The URL can be used to link to this page

7228 - Contract Executed Docusign City Council Transmittal Coversheet File Name Purchasing Contact City Council Target Date Piggy Back Option Contract Expiration Ordinance DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &"#%) #$!"'%)& ( " #*#% #'$$ % Document A141TM – 2014 Standard Form of Agreement Between Owner and Design-Builder Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 1 This document has important legal consequences. Consultation with an attorney is encouraged with respect to its completion or modification. Consultation with an attorney is also encouraged with respect to professional licensing requirements in the jurisdiction where the Project is located. AGREEMENT made as of the Twenty Fifth day of February in the year Two Thousand Twenty (In words, indicate day, month and year.) BETWEEN the Owner: (Name, legal status, address and other information) City of Denton 215 East McKinney Street Denton, TX 76201 and the Design-Builder: (Name, legal status, address and other information) Thos. S. Byrne, Inc. 551 East Berry Street Fort Worth, TX 76104 for the following Project: (Name, location and detailed description) City of Denton’s Development Services Building 401 North Elm Street Denton, TX 76201 And as further described in Exhibit "D" –Design Criteria The Owner and Design-Builder agree as follows. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 2 TABLE OF ARTICLES 1 GENERAL PROVISIONS 2 COMPENSATION AND PROGRESS PAYMENTS 3 GENERAL REQUIREMENTS OF THE WORK OF THE DESIGN-BUILD CONTRACT 4 WORK PRIOR TO EXECUTION OF THE DESIGN-BUILD AMENDMENT 5 WORK FOLLOWING EXECUTION OF THE DESIGN-BUILD AMENDMENT 6 CHANGES IN THE WORK 7 OWNER’S RESPONSIBILITIES 8 TIME 9 PAYMENT APPLICATIONS AND PROJECT COMPLETION 10 PROTECTION OF PERSONS AND PROPERTY 11 UNCOVERING AND CORRECTION OF WORK 12 COPYRIGHTS AND LICENSES 13 TERMINATION OR SUSPENSION 14 CLAIMS AND DISPUTE RESOLUTION 15 MISCELLANEOUS PROVISIONS 16 SCOPE OF THE AGREEMENT TABLE OF EXHIBITS A DESIGN-BUILD AMENDMENT B INSURANCE AND BONDS C SUSTAINABLE PROJECTS ARTICLE 1 GENERAL PROVISIONS § 1.1 Owner’s Criteria This Agreement is based on the Owner’s Criteria set forth in this Section 1.1. requirements for the Project (the "Design Criteria) set forth in Exhibit "D" – Design Criteria. (Note the disposition for the following items by inserting the requested information or a statement such as "not applicable" or "unknown at time of execution." If the Owner intends to provide a set of design documents, and the requested information is contained in the design documents, identify the design documents and insert "see Owner’s design documents" where appropriate.) § 1.1.1 The Owner’s program for the Project: (Set forth the program, identify documentation in which the program is set forth, or state the manner in which the program will be developed.) See Exhibit "D" – Design Criteria DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 3 § 1.1.2 The Owner’s design requirements for the Project and related documentation: (Identify below, or in an attached exhibit, the documentation that contains the Owner’s design requirements, including any performance specifications for the Project.) See Exhibit "D" – Design Criteria § 1.1.3 The Project’s physical characteristics: (Identify or describe, if appropriate, size, location, dimensions, or other pertinent information, such as geotechnical reports; site, boundary and topographic surveys; traffic and utility studies; availability of public and private utilities and services; legal description of the site; etc.) See Exhibit "D" – Design Criteria § 1.1.4 The Owner’s anticipated Sustainable Objective for the Project, if any: (Identify the Owner’s Sustainable Objective for the Project such as Sustainability Certification, benefit to the environment, enhancement to the health and well-being of building occupants, or improvement of energy efficiency. If the Owner identifies a Sustainable Objective, incorporate AIA Document A141™–2014, Exhibit C, Sustainable Projects, into this Agreement to define the terms, conditions and Work related to the Owner’s Sustainable Objective.) See Exhibit "D" – Design Criteria § 1.1.5 Incentive programs the Owner intends to pursue for the Project, including those related to the Sustainable Objective, and any deadlines for receiving the incentives that are dependent on, or related to, the Design-Builder’s services, are as follows:excluded. (Identify incentive programs the Owner intends to pursue for the Project and deadlines for submitting or applying for the incentive programs.) § 1.1.6 The Owner’s budget Design-Builder’s conceptual estimate for the Work to be provided by the Design-Builder is set forth below: below in: (Provide total for Owner’s budget, and if known, a line item breakdown of costs.) Exhibit "E" – Control Estimate #1 § 1.1.7 The Owner’s design and construction milestone dates:Design-Builder’s design and construction milestone dates are attached as Exhibit "F.2" – Design-Builder’s Project Schedule: .1 Design phase milestone dates: See Exhibit "F.2" – Design-Builder’s Project Schedule .2 Submission of Design-Builder Proposal: See Exhibit "F.2" – Design-Builder’s Project Schedule .3 Phased completion dates: See Exhibit "F.2" – Design-Builder’s Project Schedule .4 Substantial Completion date: See Exhibit "F.2" – Design-Builder’s Project Schedule .5 Other milestone dates: See Exhibit "F.2" – Design-Builder’s Project Schedule DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 4 § 1.1.8 The Owner requires the Design-Builder to retain the following an Architect, Consultants and Contractors at the Design-Builder’s cost:cost as necessary to complete the Work: (List name, legal status, address and other information.) .1 Architect See Exhibit "G" – Key Firms and Personnel .2 Consultants See Exhibit "G" – Key Firms and Personnel .3 Contractors See Exhibit "G" – Key Firms and Personnel § 1.1.9 Additional Owner’s Criteria upon which the Agreement is based: (Identify special characteristics or needs of the Project not identified elsewhere, such as historic preservation requirements.) See Exhibit "D" – Design Criteria § 1.1.10 The Design-Builder shall confirm that the information included in the Owner’s Criteria is, without limitation, sufficient; reasonably achievable; and complies with applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities. § 1.1.10.1 If the Owner’s Criteria is not sufficient; reasonably achievable; or conflicts with applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities, the Design-Builder shall notify the Owner of the conflict. the conflict in writing, together with the Design-Builder’s recommendations for modifications to resolve such conflicts, as further described in Section 4.2.2. § 1.1.11 If there is a change in the Owner’s Criteria, the Owner and the Design-Builder shall execute a Modification in accordance with Article 6. § 1.1.12 If the Owner and Design-Builder intend to transmit Instruments of Service or any other information or documentation in digital form, they shall endeavor to establish necessary protocols governing such transmissions. Unless otherwise agreed, the parties will use AIA Document E203™–2013 to establish the protocols for the development, use, transmission, and exchange of digital data and building information modeling. § 1.2 Project Team § 1.2.1 The Owner identifies the following representative in accordance with Section 7.1.1: (List name, address and other information.) Larry Chan City of Denton 869 South Woodrow Ln Denton, TX 76201 Larry.Chan@cityofdenton.com (940)-349-7755 § 1.2.2 The persons or entities, in addition to the Owner’s representative, who are required to review the Design-Builder’s Submittals are as follows: (List name, address and other information.) Debbie Fulwiler Elements of Architecture DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 5 1201 6th Ave, Suite 100 Fort Worth, TX 76104 dfulwiler@elementsofarc.com (817)-333-2880 § 1.2.3 The Owner will retain the following consultants and separate contractors: (List discipline, scope of work, and, if known, identify by name and address.) .1 Geotechnical Engineer .2 Commissioning Agent § 1.2.4 The Design-Builder identifies the following representative in accordance with Section 3.1.2: (List name, address and other information.) Martin Lehman Thos. S Byrne, Inc 551 East Berry St. Fort Worth, TX 76104 mlehman@tsbyrne.com (817)-335-3394 § 1.2.5 Neither the Owner’s nor the Design-Builder’s representative shall be changed without ten (10) days’ written notice to the other party. The Design-Builder’s proposed replacement representative shall be approved by the Owner in writing prior to being assigned to the project. Such Owner’s approval shall not be unreasonably withheld. § 1.3 Binding Dispute Resolution For any Claim subject to, but not resolved by, mediation pursuant to Section 14.3, the method of binding dispute resolution shall be the following: (Check the appropriate box. If the Owner and Design-Builder do not select a method of binding dispute resolution below, or do not subsequently agree in writing to a binding dispute resolution other than litigation, Claims will be resolved by litigation in a court of competent jurisdiction.) [ ]Arbitration pursuant to Section 14.4 [ X ]Litigation in a court of competent jurisdiction [ ]Other: (Specify) § 1.4 Definitions § 1.4.1 Design-Build Documents. The Design-Build Documents consist of this Agreement between Owner and Design-Builder and its attached Exhibits (hereinafter, the "Agreement"); other documents listed in the documents defined in Article 16 of this Agreement, other documents listed in and incorporated into this Agreement; and Modifications issued after execution of this Agreement. A Modification is (1) a written amendment to the Contract signed by both parties, including the Design-Build Amendment, (2) a Change Order, or (3) a Change Directive. § 1.4.2 The Contract. The Design-Build Documents form the Contract. The Contract represents the entire and integrated agreement between the parties and supersedes prior negotiations, representations or agreements, either written or oral. The Contract may be amended or modified only by a Modification. The Design-Build Documents shall not be construed to create a contractual relationship of any kind between any persons or entities other than the Owner and the Design-Builder. § 1.4.3 The Work. The term "Work" means the design, construction and related services required to fulfill the Design-Builder’s obligations under the Design-Build Documents, whether completed or partially completed, and includes all labor, materials, equipment and services provided or to be provided by the Design-Builder. equipment, supplies, skill, supervision, transportation, support services, facilities and other resources necessary or proper or incidental to the carrying out and completion of the terms of the contract and all other items of cost or value needed to DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 6 produce, construct and fully complete the Work identified by the Design-Build Documents. The Work may constitute the whole or a part of the Project. § 1.4.4 The Project. The Project is the total design and construction of which the Work performed under the Design-Build Documents may be the whole or a part, and may include design and construction by the Owner and by separate contractors. § 1.4.5 Instruments of Service. Instruments of Service Design Documents. Design Documents are representations, in any medium of expression now known or later developed, of the tangible and intangible creative work performed by the Design-Builder, Contractor(s), Architect, and Consultant(s) under their respective agreements. Instruments of Service Design Documents may include, without limitation, studies, surveys, models, sketches, drawings, specifications, digital models and other similar materials. § 1.4.6 Submittal. A Submittal is any submission to the Owner for review and approval demonstrating how the Design-Builder proposes to conform to the Design-Build Documents for those portions of the Work for which the Design-Build Documents require Submittals. Submittals include, but are not limited to, shop drawings, product data, and samples. Submittals are not Design-Build Documents unless incorporated into a Modification. § 1.4.7 Owner. The Owner is the person or entity identified as such in the Agreement and is referred to throughout the Design-Build Documents as if singular in number. The term "Owner" means the Owner or the Owner’s authorized representative.representative, including by not limited to the Owner’s Independent Representative defined in Section 1.4.16. § 1.4.8 Design-Builder. The Design-Builder is the person or entity identified as such in the Agreement and is referred to throughout the Design-Build Documents as if singular in number. The term "Design-Builder" means the Design-Builder or the Design-Builder’s authorized representative. § 1.4.9 Consultant. A Consultant is a person or entity providing professional services for the Design-Builder for all or a portion of the Work, and is referred to throughout the Design-Build Documents as if singular in number. To the extent required by the relevant jurisdiction, the Consultant shall be lawfully licensed to provide the required professional services. § 1.4.10 Architect. The Architect is a person or entity providing design services for the Design-Builder for all or a portion of the Work, and is lawfully licensed to practice architecture in the applicable jurisdiction. The Architect is referred to throughout the Design-Build Documents as if singular in number. § 1.4.11 Contractor. A Contractor is a person or entity performing all or a portion of the construction, required in connection with the Work, for the Design-Builder. The Contractor shall be lawfully licensed, if required in the jurisdiction where the Project is located. The Contractor is referred to throughout the Design-Build Documents as if singular in number and means a Contractor Contractor; a Subcontractor of or vendor to the Contractor; or an authorized representative of the Contractor. § 1.4.12 Confidential Information. Confidential Information is information containing confidential or business proprietary information that is clearly marked as "confidential." § 1.4.13 Contract Time. Unless otherwise provided, Contract Time is the period of time, including authorized adjustments, as set forth in the Design-Build Amendment for Substantial Completion of the Work. § 1.4.14 Day. The term "day" as used in the Design-Build Documents shall mean calendar day unless otherwise specifically defined. § 1.4.15 Contract Sum. The Contract Sum is the amount to be paid to the Design-Builder for performance of the Work after execution of the Design-Build Amendment, as identified in Article A.1 of the Design-Build Amendment. § 1.4.16 Owner’s Independent Representative Pursuant to and in accordance with Chapter 2269 of the Texas Government Code, the Owner has selected or designated an architect or engineer independent of the Design-Builder to act as the Owner’s representative for the DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 7 duration of the project. This "Owner’s Independent Representative" shall provide such services as the Owner deems necessary to protect its interests, and comply with statutory requirements. The Owner’s Independent Representative shall provide review and recommendation services, but shall not have the authority to execute Modifications or other documents on behalf of the Owner that change the Contract Time or Contract Sum. § 1.4.17 Design Criteria The information in Exhibit D - Design Criteria specifies criteria the Owner considers necessary to describe the project. It may (or may not) include, as appropriate to the project, the legal description of the site, survey information concerning the site, interior space requirements, special material requirements, material quality standards, conceptual criteria for the project, special equipment requirements, cost or budget estimates, time schedules, quality assurance and quality control requirements, site development requirements, applicable codes and ordinances, provisions for utilities, parking requirements, and any other requirements the Owner, at its sole discretion believes the Design-Builder requires to describe the project. The Owner, by providing the Design Criteria, makes no representation or warranty the information in it is complete; unambiguous; or in compliance with current design, engineering, or code and statutory requirements. The Owner does not warrant and will not be held responsible for errors or omissions in the Design Criteria not specifically identified in the Design-Builder’s report required by Section 4.2.2. § 1.4.18 The Drawings The Drawings are the graphic and pictorial portions of the Design-Build Documents showing the design, location and dimensions of the Work, generally including plans, elevations, sections, details, schedules, and diagrams. § 1.4.19 The Specifications The Specifications are that portion of the Design-Build Documents consisting of the written requirements for materials, equipment, systems, standards and workmanship for the Work, and performance of related services. § 1.4.20 The Indemnitees The Owner, which includes the Mayor, members of the City Council, employees, agents, assigns, and other city officers, the Owner’s consultants and the Owner’s Independent Representative or the agents and employees of any of them shall hereafter be collectively known as the "Indemnitees". § 1.4.21 Construction Management Plan The Construction Management Plan is prepared by the Design-Builder for its use in managing the Work and is not a Contract Document. The Construction Management Plan must include, at a minimum and without limitation, the following separate deliverables, which are subject to review and approval by the Owner: .1 Safety and Logistics Plan; .2 Design-Builder’s Construction Schedule; .3 Cost Management Plan, Control Estimate and Schedule of Values; .4 Quality Management, Commissioning and Turnover Plan; and .5 Information Management System. § 1.4.22 As-Built Documents The As-Built Documents are the Drawings, Specifications, and addenda thereto that may be updated by the Design-Builder to accurately reflect the actual Work in place, including without limitation, the incorporation of Change Orders, responses to the Design-Builder’s requests for information, Architect’s supplemental instructions, field modifications, and other similar changes made to the Work during construction. The As-Built documents shall conform to the format and compatibility requirements of Section 12.4. § 1.4.23 Work Breakdown Structure The project’s Work Breakdown Structure ("WBS") is a deliverable-oriented, hierarchical organization of the Project components to be executed by the Owner, and its accompanying numbering system. The WBS will be mutually agreed upon by the Owner and used by the Design-Builder. § 1.4.24 Equal to (or Approved Equal) Products by manufacturers and information about those products other than those products required to meet the Design Criteria which the Design-Builder may submit for substitution as equal to those products required to meet in DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 8 the Design Criteria; which may be incorporated in the Work after review and acceptance by the Owner and Owner’s Independent Representative. § 1.4.25 Force Majeure An act of God, fire, tornado, hurricane, flood, earthquake, explosion, war on American soil, civil disturbance, labor strikes, and similar unavoidable circumstances beyond Design-Builder’s control, not caused by the negligent act or omission of Design-Builder or breach of this Agreement, the Architect, the Contractor, its Subcontractors, or anyone else for whom Design-Builder is responsible, and not caused by Design-Builder’s breach of a project labor or a "no strike" agreement. § 1.4.26 Knowledge The terms "knowledge," "recognize" and "discover," their respective derivatives and similar terms in the Design-Build Documents, as used in reference to the Design-Builder, shall be interpreted to mean that which the Design-Builder knows or should know, recognizes or should recognize and discovers or should discover in exercising the care, skill, and diligence of a diligent and prudent design-builder familiar with the Work. Analogously, the expression "reasonably inferable" and similar terms in the Design-Build Documents shall be interpreted to mean reasonably inferable by a diligent and prudent design-builder familiar with the Work and in accordance with nationally recognized standards in the construction profession. ARTICLE 2 COMPENSATION AND PROGRESS PAYMENTS § 2.1 Compensation for Work Performed Prior To Execution of Design-Build Amendment § 2.1.1 Unless otherwise agreed, payments for Work performed prior to Execution of the Design-Build Amendment shall be made monthly. For the Design-Builder’s performance of Work prior to the execution of the Design-Build Amendment, the Owner shall compensate the Design-Builder as follows: (Insert amount of, or basis for, compensation, including compensation for any Sustainability Services, or indicate the exhibit in which the information is provided. If there will be a limit on the total amount of compensation for Work performed prior to the execution of the Design-Build Amendment, state the amount of the limit.) See Exhibit "H" – Design-Builder’s Fee & Cost Proposal § 2.1.2 The hourly billing rates for services of the Design-Builder and the Design-Builder’s Architect, Consultants and Contractors, if any, are set forth below. (If applicable, attach an exhibit of hourly billing rates or insert them below.) See Exhibit "I" – Billing Rates Individual or Position Rate Not Used § 2.1.3 Compensation for Reimbursable Expenses Prior To Execution of Design-Build Amendment § 2.1.3.1 Reimbursable Expenses are in addition to compensation set forth in Section 2.1.1 and 2.1.2 and include expenses, directly related to the Project, incurred by the Design-Builder and the Design-Builder’s Architect, Consultants, and Contractors, as follows: .1 Transportation and authorized out-of-town travel and subsistence; .2 Dedicated data and communication services, teleconferences, Project web sites, and extranets; .3 Fees paid for securing approval of authorities having jurisdiction over the Project; .4 Printing, reproductions, plots, standard form documents; .5 Postage, handling and delivery; .6 Expense of overtime work requiring higher than regular rates, if authorized in advance by the Owner; .7 Renderings, physical models, mock-ups, professional photography, and presentation materials requested by the Owner; and .8 All taxes levied on professional services and on reimbursable expenses; and .9 Other Project-related expenditures, if authorized in advance by the Owner. § 2.1.3.2 For Reimbursable Expenses, Expenses prior to the execution of the Design-Build Amendment, the compensation shall be the expenses the Design-Builder and the Design-Builder’s Architect, Consultants and Contractors incurred, plus an administrative fee of percent ( %) of the expenses incurred.incurred; will be billed at DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 9 actual cost as supported by receipts and other similar documentation; and will not exceed the topset shown in Exhibit "H" – Design-Builder’s Fee & Cost Proposal. § 2.1.4 Payments to the Design-Builder Prior To Execution of Design-Build Amendment § 2.1.4.1 Payments are due and payable upon presentation of the Design-Builder’s invoice. Amounts unpaid ( ) days after the invoice date shall bear interest at the rate entered below, or in the absence thereof at the legal rate prevailing from time to time at the principal place of business of the Design-Builder. (Insert rate of monthly or annual interest agreed upon.) % within thirty (30) days of the submission of the Design-Builder’s properly formatted invoice. Amounts unpaid shall bear interest at the legal rate allowed by Texas Government Code Ch. 2251. § 2.1.4.2 Records of Reimbursable Expenses and services performed on the basis of hourly rates shall be available to the Owner at mutually convenient times for a period of two years following execution of the Design-Build Amendment Work or termination of this Agreement, whichever occurs first. § 2.2 Contract Sum and Payment for Work Performed After Execution of Design-Build Amendment For the Design-Builder’s performance of the Work after execution of the Design-Build Amendment, the Owner shall pay to the Design-Builder the Contract Sum in current funds as agreed in the Design-Build Amendment. ARTICLE 3 GENERAL REQUIREMENTS OF THE WORK OF THE DESIGN-BUILD CONTRACT § 3.1 General § 3.1.1 The Design-Builder shall comply with any applicable licensing requirements in the jurisdiction where the Project is located. located, Denton, Texas. § 3.1.2 The Design-Builder shall designate in writing a representative who is authorized to act on the Design-Builder’s behalf with respect to the Project. § 3.1.3 The Design-Builder shall perform the Work in accordance with the Design-Build Documents. The Design-Builder shall not be relieved of the obligation to perform the Work in accordance with the Design-Build Documents by the activities, tests, inspections or approvals of the Owner. § 3.1.3.1 The Design-Builder shall perform the Work in compliance with applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities. If the Design-Builder performs Work contrary to applicable laws, statutes, ordinances, codes, rules and regulations, and lawful orders of public authorities, the Design-Builder shall assume responsibility for such Work and shall bear the costs attributable to correction.in a good workmanlike manner, fully execute the Work described in, and reasonably inferable from the Design-Build Documents. The Design-Builder shall at its sole cost, risk, and expense construct, equip, provide purchase, pay for, and furnish all of the Work necessary to provide the results intended by the Design-Build Documents, except as specifically indicated in the Design-Build Documents to be the responsibility of others. The Work shall be in accordance with such Design-Build Documents, as well as all local, state and federal governmental codes, ordinances and regulations as they apply to performance of the Work. § 3.1.3.2 Neither the Design-Builder nor any Contractor, Consultant, or Architect shall be obligated to perform any act which they believe will violate any applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities. If the Design-Builder determines that implementation of any instruction received from the Owner, including those in the Owner’s Exhibit "D" – Design Criteria, would cause a violation of any applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities, the Design-Builder shall notify the Owner in writing. writing, together with the Design-Builder’s written recommendation for modifying Exhibit "D" – Design Criteria to eliminate such violation. Upon verification by the Owner that a change to the Owner’s Exhibit "D" – Design Criteria is required to remedy the violation, the Owner and the Design-Builder shall execute a Modification in accordance with Article 6. § 3.1.3.3 The Design-Builder shall not be entitled to any adjustments in the Contract Sum or the Contract Time as a result of any action, or failure to act, in connection with any work or other services performed by the Design-Builder, or any entity affiliated with the Design-Builder, for portions of the Project other than the Work, such as, without DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 10 limitation, other projects for this Owner or nearby this site, whether such work or other services are performed under contract with the Owner or an independent third party. § 3.1.3.4 The Design-Builder shall proceed with performance of the Work as required by the Design-Build Documents and shall not modify such requirements in accordance with any substitution request, value engineering, or other recommendations unless such recommendations are accepted by the Owner in a Modification. The Design-Builder shall not be entitled to receive any additional fees as a result of substitution request, value engineering, or other recommendations submitted by the Design-Builder. § 3.1.3.5 During the performance of the Work including, but not limited to, weekends, evenings and nights, or as otherwise reasonably and mutually agreed in writing with the Owner, until all punch list items have been completed, the Design-Builder shall keep a competent superintendent at the Project site, fully authorized to act on behalf of the Design-Builder. Notice from the Owner to such superintendent, in connection with defective Work, instructions for performance of the work or any and all other issues arising under this Agreement shall be considered notice of such issues to the Design-Builder. § 3.1.3.6 All of the Design-Builder’s proposed on-site personnel must be approved by the Owner. The Design-Builder shall not employ a proposed superintendent to whom the Owner has made reasonable and timely objection. The Design-Builder shall not change the superintendent without the Owner’s consent, which shall not unreasonably be withheld or delayed. Substitution or other significant personnel changes which may affect the Design-Builder’s on-site personnel must be preceded by written notification of the Owner no less than seven (7) business days before the anticipated event. Such proposed changes must be approved by the Owner. The Design-Builder shall designate a second person in charge in writing in the event the superintendent is temporarily absent due to illness, vacation, or any other cause(s). § 3.1.4 The Design-Builder shall be responsible to the Owner for acts and omissions of the Design-Builder’s employees, Architect, Consultants, Contractors, and their agents and employees, and other persons or entities performing portions of the Work. § 3.1.5 General Consultation. The Design-Builder shall schedule and conduct periodic meetings with the Owner to review matters such as procedures, progress, coordination, and scheduling of the Work. § 3.1.6 When applicable law requires that services be performed by licensed professionals, the Design-Builder shall provide those services through qualified, licensed professionals. The Owner understands and agrees and Design-Builder agree that the services of the Design-Builder’s Architect and the Design-Builder’s other Consultants are performed in the sole interest of, and for the exclusive benefit of, the Design-Builder.Owner. § 3.1.7 The Design-Builder, with the assistance of the Owner, shall prepare and file documents required to obtain necessary approvals of governmental authorities having jurisdiction over the Project. § 3.1.8 Progress Reports § 3.1.8.1 The Design-Builder shall keep the Owner informed of the progress and quality of the Work. On a monthly basis, or otherwise as agreed to by the Owner and Design-Builder, the Design-Builder shall submit written progress reports to the Owner, showing estimated percentages of completion and other information identified below: .1 Work completed for the period; .2 Project schedule status; .3 Submittal schedule and status report, including a summary of outstanding Submittals; .4 Responses to requests for information to be provided by the Owner; .5 Approved Change Orders and Change Directives; .6 Pending Change Order and Change Directive status reports; .7 Tests and inspection reports; .8 Status report of Work rejected by the Owner; .9 Status of Claims previously submitted in accordance with Article 14; .10 Cumulative total of the Cost of the Work to date including the Design-Builder’s compensation and Reimbursable Expenses, if any; .11 Current Project cash-flow and forecast reports; and .12 Additional information as agreed to by the Owner and Design-Builder. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 11 § 3.1.8.2 In addition, where the Contract Sum is the Cost of the Work with or without a Guaranteed Maximum Price, the Design-Builder shall include the following additional information in its progress reports: .1 Design-Builder’s work force report; .2 Equipment utilization report; and .3 Cost summary, comparing actual costs to updated cost estimates. § 3.1.9 Design-Builder’s Schedules § 3.1.9.1 The Design-Builder, promptly after execution of this Agreement, shall prepare and submit for the Owner’s information a schedule for the Work. The schedule, including the time required for design and construction, shall not exceed time limits current under the Design-Build Documents, shall be revised at appropriate intervals as required by the conditions of the Work and Project, shall be related to the entire Project to the extent required by the Design-Build Documents, shall provide for expeditious and practicable execution of the Work, and shall include allowances for adequate periods of time required for the Owner’s review and for approval of submissions by authorities having jurisdiction over the Project. § 3.1.9.2 The Design-Builder shall perform the Work in general accordance with the most recent schedules submitted to and approved by the Owner. § 3.1.10 Certifications. Upon the Owner’s written request, the Design-Builder shall obtain from the Architect, Consultants, and Contractors, and furnish to the Owner, certifications with respect to the documents and services provided by the Architect, Consultants, and Contractors (a) that, to the best of their knowledge, information and belief, the documents or services to which the certifications relate (i) are consistent with the Design-Build Documents, except to the extent specifically identified in the certificate, and (ii) comply with applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities governing the design of the Project; and (b) that the Owner and its consultants shall be entitled to rely upon the accuracy of the representations and statements contained in the certifications. The Design-Builder’s Architect, Consultants, and Contractors shall not be required to execute certificates or consents that would require knowledge, services or responsibilities beyond the scope of their services. § 3.1.11 Design-Builder’s Submittals § 3.1.11.1 Prior No less than thirty (30) days prior to submission of any Submittals, the Design-Builder shall prepare a Submittal schedule, and shall submit the schedule for the Owner’s and Owner’s Independent Representative’s approval. The Owner’s and Owner’s Independent Representative’s approval shall not unreasonably be delayed or withheld. The Submittal schedule shall (1) be coordinated with the Design-Builder’s schedule provided in Section 3.1.9.1, (2) allow the Owner and Owner’s Independent Representative reasonable time to review Submittals, and (3) be periodically updated to reflect the progress of the Work. If the Design-Builder fails to submit a Submittal schedule, the Design-Builder shall not be entitled to any increase in Contract Sum or extension of Contract Time based on the time required for review of Submittals. § 3.1.11.2 By providing Submittals the Design-Builder represents to the Owner that it has (1) reviewed and approved them, (2) determined and verified materials, field measurements and field construction criteria related thereto, or will do so and (3) checked and coordinated the information contained within such Submittals with the requirements of local, State and Federal codes, statutes, ordinances, and all authorities having jurisdiction; the Work and of the Design-Build Documents. § 3.1.11.3 The Design-Builder shall perform no portion of the Work for which the Design-Build Documents require Submittals until the Owner has approved and Owner’s Independent Representative has reviewed the respective Submittal. § 3.1.11.4 The Work shall be in accordance with approved reviewed Submittals except that the Design-Builder shall not be relieved of its responsibility to perform the Work consistent with the requirements of the Design-Build Documents. The Work may deviate from the Design-Build Documents only if the Design-Builder has notified the Owner in writing of a deviation from the Design-Build Documents Documents, and the impact of such deviation on the Owner’s future costs of ownership at the time of the Submittal and a Modification is executed authorizing the identified deviation. The Design-Builder shall not be relieved of responsibility for errors or omissions in Submittals by the Owner’s approval and Owner’s Independent Representative’s review of the Submittals. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 12 § 3.1.11.5 All professional design services or certifications to be provided by the Design-Builder, including all drawings, calculations, specifications, certifications, shop drawings and other Submittals, shall contain the signature and seal of the licensed design professional preparing them. Submittals related to the Work designed or certified by the licensed design professionals, if prepared by others, shall bear the licensed design professional’s written approval. The Owner and its consultants shall be entitled to rely upon the adequacy, accuracy and completeness of the services, certifications or approvals performed by such design professionals. § 3.1.12 Warranty. The Design-Builder warrants to the Owner that materials and equipment furnished under the Contract will be of good quality and new unless the Design-Build Documents require or permit otherwise. The Design-Builder further warrants that the Work will conform to the requirements of the Design-Build Documents and will be free from defects, except for those inherent in the quality of the Work or otherwise expressly permitted by the Design-Build Documents. Work, materials, or equipment not conforming to these requirements may be considered defective. The Design-Builder’s warranty excludes remedy for damage or defect caused by abuse, alterations to the Work not executed by the Design-Builder, improper or insufficient maintenance, improper operation, or normal wear and tear and normal usage. If required by the Owner, the Design-Builder shall furnish satisfactory evidence as to the kind and quality of materials and equipment. THE DESIGN-BUILDER SHALL DEFEND AND HOLD THE OWNER HARMLESS AGAINST ANY CLAIM, DEMAND, LOSS, OR DAMAGE BY ANY BREACH OF THIS WARRANTY, AND DESIGN-BUILDER ACKNOWLEDGES IT SHALL NOT LIMIT SUCH WARRANTY BY THE PROVISIONS OF SECTION 11.2. § 3.1.12.1 All material, equipment, or other special warranties required by the Design-Build Documents shall be issued in the name of the Owner and shall commence in accordance with Section 9.8.5. § 3.1.12.2 When written warranties are specified, the document shall include the following information: Name and address of Project and Owner; Article, materials, or systems covered; Name and address of Installer; Name and address of Design-Builder; and Signature of individual authorized to sign contracts for the company issuing the warranty. § 3.1.12.3 The following minimum warranty terms shall be incorporated: .1 Duration shall be one year or as otherwise specified, dated from the Date of Substantial Completion; .2 The article, material or system is free from defective materials and workmanship; .3 Costs of repair or replacement shall not accrue to the Owner, including without limitation repair or replacement of other work disturbed by, or because of, repair or replacement; and .4 The warranty period of one year, or as otherwise specified, shall recommence upon the identification and completion by Design-Builder and acceptance by Owner of any warranty claim during the initial one-year warranty period. § 3.1.12.4 Warranties which are provided by a manufacturer for its product shall be received by the Design-Builder, filled out and filed with the manufacturer or other appropriate entity for the Owner. Certificates or registration stubs shall be included with the record documents submitted for the Owner upon completion of the Work. The Owner shall administrate manufacturer’s warranties/guarantees after expiration of the Design-Builder’s warranty. § 3.1.12.5 Temporary or trial usage by the Owner of any mechanical device, machinery, apparatus, equipment, or any work or material supplied under the Design-Build Documents before final completion and written acceptance by the Owner shall not be construed as evidence of the Owner’s acceptance of same, or the commencement of any warranty periods. § 3.1.12.6 The Owner has the privilege of such temporary or trial usage, for such reasonable time as the Owner deems proper. The Design-Builder shall make no claims for damage or injury to, or breaking of, any parts of such work which may be caused by weakness or insufficiency of structural parts, or by defective materials or workmanship. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 13 § 3.1.12.7 The Design-Builder may, without cost to the Owner, make such trial usage. However, trials shall only be conducted with the Design-Builder’s prior approval and under its observation as may be required by either of them. Equipment and/or materials shall be replaced or returned to "as new" condition prior to acceptance by the Owner. § 3.1.12.8 The Design-Builder agrees to assign to the Owner at the time of final completion of the Work any and all manufacturer’s warranties relating to materials and labor used in the Work and further agrees to perform the Work in such manner so as to preserve any and all such manufacturer’s warranties. § 3.1.12.9 If necessary as a matter of law, the Design-Builder may retain the right to enforce directly any such manufacturers’ warranties during the one (1) year period following the date of Substantial Completion described in Section 12.2.2. § 3.1.13 Royalties, Patents and Copyrights § 3.1.13.1 The Design-Builder shall pay all royalties and license fees. § 3.1.13.2 The Design-Builder shall defend suits or claims for infringement of copyrights and patent rights and shall hold the Owner and its separate contractors and consultants harmless from loss on account thereof, but shall not be responsible for such defense or loss when a particular design, process or product of a particular manufacturer or manufacturers is required by the Owner, or where the copyright violations are required in the Owner’s Exhibit "D" – Design Criteria. However, if the Design-Builder has reason to believe that the design, process or product required in the Owner’s Criteria is an infringement of a copyright or a patent, the Design-Builder shall be responsible for such loss unless such information is promptly furnished to the Owner. Owner in writing. If the Owner receives notice from a patent or copyright owner of an alleged violation of a patent or copyright, attributable to the Design-Builder, the Owner shall give prompt written notice to the Design-Builder. § 3.1.14 Indemnification § 3.1.14.1 To the fullest extent permitted by law, the Design-Builder shall indemnify and hold harmless the Owner, including the Owner’s agents and employees, from and against claims, damages, losses and expenses, including but not limited to attorneys’ fees, arising out of or resulting from performance of the Work, but only to the extent caused by the negligent acts or omissions of the Design-Builder, Architect, a Consultant, a Contractor, or anyone directly or indirectly employed by them or anyone for whose acts they may be liable. Such obligation shall not be construed to negate, abridge, or reduce other rights or obligations of indemnity that would otherwise exist as to a party or person described in this Section 3.1.14.TO THE FULLEST EXTENT PERMITTED BY LAW, THE DESIGN-BUILDER SHALL INDEMNIFY AND HOLD HARMLESS THE INDEMNITEES AS DEFINED IN SECTION 1.4.20 FROM AND AGAINST CLAIMS, DAMAGES, LOSSES AND EXPENSES, INCLUDING BUT NOT LIMITED TO ATTORNEYS’ FEES, ARISING OUT OF OR RESULTING FROM PERFORMANCE OF THE WORK, BUT ONLY TO THE EXTENT CAUSED BY THE NEGLIGENT ACTS OR OMISSIONS OF THE DESIGN-BUILDER, ARCHITECT, CONSULTANT, CONTRACTOR, OR ANYONE DIRECTLY OR INDIRECTLY EMPLOYED BY THEM OR ANYONE FOR WHOSE ACTS THEY MAY BE LIABLE. SUCH OBLIGATION SHALL NOT BE CONSTRUED TO NEGATE, ABRIDGE, OR REDUCE OTHER RIGHTS OR OBLIGATIONS OF INDEMNITY WHICH WOULD OTHERWISE EXIST AS TO A PARTY OR PERSON DESCRIBED IN THIS SECTION 3.1.14. § 3.1.14.2 The indemnification obligation under this Section 3.1.14 shall not be limited by a limitation on amount or type of damages, compensation, or benefits payable by or for Design-Builder, Architect, a Consultant, a Contractor, or anyone directly or indirectly employed by them, under workers’ compensation acts, disability benefit acts or other employee benefit acts.THE INDEMNIFICATION OBLIGATION UNDER THIS SECTION 3.1.14 SHALL NOT BE LIMITED BY A LIMITATION ON AMOUNT OR TYPE OF DAMAGES, COMPENSATION, OR BENEFITS PAYABLE BY OR FOR DESIGN-BUILDER, ARCHITECT, CONSULTANT, CONTRACTOR, OR ANYONE DIRECTLY OR INDIRECTLY EMPLOYED BY THEM, UNDER WORKERS’ COMPENSATION ACTS, DISABILITY BENEFIT ACTS OR OTHER EMPLOYEE BENEFIT ACTS. § 3.1.14.3 THE DESIGN-BUILDER’S INDEMNITY OBLIGATIONS UNDER THIS SECTION 3.1.14 SHALL ALSO SPECIFICALLY INCLUDE, WITHOUT LIMITATION, ALL FINES, PENALTIES, DAMAGES, LIABILITY, SAFETY VIOLATIONS, COSTS, EXPENSES (INCLUDING, WITHOUT LIMITATION, REASONABLE ATTORNEYS’ FEES), AND PUNITIVE DAMAGES (IF ANY) ARISING OUT OF, OR IN CONNECTION WITH ANY: DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 14 .1 VIOLATION OF OR FAILURE COMPLY WITH ANY LAW, STATUTE, ORDINANCE, RULE, REGULATION, CODE OR REQUIREMENT OF A PUBLIC AUTHORITY THAT BEARS UPON THE PERFORMANCE OF THE WORK BY THE DESIGN-BUILDER, A SUBCONTRACTOR OR ANY PERSON OR ENTITY FOR WHOM EITHER IS RESPONSIBLE; .2 MEANS, PROCEDURES, TECHNIQUES, SAFETY PRECAUTIONS, OR SEQUENCES OF EXECUTION OR PERFORMANCE OF THE WORK; AND .3 FAILURE TO SECURE AND PAY FOR PERMITS, FEES, APPROVALS, LICENSES, AND INSPECTION AS REQUIRED UNDER THE DESIGN-BUILD DOCUMENTS, OR ANY VIOLATION OF ANY PERMIT OR OTHER APPROVAL OF A PUBLIC AUTHORITY APPLICABLE TO THE WORK, BY THE DESIGN-BUILDER, A SUBCONTRACTOR, OR ANY PERSON OR ENTITY FOR WHOM EITHER IS RESPONSIBLE. § 3.1.14.4 THE DESIGN-BUILDER SHALL INDEMNIFY AND HOLD HARMLESS ALL OF THE INDEMNITEES AS DEFINED IN SECTION 1.4.20 FROM AND AGAINST ANY COSTS AND EXPENSES (INCLUDING REASONABLE ATTORNEYS’ FEES) INCURRED BY ANY OF THE INDEMNITEES IN ENFORCING ANY OF THE DESIGN-BUILDER’S DEFENSE, INDEMNITY, AND HOLD-HARMLESS OBLIGATIONS UNDER THIS CONTRACT. § 3.1.15 Contingent Assignment of Agreements § 3.1.15.1 Each agreement for a portion of the Work is assigned by the Design-Builder to the Owner, provided that .1 assignment is effective only after termination of the Contract by the Owner for cause, pursuant to Sections 13.1.4 or 13.2.2, or termination by the Owner for convenience, pursuant to Section 13.2.4; and only for those agreements that the Owner accepts by written notification to the Design-Builder and the Architect, Consultants, and Contractors whose agreements are accepted for assignment; and .2 assignment is subject to the prior rights of the surety, if any, obligated under bond relating to the Contract. When the Owner accepts the assignment of an agreement, the Owner assumes the Design-Builder’s rights and obligations under the agreement. § 3.1.15.2 Upon such assignment, if the Work has been suspended for more than 30 thirty (30) days, the compensation under the assigned agreement shall be equitably adjusted for increases in cost resulting from the suspension. § 3.1.15.3 Upon such assignment to the Owner under this Section 3.1.15, the Owner may further assign the agreement to a successor design-builder or other entity. If the Owner assigns the agreement to a successor design-builder or other entity, the Owner shall nevertheless remain legally responsible for all of the successor design-builder’s or other entity’s obligations under the agreement. § 3.1.16 Design-Builder’s Insurance and Bonds. The Design-Builder shall purchase and maintain insurance and provide bonds as set forth in Exhibit B. ARTICLE 4 WORK PRIOR TO EXECUTION OF THE DESIGN-BUILD AMENDMENT § 4.1 General § 4.1.1 Any information submitted by the Design-Builder, and any interim decisions made by the Owner, shall be for the purpose of facilitating the design process and shall not modify the Owner’s Criteria unless the Owner and Design-Builder execute a Modification. § 4.1.2 The Design-Builder shall advise the Owner on proposed site use and improvements, selection of materials, and building systems and equipment. The Design-Builder shall also provide the Owner with recommendations, consistent with the Owner’s Criteria, on constructability; availability of materials and labor; time requirements for procurement, installation and construction; and factors related to construction cost including, but not limited to, costs of alternative designs or materials, preliminary budgets, life-cycle data, and possible cost reductions. § 4.2 Evaluation of the Owner’s Criteria DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 15 § 4.2.1 The Design-Builder shall schedule and conduct meetings with the Owner and any other necessary individuals or entities to discuss and review the Owner’s Criteria as set forth in Section 1.1.The Section 1.1. The Design-Builder shall thereafter again meet with the Owner to discuss a preliminary evaluation of the Owner’s Criteria. The preliminary evaluation shall address possible alternative approaches to design and construction of the Project and include the Design-Builder’s recommendations, if any, with regard to accelerated or fast-track scheduling, procurement, or phased construction. The preliminary evaluation shall consider consider, without limitation, cost information, constructability, and procurement and construction scheduling issues. § 4.2.2 After the Design-Builder meets with the Owner and presents the preliminary evaluation, the Design-Builder shall provide a written report to the Owner, summarizing the Design-Builder’s evaluation of the Owner’s Criteria. The report shall also include .1 allocations of program functions, detailing each function and their square foot areas; .2 a preliminary estimate proposed Control Estimate of the Cost of the Work, and, if necessary, recommendations to adjust the Owner’s Criteria to conform to the Owner’s budget; .3 a preliminary schedule, proposed Design-Builder’s Project Schedule, which shall include proposed design milestones; dates for receiving additional information from, or for work to be completed by, the Owner; anticipated date for the Design-Builder’s Proposal; and dates of periodic design review sessions with the Owner; and .4 the following: (List additional information, if any, to be included in the Design-Builder’s written report.) a. Anything in the Owner’s Criteria that may conflict with the requirements of local, State and Federal codes, statutes, ordinances, and all authorities having jurisdiction; b. Anything in the Owner’s Criteria that conflicts with best practices for design, engineering, or other industry standards that would prevent the Design-Builder from fully implementing and being completely responsible for their intended results; and c. Other information and draft Exhibits to this Agreement as the Owner and Design-Builder agree are appropriate in the meeting described in Section 4.2.1. § 4.2.3 The Owner shall review the Design-Builder’s written report and, if acceptable, provide the Design-Builder with written consent to proceed to the development of the Preliminary Design as described in Section 4.3. The consent to proceed shall not be understood to modify the Owner’s Criteria unless the Owner and Design-Builder execute a Modification. § 4.3 Preliminary Design § 4.3.1 Upon the Owner’s issuance of a written consent to proceed under Section 4.2.3, the Design-Builder shall prepare and submit a Preliminary Design to the Owner. The Preliminary Design shall include a report identifying any deviations from the Owner’s Criteria, and shall include the following: .1 Confirmation of the allocations of program functions; .2 Site plan; .3 Building plans, sections and elevations; .4 Structural system; .5 Selections of major building systems, including but not limited to mechanical, electrical and plumbing systems; and .6 Outline specifications or sufficient drawing notes describing construction materials.materials; and .7 Such other information the Owner and Design-Builder agree in writing to be appropriate. The Preliminary Design may include some combination of physical study models, perspective sketches, or digital modeling. § 4.3.2 The Owner and Owner’s Independent Representative shall review the Preliminary Design and, if acceptable, provide the Design-Builder with written consent to proceed to development of the Design-Builder’s Proposal. The Preliminary Design shall not modify the Owner’s Criteria unless the Owner and Design-Builder execute a Modification. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 16 § 4.4 Design-Builder’s Proposal § 4.4.1 Upon the Owner’s issuance of a written consent to proceed under Section 4.3.2, the Design-Builder shall prepare and submit the Design-Builder’s Proposal to the Owner. The Design-Builder’s Proposal shall include the following: .1 A list of the Preliminary Design documents and other information, including the Design-Builder’s clarifications, assumptions and deviations from the Owner’s Criteria, upon which the Design-Builder’s Proposal is based; .2 The proposed Contract Sum, including the compensation method and, if based upon the Cost of the Work plus a fee, a written statement of estimated proposed Control Estimate detailing cost organized by trade categories, allowances, contingencies, Design-Builder’s Fee, and other items that comprise the updates to Exhibit "H" – Design-Builder’s Fee and Cost Proposal, and other items that comprise the Control Estimate detailing the proposed Contract Sum; .3 The proposed Design-Builder’s Project Schedule showing the detailed work plan supporting date the Design-Builder shall achieve Substantial Completion; .4 An enumeration of any qualifications and exclusions, if applicable; .5 A list of the Design-Builder’s key personnel, Contractors and suppliers; andproposed Exhibit "G" – Key Firms & Personnel; .6 The date on which the Design-Builder’s Proposal expires. expires and; .7 Such other information the Owner and Design-Builder agree in writing to be appropriate. § 4.4.2 Submission of the Design-Builder’s Proposal shall constitute a representation by the Design-Builder that it has visited the site and become familiar with local conditions under which the Work is to be completed. Prior to execution of the Agreement, the Design-Builder and each Subcontractor have evaluated and satisfied themselves as to the conditions and limitations under which the Work is to be performed, including, without limitation, (i) the location, condition, layout, and nature of the Project site and surrounding areas and generally prevailing climatic conditions; (ii) anticipated labor supply and costs; (iii) availability and cost of materials, tools, and equipment; and (iv) other similar issues. The Owner assumes no responsibility or liability for the physical condition or safety of the Project site or any improvements located on the Project site. Except as set forth in Section 10.3, the Design-Builder shall be solely responsible for providing a safe place for the performance of the Work. The Owner shall not be required to make any adjustment in either the Contract Sum or the Contract Time in connection with any failure by the Design-Builder or any Subcontractor to have complied with the requirements of this Section 4.4.2. § 4.4.3 If the Owner and Design-Builder agree on a proposal, the Owner and Design-Builder shall execute the Design-Build Amendment setting forth the terms of their agreement. ARTICLE 5 WORK FOLLOWING EXECUTION OF THE DESIGN-BUILD AMENDMENT § 5.1 Construction Documents § 5.1.1 Upon the execution of the Design-Build Amendment, the Design-Builder shall prepare Construction Documents. The Construction Documents shall shall, without limitation, establish the quality levels of materials and systems required. The Construction Documents shall be consistent with the Design-Build Documents. Prior to execution of the Agreement, the Design-Builder and each Subcontractor have evaluated and satisfied themselves as to the conditions and limitations under which the Work is to be performed, including, without limitation, (i) the location, condition, layout, and nature of the Project site and surrounding areas and generally prevailing climatic conditions; (ii) anticipated labor supply and costs; (iii) availability and cost of materials, tools, and equipment; and (iv) other similar issues. The Owner assumes no responsibility or liability for the physical condition or safety of the Project site or any improvements located on the Project site. Except as set forth in Section 10.3, the Design-Builder shall be solely responsible for providing a safe place for the performance of the Work. The Owner shall not be required to make any adjustment in either the Contract Sum or the Contract Time in connection with any failure by the Design-Builder or any Subcontractor to have complied with the requirements of this Section 5.1.1. § 5.1.2 The Design-Builder shall provide the Construction Documents to the Owner for the Owner’s information. If the Owner discovers any deviations between the Construction Documents and the Design-Build Documents, the Owner shall promptly notify the Design-Builder of such deviations in writing. The Construction Documents shall not modify the Design-Build Documents unless the Owner and Design-Builder execute a Modification. The failure of the Owner to discover any such deviations shall not relieve the Design-Builder of the obligation to perform the Work in accordance with the Design-Build Documents. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 17 § 5.2 Construction § 5.2.1 Commencement. Except as permitted in Section 5.2.2, construction shall not commence prior to execution of the Design-Build Amendment.Amendment and issuance by the Owner of a written Notice to Proceed. § 5.2.2 If the Owner and Design-Builder agree in writing, construction may proceed prior to the execution of the Design-Build Amendment. However, such authorization shall not waive the Owner’s right to reject the Design-Builder’s Proposal. § 5.2.3 The Design-Builder shall supervise and direct the Work, using the Design-Builder’s best skill and attention. The Design-Builder shall be solely responsible for, and have control over, construction means, methods, techniques, sequences and procedures, and for coordinating all portions of the Work under the Contract, unless the Design-Build Documents give other specific instructions concerning these matters. § 5.2.4 The Design-Builder shall be responsible for inspection of portions of Work already performed to determine that such portions are in proper condition to receive subsequent Work. § 5.2.5 The Design-Builder shall carefully check its own work and that of Subcontractors as the work is being performed. § 5.2.6 During the finishing stages of the project, the Design-Builder shall make frequent inspections of the Work in the presence of the Owner, the Contractor, and the applicable Subcontractor(s) involved, if any, and the Architect shall identify incorrect and faulty Work. § 5.2.7 The Design-Builder shall ensure that incorrect or faulty Work is corrected immediately. § 5.2.8 The Design-Builder shall not be relieved of obligations to perform the Work in accordance with the Design-Build Documents either by activities or duties of the Owner or Architect in their administration of the Contract, or by tests, inspections or approvals required or performed by persons other than the Design-Builder. § 5.3 Labor and Materials § 5.3.1 Unless otherwise provided in the Design-Build Documents, the Design-Builder shall provide and pay for labor, materials, equipment, tools, construction equipment and machinery, water, heat, utilities, transportation, and other facilities and services, necessary for proper execution and completion of the Work, whether temporary or permanent, and whether or not incorporated or to be incorporated in the Work. § 5.3.2 When a material or system is required to meet the Design Criteria or is specified in the Design-Build Documents, the Design-Builder may make substitutions only in accordance with Article 6. The Design-Builder shall also submit to the Owner, for each proposed substitution: .1 A full explanation of the proposed substitution and submittal of all supporting data, including technical information, catalog "cut sheets", warranties, test results, installation instructions, operating procedures, and other like information necessary for a complete evaluation of the substitution; .2 A written explanation of the reasons the substitution is advantageous and necessary, including the benefits to the Owner and the Work in the event the substitution is acceptable; .3 The adjustment, if any, in the Contract Sum, in the event the substitution is acceptable; .4 The adjustment, if any, in the time of completion of the Contract and the Contractor’s Construction Schedule in the event the substitution is acceptable; and .5 Proposals for substitutions shall be submitted electronically to the Owner in sufficient time to allow no less than ten (10) business days for review. § 5.3.3 The Design-Builder shall enforce strict discipline and good order among the Design-Builder’s employees and other persons carrying out the Work. The Design-Builder shall not permit employment of unfit persons or persons not properly skilled in tasks assigned to them. Smoking and chewing of tobacco products is prohibited in enclosed new DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 18 construction. No glass bottles shall be brought on the construction site or Owner’s property by any construction personnel. § 5.3.4 All work under this Agreement shall be performed in a skillful and workmanlike manner in accordance with the highest industry standards. § 5.3.5 The Design-Builder shall only employ or use labor in connection with the Work capable of working harmoniously with all trades, crafts, and any other individuals associated with the Project. The Design-Builder shall also use best efforts to minimize the likelihood of any strike, work stoppage, or other labor disturbance. .1 If the Work is to be performed by trade unions, the Design-Builder shall make all necessary arrangements to reconcile, without delay, damage, or cost to the Owner and without recourse to the Architect or the Owner, any conflict between the Design-Build Documents and any agreements or regulations of any kind at any time in force among members or councils that regulate or distinguish the activities that shall not be included in the work of any particular trade. .2 In case the progress of the Work is affected by any undue delay in furnishing or installing any items or materials or equipment required under the Design-Build Documents because of such conflict involving any such labor agreement or regulation, the Owner may require that other material or equipment of equal kind and quality be provided pursuant to a Change Order or Construction Change Directive. § 5.3.6 Pursuant to Chapter 2258, Texas Government Code, all Contractors and any Subcontractor involved in the construction of a public work project shall pay not less than the prevailing rates as per diem wages in the locality at the time of construction to all laborers, workmen and mechanics employed by them in the execution of this contract. The Design-Builder shall assure that these requirements are met for the Project and shall insure that every contract or subcontract relating to the Work requires, on behalf of Owner, that the prevailing wage rates be paid. § 5.3.7 The Design-Builder shall be provided an applicable Department of Labor Wage Rate Determination for use on the Project required by Chapter 2258.022, Texas Government Code. § 5.4 Taxes The Design-Builder shall shall, to the extent the Owner is not exempted under this Agreement, pay sales, consumer, use and similar taxes, for the Work provided by the Design-Builder, that are legally enacted when the Design-Build Amendment is executed, whether or not yet effective or merely scheduled to go into effect. In no event should the Owner pay the Design-Builder for taxes that were not properly due and duly paid or for which the Owner is exempt from paying under Texas law. § 5.5 Permits, Fees, Notices and Compliance with Laws § 5.5.1 Unless otherwise provided in the Design-Build Documents, the Design-Builder Owner shall secure and pay for the building permit as well as any permit. The Owner shall also pay for any applicable gas, water, sewer and electrical service application fees; assessments against the property, including property tax, developmental excise and similar taxes; sewer, water, and related utility tap fees; and sewer plant improvement fees, unless exempted under Texas law. The Contractor shall secure and pay for all other permits, fees, licenses, and inspections by government agencies, necessary for proper execution of the Work and Substantial Completion of the Project. § 5.5.2 The Design-Builder shall comply with and give notices required by applicable laws, statutes, ordinances, codes, rules and regulations, and lawful orders of public authorities, applicable to performance of the Work. § 5.5.2.1 If the Design-Builder performs Work knowing it to be contrary to applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of public authorities, regardless of whether such work is in accordance with Design-Build Documents, the Design-Builder shall assume appropriate responsibility for such Work and shall bear the costs attributable to correction. Codes and ordinances shall take full and complete precedence over anything contained in the Design-Build Documents, except where the Design-Build Documents call for Work or materials of higher standards than those required by codes or ordinances, in which case, the Design-Build Documents shall govern. Nothing contained in the Design-Build Documents shall be construed as authority for the Design-Builder to violate any applicable codes or ordinances in effect at the site. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 19 § 5.5.3 Concealed or Unknown Conditions. If the Design-Builder encounters conditions at the site that are (1) subsurface or otherwise concealed physical conditions that differ materially from those indicated in the Design-Build Documents or (2) unknown physical conditions of an unusual nature that differ materially from those ordinarily found to exist and generally recognized as inherent in construction activities of the character provided for in the Design-Build Documents, the Design-Builder shall promptly provide notice to the Owner before conditions are disturbed and in no event later than 21 twenty-one (21) days after first observance of the conditions. The Owner shall promptly investigate such conditions and, if the Owner determines that they differ materially and cause an increase or decrease in the Design-Builder’s cost of, or time required for, performance of any part of the Work, shall recommend an equitable adjustment in the Contract Sum or Contract Time, or both. If the Owner determines that the conditions at the site are not materially different from those indicated in the Design-Build Documents and that no change in the terms of the Contract is justified, the Owner shall promptly notify the Design-Builder in writing, stating the reasons. If the Design-Builder disputes the Owner’s determination or recommendation, the Design-Builder may proceed as provided in Article 14. § 5.5.3.1 In no event shall any adjustment in the Contract Sum or Contract Time be made for conditions which should have been known to the Design-Builder or would have been noticed by a Design-Builder of similar size and experience pursuant to its on-site inspection; by way of or conditions referenced in any other inspections or tests concerning the site which have been made available to the Design-Builder or have been performed by the Design-Builder or its Subcontractors; are part of the Design-Build Documents; or are part of the materials provided by the Design-Builder to be used in constructing the improvements. § 5.5.4 If, in the course of the Work, the Design-Builder encounters human remains, or recognizes the existence of burial markers, archaeological sites, or wetlands, not indicated in the Design-Build Documents, the Design-Builder shall immediately suspend any operations that would affect them and shall notify the Owner. Upon receipt of such notice, the Owner shall promptly take any action necessary to obtain governmental authorization required to resume the operations. The Design-Builder shall continue to suspend such operations until otherwise instructed by the Owner but shall continue with all other operations that do not affect those remains or features. Requests for adjustments in the Contract Sum and Contract Time arising from the existence of such remains or features may be made as provided in Article 14. § 5.5.5 The Design-Builder shall comply with all applicable laws, statutes, rules, codes, orders, regulations, and ordinances, including but not limited to all applicable immigration, employment, environmental and safety laws, statutes, rules, codes, orders and regulations. § 5.6 Allowances § 5.6.1 The Design-Builder shall include in the Contract Sum all allowances stated in the Design-Build Documents. Items covered by allowances shall be supplied for such amounts, and by such persons or entities as the Owner may direct, but the Design-Builder shall not be required to employ persons or entities to whom the Design-Builder has reasonable objection. § 5.6.2 Unless otherwise provided in the Design-Build Documents, .1 allowances shall cover the cost to the Design-Builder of materials and equipment delivered at the site and all required taxes, less applicable trade discounts; .2 the Design-Builder’s costs for unloading and handling at the site, labor, installation costs, overhead, profit, and other expenses contemplated for stated allowance amounts, shall be included in the Contract Sum but not in the allowances; and .3 whenever costs are more than or less than allowances, the Contract Sum shall be adjusted accordingly by Change Order. The amount of the Change Order shall reflect (1) the difference between actual costs and the allowances under Section 5.6.2.1 and (2) changes in Design-Builder’s costs under Section 5.6.2.2. § 5.6.3 The Owner shall make selections of materials and equipment with reasonable promptness for allowances requiring Owner selection. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 20 § 5.7 Key Personnel, Contractors and Suppliers § 5.7.1 The Design-Builder shall not employ personnel, or contract with Contractors or suppliers to whom the Owner has made reasonable and timely objection. The Design-Builder shall not be required to contract with anyone to whom the Design-Builder has made reasonable and timely objection. § 5.7.2 If the Design-Builder changes any of the personnel, Contractors or suppliers identified in the Design-Build Amendment, the Design-Builder shall notify the Owner and provide the name and qualifications of the new personnel, Contractor or supplier. The Owner may reply within 14 fourteen (14) days to the Design-Builder in writing, stating (1) whether the Owner has reasonable objection to the proposed personnel, Contractor or supplier or (2) that the Owner requires additional time to review. Failure of the Owner to reply within the 14-day fourteen (14) day period shall constitute notice of no reasonable objection. § 5.7.3 Except for those persons or entities already identified or required in the Design-Build Amendment, the Design-Builder, as soon as practicable after execution of the Design-Build Amendment, shall furnish in writing to the Owner the names of persons or entities (including those who are to furnish materials or equipment fabricated to a special design) proposed for each principal portion of the Work. The Owner may reply within 14 fourteen (14) days to the Design-Builder in writing stating (1) whether the Owner has reasonable objection to any such proposed person or entity or (2) that the Owner requires additional time for review. Failure of the Owner to reply within the 14-day fourteen (14) day period shall constitute notice of no reasonable objection. § 5.7.3.1 If the Owner has reasonable objection to a person or entity proposed by the Design-Builder, the Design-Builder shall propose another to whom the Owner has no reasonable objection. If the rejected person or entity was reasonably capable of performing the Work, the Contract Sum and Contract Time shall be increased or decreased by the difference, if any, occasioned by such change, and an appropriate Change Order shall be issued before commencement of the substitute person or entity’s Work. However, no increase in the Contract Sum or Contract Time shall be allowed for such change unless the Design-Builder has acted promptly and responsively in submitting names as required. § 5.8 Documents and Submittals at the Site The Design-Builder shall maintain at the site for the Owner one copy of the Design-Build Documents and a current set of the Construction Documents, in good order and marked currently to indicate field changes and selections made during construction, and one copy of approved Submittals. The Design-Builder shall deliver these items to the Owner in accordance with Section 9.10.2 as a record of the Work as constructed. The Design-Builder shall make available to the Owner for inspection and copying the record copy of the drawings, specifications, addenda, Change Orders and other Modifications, including all such documents maintained by the Design-Builder in electronic format, upon reasonable request of the Owner and, in any event, within twenty-four (24) hours of receipt by Design-Builder of a request from Owner for such review and/or copying. The Owner may request the record copy of the As-Built Documents, specifications, addenda, Change Orders and other modifications of the Work to be updated before Substantial Completion to reflect the most current condition of the Project, as additional Cost of the Work paid as a Change Order at the Owner’s expense. The Owner may require the Design-Builder to furnish the As-Built Documents in electronic format and may make copies of them prior to completion of the Work at the Owner’s expense. § 5.9 Use of Site The Design-Builder shall confine operations at the site to areas permitted by applicable laws, statutes, ordinances, codes, rules and regulations, lawful orders of public authorities, and the Design-Build Documents, and shall not unreasonably encumber the site with materials or equipment. § 5.8.1 The Design-Builder shall provide final electronic files and one "hard" copy of the Drawings and Specifications to the Owner updated to reflect the final condition of the Project with the final Application for Payment as a condition precedent to final payment. § 5.9 Use of Site, Delivery, & Storage The Design-Builder shall confine operations at the site to areas permitted by applicable laws, statutes, ordinances, codes, rules and regulations, lawful orders of public authorities, and the Design-Build Documents, and shall not unreasonably encumber the site with materials or equipment. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 21 § 5.9.1 The Design-Builder shall coordinate the Design-Builder’s operations with, and secure the approval of, the Owner before using any portion of the site. § 5.9.2 The Design-Builder shall take reasonable precautions for the safety of, and shall provide all reasonable protection to prevent damage, injury or loss to, all persons at the Project site; all property at the Project site; and all persons or property adjacent thereto. .1 The Design-Builder acknowledges the Project site comprises and/or may be adjacent to existing structures and that these site areas may be occupied during the performance of some portions of this Contract. .2 The Work shall be performed, to the fullest extent reasonably possible, in such a manner that public areas adjacent to the site of the Work shall be free from all debris, building materials, and equipment likely to cause interference with adjacent stakeholders or create hazardous conditions. .3 The Design-Builder shall be responsible for the mitigation and/or abatement of all noise, dust, fumes, traffic or other by-product of construction activity that, in the opinion of the Owner or the Architect, have an adverse affect on the quality of life or productivity for Project stakeholders, the Owner’s current operations, or the Owner’s employees. Such mitigation and/or abatement shall be performed in manner and with a result completely and wholly acceptable to the Owner. .4 The Design-Builder shall control its personnel and the Subcontractors on site, especially regarding the use of alcohol or profanity, dressing in an inappropriate manner, parking in an inappropriate place, or other activities deemed to be inappropriate, to the satisfaction of the Owner. Repeat offenses will cause the Owner to require, through the Design-Builder, the temporary or permanent removal of the offending individuals, Subcontractor(s) or Sub-subcontractor(s) from the site. .5 The Design-Builder shall, at a minimum, secure the site by erecting and maintaining a 6’-0" chain link fence around the perimeter of the construction site. This fence shall remain intact until such time the site becomes secure in the opinion of the Design-Builder, as a result of construction progress (by way of example, and without limitation, completion of site grading and backfill, installation of doors and windows, etc.). .6 The Design-Builder shall furnish and maintain sufficient sanitary facilities for its own forces and those of any Subcontractor or Sub-subcontractor. The facilities of any existing, nearby buildings will not be available for construction use. .7 The Design-Builder is advised that the project site area is subject to, among other inclement weather, unpredictable and high winds. When all or a portion of the Work is suspended for any reason, the Design-Builder shall securely fasten down all coverings and stored materials on site and fully protect the Work, as necessary, from injury or damage by any cause and to prevent possible damage caused by flying materials and debris. § 5.9.3 The Design-Builder shall ensure that the Work, at all times, is performed in a manner that affords reasonable access, both vehicular and pedestrian, to the site of the Work and all adjacent areas. .1 The access to the site shall be maintained in compliance with all local, state, and Federal code and life safety requirements for ingress by first responders and other similar emergency requirements. .2 The Design-Builder shall inform the Owner and any officials referenced in Section 5.9.5 in writing a minimum of thirty (30) calendar days prior to any disruption of access, specifically and graphically showing the nature of the disruption, as well as the hours it will be disrupted. Such disruption will be subject to Owner’s approval, such approval not to be unreasonably withheld. .3 The Owner shall be responsible for storm debris and snow removal to the limits of the construction site only so far that the Design-Builder will have access to the entrance to the construction area. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 22 .4 Storm debris and snow removal within the limits of work and/or for the purpose of performing and protecting work by individual contractors shall be up to the Design-Builder. § 5.9.4 During the performance of the Work, the Design-Builder, its Subcontractors, Sub-subcontractors, suppliers and their employees agree they shall: .1 Use such entrances to the construction site that may be designated by the Owner; .2 Perform the Work at such times of the day and days of the week as may be designated by the Owner; and .3 Accept that these entrances and times may be reviewed and changed from time to time by the Owner. § 5.9.5 The Design-Builder shall notify all public utility companies a minimum of two (2) business days prior to the commencement of any work by it or its Subcontractors in the vicinity of the utilities. No work shall commence until the utilities have been located and staked by the utility company or written consent from the Owner to proceed has been given to the Design-Builder. If the utility service must be interrupted, the Design-Builder shall, at Design-Builder’s sole cost and expense, notify the head of the local administrative services (by way of example only, and without limitation, the city manager, the mayor, the city or county clerk, etc. as applicable) and the utility users affected by the interruption. Such notice shall consist of direct written communication, publication on the Owner’s website or in a local newspaper, and/or announcement on local radio or television stations, whichever is most reasonably calculated to give the most effective notice to such utility users. § 5.9.6 The Design-Builder shall exercise due diligence in seeing that all equipment, material, and supplies are delivered in advance of the time they are needed for the Work, and shall properly store and protect same at the Design-Builder’s expense. § 5.9.7 Notwithstanding any other provision herein, the Design-Builder shall take all necessary measures to store materials on site for which payment has been requested by the Design-Builder or been made by the Owner so that they shall not deteriorate, be damaged or be stolen. .1 Only materials and equipment that are to be used directly in the Work shall be brought to and stored on the Project site by the Design-Builder. .2 Protection of construction materials and equipment stored at the Project site from fire, weather, burglary, pilferage, vandalism and mischief, damage, and all other adversity; and the care and protection of materials and Work installed in the building is solely the responsibility of the Design-Builder. .3 The Design-Builder shall bear sole responsibility for the restoration of damaged Work and replacement of damaged or stolen materials at no additional cost to the Owner. .4 After equipment is no longer required for the Work, it shall be promptly removed from the Project site. § 5.9.8 The Design-Builder shall not deliver any materials to the site which are not to be installed by same Design-Builder without fifteen (15) day’s advance notice in writing to the Owner of the location, date, and time of such delivery to allow proper coordination. Such materials shall be received jointly by a representative of the Design-Builder and a representative of the Owner, who shall agree, and the Design-Builder shall document such agreement in writing: .1 the materials delivered are undamaged, or if damaged, such damage is documented by digital photo(s); .2 they are in the quantities shown on the purchase order, invoice or bill of lading accompanying the shipment or delivery or otherwise provided; DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 23 .3 the storage conditions are adequate for the purposes; and .4 the Design-Builder has accepted responsibility for insurance and ongoing protection per Section 10.2.8 for such material until it is released to a third party authorized in writing by the Owner to receive it. § 5.10 Cutting and Patching The Design-Builder shall not cut, patch or otherwise alter fully or partially completed construction by the Owner or a separate contractor except with written consent of the Owner and of such separate contractor; such consent shall not be unreasonably withheld. The Design-Builder shall not unreasonably withhold from the Owner or a separate contractor the Design-Builder’s consent to cutting or otherwise altering the Work. The Design-Builder shall be responsible for cutting, fitting, or patching required to complete the Work or to make its parts fit together properly. All areas requiring cutting, fitting, or patching shall be restored to the condition existing prior to the cutting, fitting, or patching, unless otherwise required by the Design-Build Documents. The Design-Builder shall not damage or endanger a portion of the Work or fully or partially completed construction of the Owner or separate contractors by cutting, patching, or otherwise altering such construction, or by excavation. § 5.11 Cleaning Up § 5.11.1 The Design-Builder shall keep the premises and surrounding area free from accumulation of waste materials or rubbish caused by operations under the Contract. Contract and shall be responsible for daily clean-up of construction materials and dust control. At completion of the Work, the Design-Builder shall remove waste materials, rubbish, the Design-Builder’s tools, construction equipment, machinery and surplus materials from and about the Project.the Project and shall clean all glass surfaces and leave the Work "broom clean", or its equivalent, except as otherwise specified. § 5.11.2 If the Design-Builder fails to clean up as provided in the Design-Build Documents, the Owner may do so and Owner shall be entitled to reimbursement from the Design-Builder. § 5.12 Access to Work The Design-Builder shall provide the Owner and its separate contractors and consultants access to the Work in preparation and progress wherever located. The Design-Builder shall notify the Owner regarding Project safety criteria and programs, which the Owner, and its contractors and consultants, shall comply with while at the site. § 5.13 Construction by Owner or by Separate Contractors § 5.13.1 Owner’s Right to Perform Construction and to Award Separate Contracts § 5.13.1.1 The Owner reserves the right to perform construction or operations related to the Project with the Owner’s own forces; and to award separate contracts in connection with other portions of the Project, or other construction or operations on the site, under terms and conditions identical or substantially similar to this Contract, including those terms and conditions related to insurance and waiver of subrogation. The Owner shall notify the Design-Builder promptly after execution of any separate contract. If the Design-Builder claims that delay or additional cost is involved because of such action by the Owner, the Design-Builder shall make a Claim as provided in Article 14. § 5.13.1.2 When separate contracts are awarded for different portions of the Project or other construction or operations on the site, the term "Design-Builder" in the Design-Build Documents in each case shall mean the individual or entity that executes each separate agreement with the Owner. § 5.13.1.3 The Owner shall provide for coordination of the activities of the Owner’s own forces, and of each separate contractor, with the Work of the Design-Builder, who shall cooperate with them. The Design-Builder shall participate with other separate contractors and the Owner in reviewing their construction schedules. The Design-Builder shall make any revisions to the construction schedule deemed necessary after a joint review and mutual agreement. The construction schedules shall then constitute the schedules to be used by the Design-Builder, separate contractors and the Owner until subsequently revised. § 5.13.1.4 Unless otherwise provided in the Design-Build Documents, when the Owner performs construction or operations related to the Project with the Owner’s own forces or separate contractors, the Owner shall be deemed to be subject to the same obligations, and to have the same rights, that apply to the Design-Builder under the Contract. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 24 § 5.13.1.5 The Design-Builder accepts assignment of, and liability for, all purchase orders and other agreements for procurement of materials and equipment that are identified as part of the Design-Build Documents. The Design-Builder shall be responsible for such pre-purchased items, if any, as if the Design-Builder were the original purchaser. The Contract Sum includes, without limitation, all costs and expenses in connection with delivery, storage, insurance, installation, and testing of items covered in any assigned purchase orders or agreements. All warranty and correction of the Work obligations under the Design-Build Documents shall also apply to any pre-purchased items, unless the Design-Build Documents specifically provide otherwise. § 5.14 Mutual Responsibility § 5.14.1 The Design-Builder shall afford the Owner and separate contractors reasonable opportunity for introduction and storage of their materials and equipment and performance of their activities, and shall connect and coordinate the Design-Builder’s construction and operations with theirs as required by the Design-Build Documents. § 5.14.2 If part of the Design-Builder’s Work depends upon construction or operations by the Owner or a separate contractor, the Design-Builder shall, prior to proceeding with that portion of the Work, prepare a written report to the Owner, identifying apparent discrepancies or defects in the construction or operations by the Owner or separate contractor that would render it unsuitable for proper execution and results of the Design-Builder’s Work. Failure of the Design-Builder to report shall constitute an acknowledgment that the Owner’s or separate contractor’s completed or partially completed construction is fit and proper to receive the Design-Builder’s Work, except as to defects not then reasonably discoverable. § 5.14.3 The Design-Builder shall reimburse the Owner for costs the Owner incurs that are payable to a separate contractor because of the Design-Builder’s delays, improperly timed activities or defective construction. The Owner shall be responsible to the Design-Builder for costs the Design-Builder incurs because of a separate contractor’s delays, improperly timed activities, damage to the Work or defective construction. § 5.14.4 The Design-Builder shall promptly remedy damage the Design-Builder wrongfully causes to completed or partially completed construction or to property of the Owner or separate contractors as provided in Section 10.2.5. § 5.14.5 The Owner and each separate contractor shall have the same responsibilities for cutting and patching the Work as the Design-Builder has with respect to the construction of the Owner or separate contractors in Section 5.10. § 5.14.6 Should the Design-Builder wrongfully delay or cause damage to the work or property of any separate contractor, the Design-Builder shall, upon due notice, promptly attempt to settle with such other contractor by agreement or otherwise to resolve the dispute. If such separate contractor sues or initiates a judicial proceeding against the Owner on account of any delay or damage alleged to have been caused by the Design-Builder, the Owner shall notify the Design-Builder who shall defend such proceedings at the Design-Builder’s expense. The Owner may fund the defense of such proceedings contemplated by this Section but, in any event, if any judgment or award against the Owner arises therefrom, the Design-Builder shall pay to satisfy it to the extent of Design-Builder’s responsibility. § 5.14.7 SHOULD ANY SUCH SEPARATE CONTRACTOR WRONGFULLY DELAYED OR DAMAGED BY THE DESIGN-BUILDER OR PERSONS FOR WHOM THE DESIGN-BUILDER IS RESPONSIBLE PER SECTION 5.14.6 MAKE A CLAIM AGAINST THE INDEMNITEES, OR BRING ANY ACTION AGAINST THE INDEMNITEES, ON ACCOUNT OF THE DAMAGE ALLEGED TO HAVE BEEN SO SUSTAINED, THE DESIGN-BUILDER SHALL HOLD THE INDEMNITEES HARMLESS AND DEFEND THEM AGAINST ANY SUCH CLAIM OR SUIT, AND SHALL REIMBURSE TO THE INDEMNITEES THE COST INCLUDING, WITHOUT LIMITATION, REASONABLE, ADDITIONAL ATTORNEY’S FEES INCURRED DEFENDING SUCH SUIT, AND IF ANY JUDGMENT AGAINST THE INDEMNITEES ARISES THERE FROM, THE DESIGN-BUILDER SHALL PAY OR SATISFY IT AND SHALL PAY ALL COSTS INCURRED BY THE INDEMNITEES. § 5.14.8 Should the Design-Builder be caused damage by any separate contractor, by reason of such separate contractor’s failure to perform properly under its contract with the Owner, no action will lie against the Owner, and the Owner shall have no liability therefore, but the Design-Builder may assert its claims for damages directly against such separate contractor and the Owner shall assign such rights to Design-Builder, as allowed under Texas law to pursue such claims. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 25 § 5.14.9 Inasmuch as the completion of the Project within the prescribed time is dependent very largely upon the close and active cooperation of all those engaged therein, it is, therefore expressly understood and agreed that each Design-Builder shall lay out and install its work at such time(s) and in such manner as to not delay or interfere with the carrying forward of the work of the other contractors. § 5.14.10 Where the work of one contractor directly affects the conditions of the work of another contractor including, as examples only, and not limited to, providing shoring for backfilling, providing protective covering for painting, providing adequate bracing of door jambs, etc., the Design-Builder performing the work which will adversely affect another contractor’s work shall be responsible for providing adequate protection based upon methods used to perform its work. § 5.15 Owner’s Right to Clean Up If a dispute arises among the Design-Builder, separate contractors and the Owner as to the responsibility under their respective contracts for maintaining the premises and surrounding area free from waste materials and rubbish, the Owner may clean up and will allocate the cost among those responsible. ARTICLE 6 CHANGES IN THE WORK § 6.1 General § 6.1.1 Changes in the Work may be accomplished after execution of the Contract, and without invalidating the Contract, by Change Order or Change Directive, subject to the limitations stated in this Article 6 and elsewhere in the Design-Build Documents. § 6.1.2 A Change Order shall be based upon agreement between the Owner and Design-Builder. The Owner may issue a Change Directive without agreement by the Design-Builder. § 6.1.3 Changes in the Work shall be performed under applicable provisions of the Design-Build Documents, and the Design-Builder shall proceed promptly, unless otherwise provided in the Change Order or Change Directive. Except as permitted in Section 1.4.1 and Section 6.3, a change in the Contract Sum or the Contract Time shall be accomplished only by Change Order. Accordingly, no course of conduct or dealings between the parties, nor express or implied acceptance of alterations or additions to the Work, and no claim that Owner has been unjustly enriched by any alteration of or addition to the Work, whether or not there is, in fact, any unjust enrichment to the Work, shall be the basis of any claim to an increase in any amounts due under the Design-Builder or a change in any time period provided for in the Design-Builder. § 6.2 Change Orders A Change Order is a written instrument signed by the Owner and Design-Builder stating their agreement upon all of the following: .1 The change in the Work; .2 The amount of the adjustment, if any, in the Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation; and .3 The extent of the adjustment, if any, in the Contract Time. § 6.2.1 Methods used in determining adjustments to the Contract Sum may include those listed in Sections 6.3.3, 6.3.7 and 6.3.10. § 6.2.2 Agreement on any Change Order shall constitute a final settlement of all matters relating to the change in the Work that is the subject of the Change Order, including, but not limited to, all direct and indirect costs and consequential damages associated with such change and any and all adjustments to the Contract Sum and the construction schedule. § 6.2.3 Change Orders Requiring City Council Approval The Contract Sum shown in the final Exhibit A – Design Build Amendment may not be increased because of a Change Order unless additional money for increased costs is appropriated for that purpose from available funds or is provided for by the authorization of the issuance of time warrants. The approval of the Denton City Council is required if a Change Order involves a decrease or an increase of $50,000.01 or more. The original Contract Sum shown in the final Exhibit A – Design Build Amendment also may not be increased under this Section 6.2.3 by more than twenty-five DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 26 percent (25.0%) over the entire duration of the Project. The original Contract Sum shown in the final Exhibit A – Design Build Amendment may not be increased by more than twenty-five percent (25%) for any reason; nor may it be decreased by more than twenty-five percent (25%) without the consent of the Design-Builder, as provided in Texas Local Government Code Sec. 252.048. After the Change Order is submitted by the Design-Builder under this Section 6.2.3, the additional time required to obtain City Council approval shall not be factored into any past or future claim for delays or calculated as a part of the Change Order request. § 6.3 Change Directives § 6.3.1 A Change Directive is a written order signed by the Owner directing a change in the Work prior to agreement on adjustment, if any, in the Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation, or Contract Time. The Owner may by Change Directive, without invalidating the Contract, order changes in the Work within the general scope of the Contract consisting of additions, deletions or other revisions, the Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation, and Contract Time being adjusted accordingly. § 6.3.2 A Change Directive shall be used in the absence of total agreement on the terms of a Change Order. § 6.3.3 If the Change Directive provides for an adjustment to the Contract Sum or, if prior to execution of the Design-Build Amendment, an adjustment in the Design-Builder’s compensation, the adjustment shall be based on one of the following methods: .1 Mutual acceptance of a lump sum properly itemized and supported by sufficient substantiating data to permit evaluation; .2 Unit prices stated in the Design-Build Documents or subsequently agreed upon; .3 Cost to be determined in a manner agreed upon by the parties and a mutually acceptable fixed or percentage fee; ; or .4 As provided in Section 6.3.7. § 6.3.4 If unit prices are stated in the Design-Build Documents or subsequently agreed upon, and if quantities originally contemplated are materially changed in a proposed Change Order or Change Directive so that application of such unit prices to quantities of Work proposed will cause substantial inequity to the Owner or Design-Builder, the applicable unit prices shall be equitably adjusted. § 6.3.5 Upon receipt of a Change Directive, the Design-Builder shall promptly proceed with the change in the Work involved and advise the Owner of the Design-Builder’s agreement or disagreement with the method, if any, provided in the Change Directive for determining the proposed adjustment in the Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation, or Contract Time. § 6.3.6 A Change Directive signed by the Design-Builder indicates the Design-Builder’s agreement therewith, including adjustment in Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation, and Contract Time or the method for determining them. Such agreement shall be effective immediately and shall be recorded as a Change Order. § 6.3.7 If the Design-Builder does not respond promptly or disagrees with the method for adjustment in the Contract Sum or, if prior to execution of the Design-Build Amendment, the method for adjustment in the Design-Builder’s compensation, the Owner shall determine the method and the adjustment on the basis of reasonable expenditures and savings of those performing the Work attributable to the change, including, in case of an increase, an amount for overhead and profit as set forth in the Agreement, or if no such amount is set forth in the Agreement, a reasonable amount. calculated using the sum of the actual costs allowed in Sections 6.3.7.1 through 6.7.3.5, and using the percentages shown in Section 6.3.12 below. In such case, and also under Section 6.3.3.3, the Design-Builder shall keep and present, in such form as the Owner may prescribe, an itemized accounting together with appropriate supporting data. Unless otherwise provided in the Design-Build Documents, costs for the purposes of this Section 6.3.7 shall be limited to the following: .1 Additional verifiable and reasonable costs of professional services; .2 Costs of labor, including social security, unemployment insurance, fringe benefits required by agreement or custom, and workers’ compensation insurance; .3 Costs of materials, supplies and equipment, including cost of transportation, whether incorporated or consumed; DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 27 .4 Rental costs of machinery and equipment, exclusive of hand tools, whether rented from the Design-Builder or others; .5 Costs of premiums for all bonds and insurance, permit fees, and sales, use or similar taxes related to the Work; and .6 Additional costs of supervision and field office verifiable payroll and subsistence costs incurred by the Design-Builder, Subcontractor and Subcontractors of field personnel directly attributable to the change. § 6.3.8 The amount of credit to be allowed by the Design-Builder to the Owner for a deletion or change that results in a net decrease in the Contract Sum or, if prior to execution of the Design-Build Amendment, in the Design-Builder’s compensation, shall be actual net cost. When both additions and credits covering related Work or substitutions are involved in a change, the allowance for overhead and profit shall be figured on the basis of net increase, if any, with respect to that change. § 6.3.9 Pending final determination of the total cost of a Change Directive to the Owner, the Design-Builder may request payment for Work completed under the Change Directive in Applications for Payment. The Owner will make an interim determination for purposes of certification for payment for those costs deemed to be reasonably justified. The Owner’s interim determination of cost shall adjust the Contract Sum or, if prior to execution of the Design-Build Amendment, the Design-Builder’s compensation, on the same basis as a Change Order, subject to the right of Design-Builder to disagree and assert a Claim in accordance with Article 14. § 6.3.10 When the Owner and Design-Builder agree with a determination concerning the adjustments in the Contract Sum or, if prior to execution of the Design-Build Amendment, the adjustment in the Design-Builder’s compensation and Contract Time, or otherwise reach agreement upon the adjustments, such agreement shall be effective immediately and the Owner and Design-Builder shall execute a Change Order. Change Orders may be issued for all or any part of a Change Directive. § 6.3.11 If the Owner and Design-Builder do not agree with the adjustment in Contract Time or the method for determining it, the adjustment or the method shall be referred to the Architect for determination. The Architect may consult with the Owner in connection with such determination either at the direction of the Owner or at the Architect’s discretion. § 6.3.12 In Section 6.3.7, the allowance for the combined total of onsite and offsite overhead, insurance and profit included in the total cost to the Owner shall be based on the following schedule: .1 For the Design-Builder, for Work performed by the Design-Builder’s own forces, ten percent (10%) of the cost; .2 For the Design-Builder, for Work performed by the Design-Builder’s Subcontractor, five percent (5%) of the amount due the Subcontractor; .3 For each Subcontractor or Sub-subcontractor involved, for Work performed by that Subcontractor or Sub-subcontractor’s own forces, ten percent (10%) of the cost; .4 For each Subcontractor, for Work performed by the Subcontractor’s Sub-subcontractors, five percent (5%) of the amount due the Sub-subcontractor; .5 Cost to which overhead and profit is to be applied shall be determined in accordance with Section 6.3.7; .6 Under no circumstance shall costs of the Design-Builder’s supervisory, management, administrative or other office personnel, regardless of where stationed, be paid as cost of the Work under 6.3.7. Conversely, the Design-Builder shall be compensated for their labor within the overhead and profit percentage specified in this Section 6.3.12. .7 In order to facilitate checking of quotations for extras or credits, all proposals, except those so minor that their propriety can immediately be seen by inspection, shall be accomplished by a complete DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 28 itemization of costs including labor, materials, and subcontracts. Labor and materials shall be itemized in the manner prescribed above. Where major cost items are subcontracts, they shall be itemized also. .8 When both additions and credits are involved in any change, the allowance for overhead and profit shall be figured on the basis of the net increase or decrease, if any. .9 Overtime, when specifically authorized by the Owner and not as a requirement for the Design-Builder to fulfill its obligations under this Agreement, shall be paid for by the Owner on the basis of premium payment only, plus the cost of insurance and taxes based on the premium payment period. Overhead and profit will not be paid by the Owner for overtime. § 6.4 Supporting Information Notwithstanding the above, requests for an adjustment in the Contract Sum or adjustment in the Contract Time shall be in a form and accompanied by supporting information with a level of detail wholly acceptable to the Owner. The Design-Builder shall also comply with all provisions of Articles 8 and 14 with respect to claims. The required information shall be provided by the Design-Builder in less than twenty-one (21) days from the Design-Builder’s request for an adjustment in the Contract Sum or Contract Time. Failure to timely provide this information in the proper form may be, in and of itself, grounds for rejection of the request, at the sole discretion of the Owner. ARTICLE 7 OWNER’S RESPONSIBILITIES § 7.1 General § 7.1.1 The Owner shall designate in writing a representative who shall have express authority to bind the Owner with respect to all Project matters requiring the Owner’s approval or authorization. § 7.1.2 The Owner shall render decisions in a timely manner and in accordance with the Design-Builder’s schedule agreed to by the Owner. The Owner shall furnish to the Design-Builder, within 15 fifteen (15) days after receipt of a written request, information necessary and relevant for the Design-Builder to evaluate, give notice of or enforce mechanic’s lien rights. Such information shall include a correct statement of the record legal title to the property on which the Project is located, usually referred to as the site, and the Owner’s interest therein. § 7.1.3 The Owner may obtain independent review(s) of the Design-Builder’s Design Documents, or of any document or other materials submitted by the Design-Builder, by a separate architect, engineer, contractor, cost estimator or any other consultant they deem necessary and put under contract to or cause to be employed by the Owner. Such independent review shall be undertaken at the Owner’s expense in a timely manner and shall not delay the orderly progress of the Work. The Design-Builder shall cooperate with such Owner’s other consultants fully, and respond to their reviews and comments in writing in a timely and comprehensive manner. This provision shall not be interpreted to require the Owner to obtain an independent review or imply that the Owner is in any way assuming responsibility for the work of the Design-Builder. § 7.2 Information and Services Required of the Owner § 7.2.1 The Owner shall furnish information or services required of the Owner by the Design-Build Documents with reasonable promptness. § 7.2.2 The Owner shall provide, to the extent under the Owner’s control and if not required by the Design-Build Documents to be provided by the Design-Builder, the results and reports of prior tests, inspections or investigations conducted for the Project involving structural or mechanical systems; chemical, air and water pollution; hazardous materials; or environmental and subsurface conditions and information regarding the presence of pollutants at the Project site. Upon receipt of a written request from the Design-Builder, the Owner shall also provide surveys describing physical characteristics, legal limitations and utility locations for the site of the Project, and a legal description of the site under the Owner’s control. § 7.2.3 The Owner shall promptly obtain easements, zoning variances, and legal authorizations or entitlements regarding site utilization where essential to the execution of the Project. § 7.2.4 The Owner shall cooperate with the Design-Builder in securing building and other permits, licenses and inspections. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 29 § 7.2.5 The services, information, surveys and reports required to be provided by the Owner under this Agreement, shall be furnished at the Owner’s expense, and except as otherwise specifically provided in this Agreement or elsewhere in the Design-Build Documents or to the extent the Owner advises the Design-Builder to the contrary in writing, the Design-Builder shall be entitled to rely upon the accuracy and completeness thereof. Omissions and conflicts thus discovered by the Design-Builder will be promptly communicated to the Owner in writing, after the Design-Builder has carefully scrutinized such information for consistency with other information about the Work. In no event shall the Design-Builder be relieved of its responsibility to exercise proper precautions relating to the safe performance of the Work. § 7.2.6 If the Owner observes or otherwise becomes aware of a fault or defect in the Work or non-conformity with the Design-Build Documents, the Owner shall give prompt written notice thereof to the Design-Builder. § 7.2.7 Prior to the execution of the Design-Build Amendment, the Design-Builder may request in writing that the Owner provide reasonable evidence that the Owner has made financial arrangements to fulfill the Owner’s obligations under the Design-Build Documents and the Design-Builder’s Proposal. Thereafter, the Design-Builder may only request such evidence if (1) the Owner fails to make payments to the Design-Builder as the Design-Build Documents require; (2) a change in the Work materially changes the Contract Sum; or (3) the Design-Builder identifies in writing a reasonable concern regarding the Owner’s ability to make payment when due. The Owner shall furnish such evidence as a condition precedent to commencement or continuation of the Work or the portion of the Work affected by a material change. After the Owner furnishes the evidence, the Owner shall not materially vary such financial arrangements without prior notice to the Design-Builder.As required by the provisions of Chapter 56 of the Texas Business and Commerce Code, the Owner has represented that it has sufficient funds available to undertake the Project. § 7.2.8 Except as otherwise provided in the Design-Build Documents or when direct communications have been specially authorized, the Owner shall communicate through the Design-Builder with persons or entities employed or retained by the Design-Builder. § 7.2.9 Unless required by the Design-Build Documents to be provided by the Design-Builder, the Owner shall, upon request from the Design-Builder, furnish the services of geotechnical engineers or other consultants for investigation of subsurface, air and water conditions when such services are reasonably necessary to properly carry out the design services furnished by the Design-Builder. In such event, the Design-Builder shall specify the services required. Such services may include, but are not limited to, test borings, test pits, determinations of soil bearing values, percolation tests, evaluations of hazardous materials, ground corrosion and resistivity tests, and necessary operations for anticipating subsoil conditions. The services of geotechnical engineer(s) or other consultants shall include preparation and submission of all appropriate reports and professional recommendations. § 7.2.10 The Owner shall purchase and maintain insurance as set forth in Exhibit B. § 7.2.11 The Owner shall furnish information and services under the Owner’s control when (1) such services are reasonably required by the scope of the Work; (2) are scheduled by the Design-Builder in the approved Design-Builder’s Project Schedule; (3) and requested by the Design-Builder in writing reasonably in advance of the date required by the Design-Builder to allow the Owner to procure of the requested information and/or consultant(s), and such consultant(s) to provide the requested information and/or services in the normal course of the consultant(s)’ business. § 7.2.12 The Owner shall furnish the following information to a person, including the Architect or Contractor, who makes a request for information under Texas Government Code Chapter 2253, related to a payment or performance bond: (1) a certified copy of a payment bond and any attachment to the bond; (2) the public work contract for which the bond was given; and (3) the toll-free telephone number maintained by the Texas Department of Insurance under Subchapter B, Chapter 521, Insurance Code, for obtaining information concerning licensed insurance companies. § 7.2.13 Notwithstanding the foregoing, the Design-Builder expressly understands, acknowledges and agrees that such reports, analyses and assessments have been provided for the Design-Builder’s bidding and informational purposes only. The City does not warrant or guarantee the information contained in those documents. The Design-Builder shall not be entitled to rely solely on the aforementioned documents in performing any portion of the Work, but shall DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 30 conduct its own testing, inspections and investigations as part of the final Project design. The Design-Builder agrees that nothing contained in any Owner-provided reports, analyses or assessments, nor any provision of the Design-Build Agreement, shall have the effect of releasing, diminishing, discharging or otherwise absolving Design-Builder of the responsibility for performing any testing, inspections or evaluations necessary to ensure the structural integrity of the foundation and compliance with the Design-Build Documents. PROJECT SITE INFORMATION AND REPORTS (INCLUDING BUT NOT LIMITED TO SOILS TESTING REPORTS, GEOTECHNICAL REPORTS, OR ENVIRONMENTAL SITE ASSESSMENTS) PROVIDED BY THE OWNER IN THE PROJECT MANUAL OR BY OTHER MEANS SHALL BE UTILIZED BY THE DESIGN-BUILDER AT ITS OWN RISK. THE OWNER AND THE OWNER’S CONSULTANTS DO NOT GUARANTEE OR WARRANT ANY INFORMATION SHOWN IN THE PROJECT SITE INFORMATION AND REPORTS. § 7.2.14 The Design-Builder shall be the party with primary responsibility for securing necessary site, building, and other permits, licenses and inspections required by regulatory agencies, unless otherwise provided herein or required by law. The Owner shall cooperate with the Design-Builder in securing permits. The Design-Builder will include the fees for such permits, licenses and inspections in the Contract Sum. § 7.2.15 If the Owner observes or otherwise becomes aware of any fault or defect in the Work or non-conformity with the Design-Build Documents, the Owner shall, as soon as possible but not later than fifteen (15) days after the Owner becomes aware of such fault or defect, give written notice thereof to the Design-Builder. § 7.3 Submittals § 7.3.1 The Owner shall review and approve or take other appropriate action on Submittals. Review of Submittals is not conducted for the purpose of determining the accuracy and completeness of other details, such as dimensions and quantities; or for substantiating instructions for installation or performance of equipment or systems; or for determining that the Submittals are in conformance with the Design-Build Documents, all of which remain the responsibility of the Design-Builder as required by the Design-Build Documents. The Owner’s action will be taken in accordance with the submittal schedule approved by the Owner or, in the absence of an approved submittal schedule, with reasonable promptness while allowing sufficient time in the Owner’s judgment to permit adequate review. The Owner’s review of Submittals shall not relieve the Design-Builder of the obligations under Sections 3.1.11, 3.1.12, and 5.2.3. The Owner’s review shall not constitute approval of safety precautions or, unless otherwise specifically stated by the Owner, of any construction means, methods, techniques, sequences or procedures. The Owner’s approval of a specific item shall not indicate approval of an assembly of which the item is a component. § 7.3.2 Upon review of the Submittals required by the Design-Build Documents, the Owner shall notify the Design-Builder of any non-conformance with the Design-Build Documents the Owner discovers. § 7.4 Visits to the site by the Owner shall not be construed to create an obligation on the part of the Owner to make on-site inspections to check the quality or quantity of the Work. The Owner shall neither have control over or charge of, nor be responsible for, the construction means, methods, techniques, sequences or procedures, or for the safety precautions and programs in connection with the Work, because these are solely the Design-Builder’s rights and responsibilities under the Design-Build Documents. § 7.5 The Owner shall not be responsible for the Design-Builder’s failure to perform the Work in accordance with the requirements of the Design-Build Documents. The Owner shall not have control over or charge of, and will not be responsible for acts or omissions of the Design-Builder, Architect, Consultants, Contractors, or their agents or employees, or any other persons or entities performing portions of the Work for the Design-Builder. § 7.6 The Owner has the authority to reject Work that does not conform to the Design-Build Documents. The Owner shall have authority to require inspection or testing of the Work in accordance with Section 15.5.2, whether or not such Work is fabricated, installed or completed. However, neither this authority of the Owner nor a decision made in good faith either to exercise or not to exercise such authority shall give rise to a duty or responsibility of the Owner to the Design-Builder, the Architect, Consultants, Contractors, material and equipment suppliers, their agents or employees, or other persons or entities performing portions of the Work. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 31 § 7.7 The Owner shall determine the date or dates of Substantial Completion in accordance with Section 9.8 and the date of final completion in accordance with Section 9.10. § 7.8 Owner’s Right to Stop Work If the Design-Builder fails to correct Work which is not in accordance with the requirements of the Design-Build Documents as required by Section 11.2 or persistently fails to carry out Work in accordance with the Design-Build Documents, the Owner may issue a written order to the Design-Builder to stop the Work, or any portion thereof, until the cause for such order has been eliminated; however, the right of the Owner to stop the Work shall not give rise to a duty on the part of the Owner to exercise this right for the benefit of the Design-Builder or any other person or entity, except to the extent required by Section 5.13.1.3. § 7.9 Owner’s Right to Carry Out the Work If the Design-Builder defaults or neglects to carry out the Work in accordance with the Design-Build Documents and fails within a ten-day four (4) day period after receipt of written notice from the Owner to commence and continue correction of such default or neglect with diligence and promptness, the Owner may, without prejudice to other remedies the Owner may have, correct such deficiencies. In such case, an appropriate Change Order shall be issued deducting from payments then or thereafter due the Design-Builder the reasonable cost of correcting such deficiencies. If payments then or thereafter due the Design-Builder are not sufficient to cover such amounts, the Design-Builder shall pay the difference to the Owner. § 7.10 Extent of Owner Rights § 7.10.1 The rights stated in this Article 7 and elsewhere in the Design-Build Documents are cumulative and not in limitation of any rights of the Owner granted in the Design-Build Documents; at law; or in equity. § 7.10.2 In no event shall the Owner have control over, charge of, or any responsibility for construction means, methods, techniques, sequences, or procedures or for safety precautions and programs in connection with the Work. Notwithstanding anything else herein, and without limitation, the providing of the Design Criteria; any review(s), independent or otherwise, or approval(s) by the Owner or Owner’s Independent Representative of the Design-Build Documents, the Contract Documents, the Design-Builder’s Construction Management Plan(s), the Design-Builder’s Construction Schedule, shop drawings, submittals, meeting minutes or other Design-Builder’s services, deliverables or activities; nor the exercising of any of the rights and authority granted the Owner in the Design-Build Documents shall in any way reduce, diminish, or otherwise affect the Design-Builder’s responsibilities, duties and accountability to the Owner for, without limitation, the design, engineering, construction means, methods, techniques, sequences, procedures or for safety precautions, and the provision of the Work per the requirements of the Design-Build Documents. § 7.10.3 The Owner reserves the right to have the Design-Builder and/or subcontractors remove person(s) and/or personnel from any and all work on the Project for cause but without cost to the Owner. Such requests from the Owner will be made in writing. "Cause" may include, but is not limited to, any of the following: incompetence, poor workmanship, poor scheduling abilities, poor coordination, disruptive to the project, the facility or others, poor management, cause delay or delays, will not strictly adhere to facility procedures and project requirements either willfully or unknowingly, insubordination, drug/alcohol use, possession of contraband, belligerent acts or actions, etc. The Design-Builder shall provide replacement person(s) and/or personnel acceptable to the Owner at no cost to the Owner. ARTICLE 8 TIME § 8.1 Progress and Completion § 8.1.1 Time limits stated in the Design-Build Documents are of the essence of the Contract. By executing the Design-Build Amendment the Design-Builder confirms that the Contract Time is a reasonable period for performing the Work. § 8.1.2 The Design-Builder shall not, except by agreement of the Owner in writing, commence the Work prior to the effective date of insurance, other than property insurance, required by this Contract. The Contract Time shall not be adjusted as a result of the Design-Builder’s failure to obtain insurance required under this Contract. Unless the date of commencement is established by a notice to proceed given by the Owner, the Design-Builder shall notify the Owner in DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 32 writing not less than five (5) days or other agreed period before commencing the Work to permit the timely filing of any documents or notices required of the Owner prior to such commencement of the Work. § 8.1.3 The Design-Builder shall proceed expeditiously with adequate forces and shall achieve Substantial Completion within the Contract Time.Attention is directed to the fact that the Work is urgently needed by the Owner; for this reason it shall be agreed that the Design-Builder will substantially complete all Work under the Contract within the time established in the Design-Build Documents and the most recently approved Design-Builder’s Construction Schedule. The Design-Builder shall begin the Work on the date of commencement as defined in Exhibit "A" – Design-Build Amendment; carry the Work forward with adequate resources; furnish, without limitation such labor, supervision, materials, facilities, and equipment; and work such hours, including night shifts, overtime operations, and Sundays and/or holidays, as may be necessary to ensure the progress and completion of both the Work and the Project as reflected by the most recently approved Design-Builder’s Construction Schedule. § 8.1.4 The Design-Builder shall achieve specific Contractual Milestone dates (if any), Substantial Completion, and Final Completion within the times stated in Exhibit "A" – Design Build Amendment, and such dates shall be adhered to and shall be the last acceptable dates for completion of Work required for those milestones and completions, unless and until modified by the Owner in writing. § 8.1.5 The Design-Builder understands and agrees that all Work must be performed in an orderly and closely coordinated sequence so that the dates for Contractual Milestones (if any), Substantial Completion, and Final Completion, may be met by the both the Design-Builder as well as the respective Multiple Prime Contractors. § 8.1.6 The Design-Builder shall also complete the Work in all of its details for final acceptance as expeditiously as possible after Substantial Completion. § 8.2 Delays and Extensions of Time § 8.2.1 If the Design-Builder is delayed at any time in the commencement or progress of the Work by an act or neglect of the Owner or of a consultant or separate contractor employed by the Owner; or by changes ordered in the Work by the Owner; or by labor disputes, fire, unusual delay in deliveries, transportation, unavoidable casualties or other causes beyond the Design-Builder’s control; causes; or by delay authorized by the Owner pending mediation and binding dispute resolution or by other causes that the Owner determines may justify delay, then the Contract Time shall be extended by Change Order for such reasonable time as the Owner may determine. § 8.2.2 Claims relating to time shall be made in accordance with applicable provisions of Article 14. § 8.2.3 This Section 8.2 does not preclude recovery of damages for delay by either party under other provisions of the Design-Build Documents. § 8.2.4 Any claims for extension of time shall be made in writing to the Owner not more than ten (10) days after commencement of the delay; otherwise it shall be waived. In the case of a continuing delay only one claim is necessary. The Design-Builder shall provide an estimate of the probable effect of such delay on the progress of work within five (5) days of the first date the Design-Builder should reasonably be expected to have calculated the impact of such delay, but in no event more than fifteen (15) days after the commencement of the delay, with weekly updates to the impact if the delay is of an ongoing nature. § 8.2.5 Extensions of the Contract Time will be made for delays due to weather conditions only when such conditions are more severe and extended than those reflected by the ten (10) year average for the month as evidenced by the National Climatic Data Center’s (NCDC’s) Surface Data US at https://www.ncdc.noaa.gov/cag/regional/mapping/-1/pcp/201804/60/value or other data as mutually agreed by the Owner and Design-Builder for the Project area. In allowing delays for weather, the Owner will be entitled to consider weather conditions prevailing throughout the entire Contract period. Extensions of time due to weather or other allowable reasons will be granted on the basis actual impacts of those work days lost with each separate extension figured to the nearest whole calendar day. The extension of the contract completion time for weather conditions will occur only in the event that the weather in question affected critical activities on the most current Design-Builder’s Construction Schedule, and at least one half of the work force allocated to that item of work was also adversely affected by the same weather conditions. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 33 § 8.3 Design-Builder’s Obligations after Delay § 8.3.1 If either the Work actually in place falls behind as reflected by the currently updated Master Project Schedule or Design-Builder’s Construction Schedule, or it becomes apparent or likely in the reasonable opinion of the Owner that the Work will not be completed within the Contract Time or in accordance with the Design-Builder’s Construction Schedule, the Design-Builder agrees it shall, as necessary, take some or all of the following actions (hereinafter referred to collectively as "Extraordinary Measures") at no additional cost to the Owner, as required to substantially eliminate, in the judgement of the Owner, the backlog of Design-Builder’s Work on the Project: .1 Increase quantities of, without limitation, labor, supervision, material deliveries, equipment on site, and crafts as necessary; .2 Increase the number of working hours per shift, shifts per working day, working days per week, or any combination of the foregoing; .3 Reschedule activities to achieve maximum practical concurrence of accomplishment; and .4 Do whatever else is reasonably required by the Owner. § 8.3.2 These Extraordinary Measures shall continue until the progress of the Work complies with the stage of completion required by the Design-Build Documents. The Owner’s right to require Extraordinary Measures is solely for the purpose of ensuring the Design-Builder’s compliance with the Design-Builder’s Construction Schedule. § 8.3.3 In the event of a delay, the Owner may also require the Design-Builder to immediately submit a Proposed Recovery Schedule as specified in Section 8.3.1 above. If the Proposed Recovery Schedule is not satisfactory, the Owner may unilaterally establish a new Proposed Recovery Schedule acceptable to the Owner; issue it as a Construction Change Directive; and the Design-Builder shall comply therewith. The Owner may also require the Design-Builder to take any of the Extraordinary Measures to make up the lag in scheduled progress, all without additional cost to the Owner. § 8.3.4 Failure of the Design-Builder to substantially comply with the requirements of this Section 8.3 shall be considered grounds for a determination by the Owner that the Design-Builder is in breach of this Agreement by failing to prosecute the Work and that of the Project so as to ensure its completion within both the Contract Time and the updated Design-Builder’s Construction Schedule. § 8.3.5 Likewise, in the event the progress of the Project falls behind the predictions of the Master Project Schedule through no fault of the Design-Builder, the Owner may request, and the Design-Builder agrees to take one or more of the Extraordinary Measures, with the Owner bearing the cost for such actions per Article 6 herein. § 8.3.6 The Design-Builder shall not be entitled to an adjustment in the Contract Sum in connection with Extraordinary Measures required by the Owner under or pursuant to this Section 8.3, except as specifically noted otherwise in Section 8.3.5. § 8.4 Owner’s Rights after Delay § 8.4.1 Likewise, in the event the Design-Builder fails, or appears likely to fail, to complete a critical portion of Work on time or to complete a Contractual Milestone Date or completion date as evidenced by the most recently approved Design-Builder’s Construction Schedule, the Owner shall have the right to impose any or all of the following options: .1 Require the Design-Builder to substantiate the capability to get back on schedule within ten (10) business days; .2 Require the Design-Builder to take some or all of the Extraordinary Measures, and do whatever else is required by the Owner until Design-Builder confirms, to the satisfaction of the Owner, the progress of the Work is in compliance and congruence with the most recently approved Design-Builder’s Construction Schedule, such measures being at no extra cost to Owner; .3 Withhold progress payment, or portions thereof, until such time as the Design-Builder is in compliance with the most recently approved Design-Builder’s Project Schedule; and DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 34 .4 Contact or visit the factory, plant or distribution center whose production or delivery schedule may be critical to the scheduled completion of a portion of the contract work, and expedite same, at Design-Builder’s expense. § 8.5 Liquidated Damages § 8.5.1 Should the Design-Builder fail to substantially complete the Work on, or before, the original date set forth in the Contract, or on or before the revised date as granted by extensions to Contract Time, the Owner may at its sole discretion permit the Design-Builder to proceed, and in such case, there shall be deducted from any monies due or which may become due the Design-Builder, a sum as specified herein, for each and every calendar day that the Work shall remain uncompleted. This sum shall be considered, not as penalty, but as the cost(s) for substantial losses suffered by the public and the Owner. Liquidated damages are intended to compensate the Owner for the Design-Builder’s failure to meet the deadlines set forth herein, and shall not excuse the Design-Builder from liability from any other breach of requirements of the Contract Documents, including any failure of the Work to conform to applicable requirements. The Design-Builder agrees that the sums in Section 8.5.2 are reasonable in light of the anticipated or actual harm caused by the breach, the difficulties of the proof of loss, and the inconvenience or non-feasibility of otherwise obtaining an adequate remedy. Design-Builder further acknowledges and agrees that Liquidated Damages may be owing even though no termination has occurred. § 8.5.2 The Design-Builder shall pay Owner five hundred dollars ($ 500.00) for each day that expires after the date set forth in the Contract for substantially completing the work to be "ready for use, beneficial occupancy and operation" by the Owner and five hundred dollars ($ 500.00) for each day that expires after the date set forth in the Contract for Final Completion of the Work. § 8.5.3 The parties acknowledge, covenant and agree that the daily basis and the amount set forth above for liquidated damages are reasonable and equitable due to increased Owner personnel efforts in administrating the Contract; increased consultants’ expenses; inconvenience and expense caused to Project stakeholders; and loss of confidence and diminished trust in the Owner’s management abilities by the local and national community, the Owner’s peers, and by financial institutions necessary to the Owner’s future endeavors; all incurred by delays in the completion time. § 8.5.4 Permitting the Design-Builder to continue and finish the Work, or any portion thereof, after the time fixed for its completion, shall in no way operate as a waiver on the part of the Owner of any of its rights under the Contract. The Design-Builder acknowledges the Owner receives no benefits from early completion of the Project or the Work, therefore all rights, if any, to an early completion bonus or other increases in the Contract Sum for such early completion are hereby waived by the Design-Builder. ARTICLE 9 PAYMENT APPLICATIONS AND PROJECT COMPLETION § 9.1 Contract Sum The Contract Sum is stated in the Design-Build Amendment. § 9.2 Schedule of Values Where the Contract Sum is based on a stipulated sum or Guaranteed Maximum Price, the Design-Builder, prior to the first Application for Payment after execution of the Design-Build Amendment shall submit to the Owner a schedule of values allocating Stipulated Sum or the Cost of the Work with a Guaranteed Maximum Price, the Design-Builder, meet with the Owner, at the Preconstruction Conference with a proposed Schedule of Values. The Design-Builder’s Schedule of Values will be reviewed by the Owner in the context of the Design-Builder’s proposed Construction Management Plan, including but not limited to the Design-Builder’s Construction Schedule therein. The values assigned to each work activity in the Schedule of Values should be generated by the projected earned value of the activities in the Design-Builder’s Construction Schedule, rounded to the nearest five dollars, and equal in aggregate to the Design-Builder’s and Subcontractor’s contract amount(s). The Schedule of Values shall allocate the entire Contract Sum to the various portions of the Work and be prepared in such form and supported by such additional data to substantiate its accuracy as the Owner may require. This schedule, Schedule of Values, unless objected to by the Owner, shall be used as a basis for reviewing the Design-Builder’s Applications for Payment. § 9.3 Applications for Payment § 9.3.1 At least ten (10) days before the date established for each progress payment, the Design-Builder shall submit to the Owner an itemized Application for Payment for completed portions of the Work. The application shall be DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 35 notarized, if required, and supported by data substantiating the Design-Builder’s right to payment as the Owner may require, such as copies of requisitions from the Architect, Consultants, Contractors, and material suppliers, and shall reflect retainage if provided for in the Design-Build Documents. The form of Application for Payment shall be a notarized AIA Document G702, Application and Certification for Payment; supported by AIA Document G703, Continuation Sheet; and other documentation as reasonably required by the Owner; submitted electronically. § 9.3.1.1 As provided in Section 6.3.9, Applications for Payment may include requests for payment on account of changes in the Work that have been properly authorized by Change Directives, or by interim determinations of the Owner, but not yet included in Change Orders. § 9.3.1.2 Applications for Payment shall not include requests for payment for portions of the Work for which the Design-Builder does not intend to pay the Architect, Consultant, Contractor, material supplier, or other persons or entities providing services or work for the Design-Builder, unless such Work has been performed by others whom the Design-Builder intends to pay. § 9.3.1.3 Each Application for Payment shall be accompanied by the following, all in form and substance satisfactory to the Owner and in compliance with all applicable statutes: .1 A duly executed and acknowledged sworn statement showing all Subcontractors and material suppliers with whom the Design-Builder has entered into subcontracts, the amount of each such subcontract, the invoice from and the amount requested for any Subcontractor and material supplier in the requested Application for Payment, and the amount to be paid to the Design-Builder from such progress payment, together with similar sworn statements from all such Subcontractors and material suppliers; .2 Duly executed unconditional waivers of mechanics’ and material suppliers’ liens from all Subcontractors and, when appropriate, from material suppliers and lower tier Sub-subcontractors establishing payment or satisfaction of payment of all amounts requested by the Design-Builder on behalf of such entities or persons in any previous Application for Payment; .3 Duly executed waivers of mechanics’ and material suppliers’ liens from all Subcontractors and, when appropriate, from material suppliers and lower tier Sub-subcontractors conditional upon and establishing payment or satisfaction of payment of all amounts requested by the Design-Builder on behalf of such entities or persons in the current Application for Payment; .4 An updated Design-Builder’s Construction Schedule clearly showing the actual progress of the Work for each activity against the Work previously scheduled to be completed during the period, and against targeted activities’ previously approved completion dates; and .5 Notwithstanding the above, Applications for Payment shall be in a form and accompanied by supporting information with a level of detail wholly acceptable to the Owner, and shall include, at a minimum, an updated monthly Design-Builder’s Construction Schedule clearly and graphically comparing the actual "work-in-place" completed to the Work previously projected to be complete for the period. Failure to provide this information in the proper form may be, in and of itself, grounds for rejection of the Application for Payment, at the discretion of the Owner. § 9.3.2 Unless otherwise provided in the Design-Build Documents, payments shall be made for services provided as well as materials and equipment delivered and suitably stored at the site for subsequent incorporation in the Work. If approved in advance by the Owner, payment may similarly be made for materials and equipment suitably stored off the site at a location agreed upon in writing. Payment for materials and equipment stored on or off the site shall be conditioned upon compliance by the Design-Builder with procedures satisfactory to the Owner to establish the Owner’s title to such materials and equipment or otherwise protect the Owner’s interest, and stored materials and equipment are properly tagged as to material and job identification; are available for inspection by the Owner; and such requests for payment must be accompanied by documentary evidence as specified, without limitation, in Sections 5.9 and the insurance required by Exhibit "B" – Insurance and Bonds, which supports the request’s validity; quantity and value of materials; proper material acceptance and storage; and including insurance on the materials as evidenced by a Certificate of Insurance or otherwise protects the Owner’s interests. Such request, shall include the costs of DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 36 applicable insurance, storage and transportation to the site for such materials and equipment stored off the site. Such materials shall be: .1 Protected from diversion, destruction, theft, and damage to the satisfaction of the Owner, and the Lender (if any); .2 Specifically marked for use on the Project; and .3 Segregated from other materials at the storage facility. § 9.3.3 The Design-Builder warrants that title to all Work, other than Instruments of Service, Work covered by an Application for Payment will pass to the Owner no later than the time of payment. either by incorporation into the construction or receipt of payment by the Design-Builder, whichever occurs first . The Design-Builder further warrants that, upon submittal of an Application for Payment, all Work for which Certificates for Payment have been previously issued and payments received from the Owner shall, to the best of the Design-Builder’s knowledge, information and belief, be free and clear of liens, claims, security interests or encumbrances in favor of the Design-Builder, Architect, Consultants, Contractors, material suppliers, or other persons or entities entitled to make a claim by reason of having provided labor, materials and equipment relating to the Work. .1 THE DESIGN-BUILDER FURTHER EXPRESSLY UNDERTAKES TO DEFEND THE INDEMNITEES, AT THE DESIGN-BUILDER’S SOLE EXPENSE, AGAINST ANY ACTIONS, LAWSUITS, OR PROCEEDINGS BROUGHT AGAINST THE INDEMNITEES AS A RESULT OF LIENS OR VERIFIED CLAIMS FILED AGAINST THE WORK, THE SITE OF ANY OF THE WORK, THE PROJECT SITE AND ANY IMPROVEMENTS THEREON, PAYMENTS DUE THE DESIGN-BUILDER, THE PROJECT BOND OR ANY PORTION OF THE PROPERTY OF ANY OF THE INDEMNITEES (REFERRED TO COLLECTIVELY AS "LIENS OR VERIFIED CLAIMS" IN THIS SECTION 9.3.3). THE DESIGN-BUILDER HEREBY AGREES TO INDEMNIFY AND HOLD THE INDEMNITEES HARMLESS AGAINST ANY SUCH LIENS OR VERIFIED CLAIMS AND AGREES TO PAY ANY JUDGMENT OR LIENS OR VERIFIED CLAIMS RESULTING FROM ANY SUCH ACTIONS, LAWSUITS, OR PROCEEDINGS. .2 The Owner shall release any payments withheld due to a lien or verified claim if the Design-Builder obtains security acceptable to the Owner or a lien bond that is (1) issued by a surety acceptable to the Owner, (2) in form and substance satisfactory to the Owner, and (3) in an amount not less than two hundred percent (200%) of such lien or verified claim or such other amount as required by applicable law. By posting a lien bond or other acceptable security, however, the Design-Builder shall not be relieved of any responsibilities or obligations under this Section 9.3.3, including, without limitation, the duty to defend and indemnify the Indemnitees. The cost of any premiums incurred in connection with such bonds and security shall be the responsibility of the Design-Builder and shall not be part of, or cause any adjustment to, the Contract Sum. .3 Notwithstanding the foregoing, the Owner reserves the right to settle any disputed lien or verified claim by payments to the claimant or by such other means as the Owner, in the Owner’s sole discretion, determines is the most economical or advantageous method of settling the dispute. The Design-Builder shall promptly reimburse the Owner, upon demand, for any payments so made if the amount paid exceeds the amount remaining owed under the subcontract. § 9.4 Certificates for Payment The Owner shall, within seven (7) days after receipt of the Design-Builder’s Application for Payment, issue to the Design-Builder a Certificate for Payment indicating the amount the Owner determines is properly due, and notify the Design-Builder in writing of the Owner’s reasons for withholding certification in whole or in part as provided in Section 9.5.1. § 9.4.1 The issuance of a Application for Payment will constitute a representation by the Design-Builder to the Owner, based on the Design-Builder’s evaluation of the Work and the data comprising the Application for Payment, that, to the best of the Design-Builder’s knowledge, information and belief, the Work has progressed to the point indicated DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 37 and that the quality of the Work is in accordance with the Design-Build Documents. The foregoing representations are subject to an evaluation of the Work for conformance with the Design-Build Documents upon Substantial Completion, to results of subsequent tests and inspections, to correction of minor deviations from the Design-Build Documents prior to completion and to specific qualifications expressed by the Design-Builder. The issuance of a Certificate for Payment will further constitute a representation that the Design-Builder is entitled to payment in the amount certified. § 9.4.2 Certification will be issued for ninety-five percent (95%) of the amount requested by the Design-Builder and approved by the Owner to be properly due until the Design-Builder is ninety-five percent (95%) completed with the Work. Thereafter, the accumulated retainage may be held without additional retainage, except that should the Design-Builder at any time fail to keep current with the approved progress schedule; fail to assure payment to Subcontractors, Sub-subcontractors and suppliers as required hereunder; or fails to promptly and diligently correct Work that does not comply with the Design-Build Documents, certification of ninety-five percent (95%) shall automatically again become effective and shall apply as long as the Design-Builder lags behind such progress or fails to assure such payment. § 9.5 Decisions to Withhold Certification § 9.5.1 The Owner may withhold a Certificate for Payment in whole or in part to the extent reasonably necessary to protect the Owner due to the Owner’s determination that the Work has not progressed to the point indicated in the Design-Builder’s Application for Payment, or the quality of the Work is not in accordance with the Design-Build Documents. If the Owner is unable to certify payment in the amount of the Application, the Owner will notify the Design-Builder as provided in Section 9.4. If the Design-Builder and Owner cannot agree on a revised amount, the Owner will promptly issue a Certificate for Payment for the amount that the Owner deems to be due and owing. The Owner may also withhold a Certificate for Payment or, because of subsequently discovered evidence, may nullify the whole or a part of a Certificate for Payment previously issued to such extent as may be necessary to protect the Owner from loss for which the Design-Builder is responsible because of .1 defective Work, including design and construction, not remedied; .2 third party claims filed or reasonable evidence indicating probable filing of such claims unless security acceptable to the Owner is provided by the Design-Builder; .3 failure of the Design-Builder to make assure payments properly to the Architect, Consultants, Contractors or others, for services, labor, materials or equipment; .4 reasonable evidence that the Work cannot be completed for the unpaid balance of the Contract Sum; .5 damage to the Owner or a separate contractor; .6 reasonable evidence that the Work will not be completed within the Contract Time, and that the unpaid balance would not be adequate to cover actual or liquidated damages for the anticipated delay; or .7 repeated failure to carry out the Work in accordance with the Design-Build Documents. .8 Design-Builder’s failure to obtain necessary permits or licenses or to comply with applicable codes, regulations, or other laws; .9 failure to fully execute the Contract with all associated documents as required; .10 liens filed for any portion of the Work; or .11 failure of the Design-Builder to comply with any provisions of the Design-Build Documents, including without limitation Section 8.3. § 9.5.2 When the above reasons for withholding certification are removed, certification will be made for amounts previously withheld.previously withheld less all associated damages, costs and expenses, suffered or accrued by the Owner. In the event the Owner nullifies a previously issued Certificate for Payment, and the Owner has, prior to such nullification, paid thereon, the Design-Builder shall promptly reimburse to the Owner amounts the latter had paid pursuant to the nullified Certificate for Payment. Alternately, the Owner may withhold payment in any subsequent Application for Payment, until and unless the reasons for nullification of the previously issued Certificate for Payment have been remedied and all associated damages, costs, and expenses of Owner have been paid by the Design-Builder. § 9.5.3 If the Owner withholds certification for payment under Section 9.5.1.3, the Owner may, at its sole option, issue joint checks to the Design-Builder and to the Architect or any Consultants, Contractor, material or equipment suppliers, or other persons or entities providing services or work for the Design-Builder to whom the Design-Builder failed to make payment for Work properly performed or material or equipment suitably delivered. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 38 § 9.5.4 The Design-Builder shall not stop work or terminate the Contract if the Owner’s Lender (if any) should refuse to issue any certificate because the Application for Payment does not conform with the requirements of Sections 9.3, 9.4, 9.5 or any other portion of these General Conditions, as supplemented herein. § 9.6 Progress Payments § 9.6.1 After the Owner has issued a Certificate for Payment, the Owner shall make payment in the manner and within the time provided in the Design-Build Documents. § 9.6.2 The Design-Builder shall pay each Architect, Consultant, Contractor, and other person or entity providing services or work for the Design-Builder no later than the time period required by applicable law, but in no event more than seven (7) days after receipt of payment from the Owner the amount to which the Architect, Consultant, Contractor, and other person or entity providing services or work for the Design-Builder is entitled, reflecting percentages actually retained from payments to the Design-Builder on account of the portion of the Work performed by the Architect, Consultant, Contractor, or other person or entity. The Design-Builder shall, by appropriate agreement with each Architect, Consultant, Contractor, and other person or entity providing services or work for the Design-Builder, require each Architect, Consultant, Contractor, and other person or entity providing services or work for the Design-Builder to make payments to subconsultants and subcontractors in a similar manner. § 9.6.3 The Owner will, on request and if practicable, furnish to the Architect, a Consultant, Contractor, or other person or entity providing services or work for the Design-Builder, information regarding percentages of completion or amounts applied for by the Design-Builder and action taken thereon by the Owner on account of portions of the Work done by such Architect, Consultant, Contractor or other person or entity providing services or work for the Design-Builder. § 9.6.4 The Owner has the right to request written evidence from the Design-Builder that the Design-Builder has properly paid the Architect, Consultants, Contractors, or other person or entity providing services or work for the Design-Builder, amounts paid by the Owner to the Design-Builder for the Work. If the Design-Builder fails to furnish such evidence within seven (7) days, the Owner shall have the right to contact the Architect, Consultants, and Contractors to ascertain whether they have been properly paid. The Owner shall have no obligation to pay or to see to the payment of money to a Consultant or Contractor, except as may otherwise be required by law. § 9.6.5 Design-Builder payments to material and equipment suppliers shall be treated in a manner similar to that provided in Sections 9.6.2, 9.6.3 and 9.6.4. § 9.6.6 A Certificate for Payment, a progress payment, or partial or entire use or occupancy of the Project by the Owner shall not constitute acceptance of Work not in accordance with the Design-Build Documents. § 9.6.7 Unless the Design-Builder provides the Owner with a payment bond in the full penal sum of the Contract Sum, payments The Design-Builder shall not withhold from any Subcontractor sums due the Subcontractor for completed Work which has been paid for by the Owner. Sums withheld by the Owner from the Design-Builder for deficiencies solely attributable to the Design-Builder shall not be grounds for the Design-Builder to withhold sums due to any Subcontractor. All sums paid to the Design-Builder for labor, materials, or equipment for the Work or Project shall be considered trust funds to be used by the Design-Builder for payment to those persons and entities to the extent providing labor, materials and/or equipment incorporated into the Work or Project. Payments received by the Design-Builder for Work properly performed by the Architect, Consultants, Contractors and other person or entity providing services or work for the Design-Builder, shall be held by the Design-Builder for the Architect and those Consultants, Contractors, or other person or entity providing services or work for the Design-Builder, for which payment was made by the Owner. Nothing However, notwithstanding the above, nothing contained herein shall require money to be placed in a separate account and not commingled with money of the Design-Builder, shall create any fiduciary liability or tort liability on the part of the Design-Builder for breach of trust or shall entitle any person or entity to an award of punitive damages against the Design-Builder for breach of the requirements of this provision. In addition to this contractual trust requirement, Design-Builder understands and acknowledges that all payments under this Contract are considered construction trust fund payments for the purposes of application of Chapter 162 of the Texas Property Code. § 9.6.8 The Design-Builder agrees to keep the Work and the site of the Project and all project bonds free and clear of all liens and verified claims related to labor and materials furnished in connection with the Work. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 39 § 9.6.9 Notwithstanding anything to the contrary contained in the Design-Build Documents , if any lien or verified claim is filed or there is evidence to believe that any lien or verified claim may be filed at any time during the progress of the Work or the duration of this Contract, the Owner may refuse to make any payment otherwise due the Design-Builder or may withhold from any payment due the Design-Builder a sum sufficient in the opinion of the Owner to pay all obligations and expenses necessary to satisfy such lien or verified claim. The Owner may withhold such payment unless or until the Design-Builder, within ten (10) calendar days after demand therefore by the Owner, shall furnish satisfactory evidence that the indebtedness and any lien or verified claim in respect thereof has been satisfied, discharged, and released of record, or that the Design-Builder has legally caused such lien or verified claim to be released of record pending the resolution of any dispute between the Design-Builder and the person or persons filing the lien or verified claim. If the Design-Builder fails to furnish satisfactory evidence within ten (10) calendar days of the demand thereof, the Design-Builder and the Owner shall meet within two (2) additional business days to review and agree in writing on the Design-Builder’s action plan for disposing of the lien or verified claim in question. Failing an agreement satisfactory to the Owner, the Owner may discharge such indebtedness in any manner and may deduct the amount thereof, together with any and all losses, costs, damages, and attorney’s fees suffered or incurred by the Owner from any sum payable to the Design-Builder under the Design-Build Documents, including but not limited to final payment and retained amounts. § 9.6.10 If the Owner is entitled to reimbursement or payment from the Design-Builder under or pursuant to the Design-Build Documents, such payment shall be made promptly upon demand by the Owner. Notwithstanding anything contained in the Design-Build Documents to the contrary, if the Design-Builder fails to promptly make any payment due the Owner, or if the Owner incurs any costs and expenses to cure any default of the Design-Builder or to correct defective Work, the Owner shall have an absolute right to offset such amount against the Contract Sum and may, at the Owner’s sole discretion, elect either to (i) deduct an amount equal to that which the Owner is entitled from any payment then or thereafter due the Design-Builder from the Owner, or (ii) issue a written notice to the Design-Builder reducing the Contract Sum by an amount equal to that which the Owner is entitled. § 9.7 Failure of Payment If the Owner does not issue a Certificate for Payment, through no fault of the Design-Builder, within the time required by the Design-Build Documents, then the Design-Builder may, upon seven (7) additional days’ written notice to the Owner, stop the Work until payment of the amount owing has been received. The Contract Time shall be extended appropriately and the Contract Sum shall be increased by the amount of the Design-Builder’s reasonable costs of shut-down, delay and start-up, plus interest as provided for in the Design-Build Documents. § 9.8 Substantial Completion § 9.8.1 Substantial Completion is the stage in the progress of the Work when the Work or designated portion thereof is sufficiently complete in accordance with the Design-Build Documents so that the Owner can occupy or utilize the Work for its intended use. The date of Substantial Completion is the date certified by the Owner in accordance with this Section 9.8.use, all major systems are operational, and all safety features are completed and Owner’s receipt of written confirmation after final inspections by the applicable electrical, plumbing, fire department, health department, and other local and state officials having jurisdiction, stating the project is ready for occupancy by the Owner. In addition to the other requirements of the Design-Build Documents, and without limitation the Design-Builder must also have obtained the written approval and issuance of any occupancy permits required by the laws of local government(s) and the State of Texas before the Contractor shall be deemed to have achieved Substantial Completion. § 9.8.2 When the Design-Builder considers that the Work, or a portion thereof which the Owner agrees to accept separately, is substantially complete, the Design-Builder shall prepare and submit to the Owner a comprehensive list of items to be completed or corrected prior to final payment. The Design-Builder shall proceed promptly to complete and correct items on the list. Failure to include an item on such list does not alter the responsibility of the Design-Builder to complete all Work in accordance with the Design-Build Documents. The Design-Builder will also provide the Owner a comprehensive list of all claims previously and properly made in writing and identified by the Design-Builder as unsettled at the time of Substantial Completion. § 9.8.3 Upon receipt of the Design-Builder’s list, the Owner shall make an inspection observation to determine whether the Work or designated portion thereof is substantially complete. If the Owner’s inspection observation discloses any item, whether or not included on the Design-Builder’s list, which is not sufficiently complete in accordance with the Design-Build Documents so that the Owner can occupy or utilize the Work or designated portion thereof for its DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 40 intended use, the Design-Builder shall, before issuance of the Certificate of Substantial Completion, complete or correct such item upon notification by the Owner. In such case, the Design-Builder shall then submit a request for another inspection observation by the Owner to determine Substantial Completion. § 9.8.4 Prior to issuance of the Certificate of Substantial Completion under Section 9.8.5, the Owner and Design-Builder shall discuss and then determine the parties’ obligations to obtain and maintain property insurance following issuance of the Certificate of Substantial Completion. Such determination shall be documented in writing by the Design-Builder; provided to the Owner for approval. § 9.8.5 When the Work or designated portion thereof is substantially complete, the Design-Builder will prepare for the Owner’s signature a Certificate of Substantial Completion that shall, upon the Owner’s signature, establish the date of Substantial Completion; establish responsibilities of the Owner and Design-Builder for security, maintenance, heat, utilities, damage to the Work and insurance; and fix the time within which the Design-Builder shall finish all items on the list accompanying the Certificate. Warranties required by the Design-Build Documents shall commence on the date of Substantial Completion of the Work or designated portion thereof unless otherwise provided in the Certificate of Substantial Completion. § 9.8.6 The Certificate of Substantial Completion shall be submitted by the Design-Builder to the Owner for written acceptance of responsibilities assigned to it in the Certificate. Upon the Owner’s acceptance, and consent of surety, if any, the Owner shall make payment of retainage applying to the Work or designated portion thereof. Payment shall be adjusted for Work that is incomplete or not in accordance with the requirements of the Design-Build Documents. § 9.8.6 The Design-Builder’s acceptance of payment per Section 9.8.5 shall constitute a waiver for all purposes of all claims by the Design-Builder against the Owner, except those previously and properly made in writing and identified in the list provided by the Design-Builder as unsettled at the time of Substantial Completion per Sections 9.8.2. § 9.9 Partial Occupancy or Use § 9.9.1 The Owner may occupy or use any completed or partially completed portion of the Work at any stage when such portion is designated by separate agreement with the Design-Builder, provided such occupancy or use is consented to, by endorsement or otherwise, by as such occupancy or use has been consented to by the Design-Builder in advance herein, the Design-Builder shall obtain by endorsement or otherwise, similar consent from the insurer providing property insurance and authorized by secure authorization for such use from the public authorities having jurisdiction over the Project. Such partial occupancy or use may commence whether or not the portion is substantially complete, provided the Owner and Design-Builder have accepted in writing the responsibilities assigned to each of them for payments, retainage, if any, security, maintenance, heat, utilities, damage to the Work and insurance, and have agreed in writing concerning the period for correction of the Work and commencement of warranties required by the Design-Build Documents. When the Design-Builder considers a portion substantially complete, the Design-Builder shall prepare and submit a list to the Owner as provided under Section 9.8.2. Consent of the Design-Builder to partial occupancy or use shall not be unreasonably withheld. The stage of the progress of the Work shall be determined by written agreement between the Owner and Design-Builder. § 9.9.2 Immediately prior to such partial occupancy or use, the Owner and Design-Builder shall jointly inspect the area to be occupied or portion of the Work to be used in order to determine and record the condition of the Work. § 9.9.3 Unless otherwise agreed upon, partial occupancy or use of a portion or portions of the Work shall not constitute acceptance of Work not complying with the requirements of the Design-Build Documents. § 9.10 Final Completion and Final Payment § 9.10.1 Upon receipt of the Design-Builder’s written notice that the Work is ready for final inspection observation and acceptance and upon receipt of a final Application for Payment, the Owner will promptly make such inspection. observation. When the Owner finds the Work acceptable under the Design-Build Documents and the Contract fully performed, the Owner will, subject to Section 9.10.2, promptly issue a final Certificate for Payment. § 9.10.2 Neither final payment nor any remaining retained percentage shall become due until the Design-Builder submits to the Owner (1) an affidavit that payrolls, bills for materials and equipment, and other indebtedness connected with the Work, for which the Owner or the Owner’s property might be responsible or encumbered, (less amounts withheld by Owner) have been paid or otherwise satisfied, (2) a certificate evidencing that insurance required DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 41 by the Design-Build Documents to remain in force after final payment is currently in effect, and will not be cancelled or allowed to expire until at least forty-five (45) days written notice is given the Owner, (3) a written statement that the Design-Builder knows of no substantial reason that the insurance will not be renewable to cover the period required by the Design-Build Documents, (4) consent of surety, if any, to final payment, (5) as-constructed record copy of the Construction Documents marked to indicate field changes and selections made during construction, (6) manufacturer’s warranties, product data, and maintenance and operations manuals, and (7) if required by the Owner, other data establishing payment or satisfaction of obligations, such as receipts, or releases and waivers of liens, claims, security interests, or encumbrances, arising out of the Contract, to the extent and in such form as may be designated by the Owner. If an Architect, a Consultant, or a Contractor, or other person or entity providing services or work for the Design-Builder, refuses to furnish a release or waiver required by the Owner, the Design-Builder may furnish a bond satisfactory to the Owner to indemnify the Owner against such liens, claims, security interests, or encumbrances. If such liens, claims, security interests, or encumbrances remains unsatisfied after payments are made, the Design-Builder shall refund to the Owner all money that the Owner may be compelled to pay in discharging such liens, claims, security interests, or encumbrances, including all costs and reasonable attorneys’ fees. § 9.10.2.1 In addition to items listed in 9.10.2 to be submitted before Final Payment will be made or remaining retainage released, Design-Builder shall deliver a permanent certificate of occupancy from local authorities having jurisdiction. § 9.10.3 If, after Substantial Completion of the Work, final completion thereof is materially delayed through no fault of the Design-Builder or by issuance of Change Orders affecting final completion, the Owner shall, upon application by the Design-Builder, and without terminating the Contract, make payment of the balance due for that portion of the Work fully completed and accepted. If the remaining balance for Work not fully completed or corrected is less than retainage stipulated in the Design-Build Documents, and if bonds have been furnished, the written consent of surety to payment of the balance due for that portion of the Work fully completed and accepted shall be submitted by the Design-Builder to the Owner prior to issuance of payment. Such payment shall be made under terms and conditions governing final payment, except that it shall not constitute a waiver of claims. § 9.10.4 The making of final payment shall constitute a waiver of Claims by the Owner except those arising from .1 liens, Claims, bond claims, Claims, liquidated damages, security interests or encumbrances arising out of the Contract and unsettled; .2 failure of the Work to comply with the requirements of the Design-Build Documents;or .3 terms of special warranties required by the Design-Build Documents.by the Design-Build Documents; .4 audits performed by the Owner, if permitted by the Design-Build Documents, after final payment; or .5 gross negligence, willful misconduct, or fraudulent concealment in connection with the performance of the Contract. § 9.10.5 Acceptance Application for and acceptance of final payment by the Design-Builder shall constitute a waiver of claims by the Design-Builder against the Owner except those previously made in writing and identified by the Design-Builder as unsettled at the time of final Application for Payment.arising after the waiver given at Substantial Completion payment described in Sections 9.8.2 and 9.8.6. § 9.10.6 In addition to any other damages, failure of the Design-Builder to achieve final completion within sixty (60) days after the specified date of Substantial Completion, subject to authorized extensions, will result in the Design-Builder being responsible for excess Owner’s consultant(s)’ fees beyond their original scope of services required to achieve final completion ("Excess Fees"). Excess Fees will be deducted from the amount due the Design-Builder. ARTICLE 10 PROTECTION OF PERSONS AND PROPERTY § 10.1 Safety Precautions and Programs The Design-Builder shall be responsible for initiating, maintaining and supervising all safety precautions and programs in connection with the performance of the Contract. Design-Builder’s and all Subcontractors’ Safety Programs shall comply with all applicable requirements of the Occupational Safety and Health Act of 1970, and all other applicable state, local, or federal laws or regulations. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 42 § 10.2 Safety of Persons and Property § 10.2.1 The Design-Builder shall be responsible for precautions for the safety of, and reasonable protection to prevent damage, injury or loss to all of the following: .1 employees on the Work and other persons who may be affected thereby; .2 the Work and materials and equipment to be incorporated therein, whether in storage on or off the site, under care, custody or control of the Design-Builder or the Architect, Consultants, or Contractors, or other person or entity providing services or work for the Design-Builder; and .3 other property at the site or adjacent thereto, such as trees, shrubs, lawns, walks, pavements, roadways, or structures and utilities not designated for removal, relocation or replacement in the course of construction. § 10.2.2 The Design-Builder shall comply with, and give notices required by, applicable laws, statutes, ordinances, codes, rules and regulations, and lawful orders of public authorities, bearing on safety of persons or property, or their protection from damage, injury or loss. § 10.2.3 The Design-Builder shall implement, erect, and maintain, as required by existing conditions and performance of the Contract, reasonable safeguards for safety and protection, including posting danger signs and other warnings against hazards, promulgating safety regulations, and notify owners and users of adjacent sites and utilities of the safeguards and protections. The Design-Builder shall also be responsible, at the Design-Builder’s sole cost and expense, for all measures necessary to protect any property adjacent to the Project and improvements therein. Any damage to such property or improvements shall be promptly repaired by the Design-Builder. § 10.2.4 When use or storage of explosives or other hazardous materials or equipment, or unusual methods, are necessary for execution of the Work, the Design-Builder shall exercise utmost care, and carry on such activities under supervision of properly qualified personnel.personnel, and the Design-Builder shall give the Owner reasonable advance written notice of such planned activities. § 10.2.5 The Design-Builder shall promptly remedy damage and loss (other than damage or loss insured under property insurance required by the Design-Build Documents) to property referred to in Sections 10.2.1.2 and 10.2.1.3, caused in whole or in part by the Design-Builder, the Architect, a Consultant, a Contractor, or anyone directly or indirectly employed by any of them, or by anyone for whose acts they may be liable and for which the Design-Builder is responsible under Sections 10.2.1.2 and 10.2.1.3; except damage or loss attributable to acts or omissions of the Owner, or anyone directly or indirectly employed by the Owner, or by anyone for whose acts the Owner may be liable, and not attributable to the fault or negligence of the Design-Builder. The foregoing obligations of the Design-Builder are in addition to the Design-Builder’s obligations under Section 3.1.14. § 10.2.6 The Design-Builder shall designate a responsible member of the Design-Builder’s organization, at the site, whose duty shall be the prevention of accidents. This person shall be the Design-Builder’s superintendent unless otherwise designated by the Design-Builder in writing to the Owner. § 10.2.7 The Design-Builder shall not permit any part of the construction or site to be loaded so as to cause damage or create an unsafe condition. § 10.2.8 Injury or Damage to Person or Property. If the Owner or Design-Builder suffers injury or damage to person or property because of an act or omission of the other, or of others for whose acts such party is legally responsible, written notice of the injury or damage, whether or not insured, shall be given to the other party within a reasonable time not exceeding 21 twenty-one (21) days after discovery. The notice shall provide sufficient detail to enable the other party to investigate the matter. § 10.2.9 The Design-Builder shall immediately report in writing to the Owner all accidents arising out of or in connection with the Work that cause death, personal injury, or property damage, giving full details and statements of any witnesses. In addition, if death, serious personal injuries, or serious damages are caused, the accident shall be reported immediately electronically, as well as by telephone or messenger to the Owner. § 10.3 Hazardous Materials § 10.3.1 Hazardous materials include any material in such quantity, concentration, and physical or chemical characteristics including but not limited to ignitability or toxicity, so as to be capable of posing an unreasonable risk to DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 43 health, safety and/or property if released into the atmosphere, transported, stored, or disposed of. The Design-Builder is responsible for compliance with any requirements included in the Design-Build Documents regarding hazardous materials. If the Design-Builder encounters a hazardous material or substance not addressed in the Design-Build Documents and if reasonable precautions will be inadequate to prevent foreseeable bodily injury or death to persons resulting from a material or substance, including but not limited to asbestos or polychlorinated biphenyl (PCB), encountered on the site by the Design-Builder, the Design-Builder shall, upon recognizing the condition, immediately stop Work in the affected area and report the condition to the Owner in writing. § 10.3.2 Upon receipt of the Design-Builder’s written notice, the Owner shall obtain the services of a licensed laboratory to verify the presence or absence of the material or substance reported by the Design-Builder and, in the event such material or substance is found to be present, to cause it to be rendered harmless. Unless otherwise required by the Design-Build Documents, the Owner shall furnish in writing to the Design-Builder the names and qualifications of persons or entities who are to perform tests verifying the presence or absence of such material or substance or who are to perform the task of removal or safe containment of such material or substance. The Design-Builder will promptly reply to the Owner in writing stating whether or not the Design-Builder has reasonable objection to the persons or entities proposed by the Owner. If the Design-Builder has an objection to a person or entity proposed by the Owner, the Owner shall propose another to whom the Design-Builder has no reasonable objection. When the material or substance has been rendered harmless, Work in the affected area shall resume upon written agreement of the Owner and Design-Builder. By Change Order, Order duly processed and approved, the Contract Time shall be extended appropriately and the Contract Sum shall be increased in the amount of the Design-Builder’s reasonable additional costs of shut-down, delay and start-up. § 10.3.3 To the fullest extent permitted by law, the Owner shall indemnify and hold harmless the Design-Builder, the Architect, Consultants, and Contractors, and employees of any of them, from and against claims, damages, losses and expenses, including but not limited to attorneys’ fees, arising out of or resulting from performance of the Work in the affected area, if in fact the material or substance presents the risk of bodily injury or death as described in Section 10.3.1 and has not been rendered harmless, provided that such claim, damage, loss or expense is attributable to bodily injury, sickness, disease or death, or to injury to, or destruction of, tangible property (other than the Work itself), except to the extent that such damage, loss or expense is due to the fault or negligence of the party seeking indemnity.start-up, both as specified in Article 6. The term "rendered harmless" shall be interpreted to mean, without limitation that levels of hazardous materials, including but not limited to asbestos and polychlorinated biphenyls, are less than any applicable exposure standards set forth in OSHA regulations. In no event, however, shall the Owner have any responsibility for any substance or material that is brought to the Project site by the Design-Builder, any Subcontractor, any material supplier, or any entity for whom any of them is responsible. The Design-Builder agrees not to use any fill or other materials to be incorporated into the Work that are hazardous, toxic, or made up of any items that are hazardous or toxic. § 10.3.3 Not Used. § 10.3.4 The Owner shall not be responsible under this Section 10.3 for materials or substances the Design-Builder brings to the site unless such materials or substances are required by the Owner’s Criteria. The Owner shall be responsible for materials or substances required by the Owner’s Criteria, except to the extent of the Design-Builder’s fault or negligence in the use and handling of such materials or substances. § 10.3.5 The Design-Builder shall indemnify the Owner for the cost and expense the Owner incurs (1) for remediation of a material or substance the Design-Builder brings to the site and negligently handles, or (2) where the Design-Builder fails to perform its obligations under Section 10.3.1, except to the extent that the cost and expense are due to the Owner’s fault or negligence. § 10.3.6 If, without negligence on the part of the Design-Builder, the Design-Builder is held liable by a government agency for the cost of remediation of a hazardous material or substance solely by reason of performing Work as required by the Design-Build Documents, the Owner shall indemnify the Design-Builder for all cost and expense thereby incurred. § 10.4 Emergencies In an emergency affecting safety of persons or property, the Design-Builder shall act, at the Design-Builder’s discretion, to prevent threatened damage, injury or loss. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 44 § 10.5 Site Visits Anyone other than the Owner’s designated representatives and other consultants visiting the job site who is not employed by a Design-Builder shall be required to register with the Design-Builder’s site office before proceeding onto the job site. ARTICLE 11 UNCOVERING AND CORRECTION OF WORK § 11.1 Uncovering of Work The Owner may request to examine a portion of the Work that the Design-Builder has covered to determine if the Work has been performed in accordance with the Design-Build Documents. If such Work is in accordance with the Design-Build Documents, the Owner and Design-Builder shall execute a Change Order to adjust the Contract Time and Contract Sum, as appropriate. If such Work is not in accordance with the Design-Build Documents, the costs of uncovering and correcting the Work shall be at the Design-Builder’s expense and the Design-Builder shall not be entitled to a change in the Contract Time unless the condition was caused by the Owner or a separate contractor in which event the Owner shall be responsible for payment of such costs and the Contract Time will be adjusted as appropriate. § 11.2 Correction of Work § 11.2.1 Before or After Substantial Completion. The Design-Builder shall promptly correct Work rejected by the Owner or failing to conform to the requirements of the Design-Build Documents, whether discovered before or after Substantial Completion and whether or not fabricated, installed or completed. Costs of correcting such rejected Work, specifically including but not limited to additional testing and inspections, the cost of uncovering and replacement, and replacement the cost of any additional supervision, material, labor, equipment, rental charges, home office overhead, and other expenditures necessitated to both rectify the non-complying conditions, protect adjacent Work of both the Design-Builder and the Project, and restore Work by the Design-Builder and others necessarily damaged in the course of rectifying the non-complying conditions; as well as, and compensation for any design consultant employed by the Owner whose expenses and compensation were made necessary thereby, shall be at the Design-Builder’s expense. § 11.2.1.1 If prior to the date of Substantial Completion the Design-Builder, a Subcontractor, or anyone for whom either is responsible uses or damages any portion of the Work, including, without limitation, mechanical, electrical, plumbing, and other building systems, machinery, equipment, or other mechanical device, the Design-Builder shall cause such item to be restored to "like new" condition at no expense to the Owner. In addition, the Design-Builder shall promptly remedy damage and loss arising in conjunction with the Project caused in whole or in part by the Design-Builder, a Subcontractor, a Sub-subcontractor, supplier, or anyone directly or indirectly employed by any of them, or anyone for whose acts they may be liable or for which the Design-Builder is otherwise responsible. § 11.2.2 After Substantial Completion § 11.2.2.1 In addition to the Design-Builder’s obligations under Section 3.1.12, if, within one year after the date of Substantial Completion of the Work or designated portion thereof or after the date for commencement of warranties established under Section 9.9.1, or by terms of an applicable special warranty required by the Design-Build Documents, or within such longer period as may be prescribed by law, any of the Work is found not to be in accordance with the requirements of the Design-Build Documents, the Design-Builder shall correct it promptly after receipt of written notice from the Owner to do so unless the Owner has previously given the Design-Builder a written acceptance of such condition. The Owner shall give such notice promptly after discovery of the condition. During If the condition is reasonably discoverable, during the one-year period for correction of the Work, if and the Owner fails to notify the Design-Builder and give the Design-Builder an opportunity to make the correction, the Owner waives the rights to require correction by the Design-Builder and to make a claim for breach of warranty. If the Design-Builder fails to correct nonconforming Work within a reasonable time during that period after receipt of notice from the Owner, the Owner may correct it in accordance with Section 7.9.Section 7.9, and charge the reasonable costs to the Design-Builder. § 11.2.2.2 The one-year period for correction of Work shall be extended with respect to portions of Work first performed after Substantial Completion also be extended by the period of time between Substantial Completion and the actual completion of that portion the corrective Work performed by the Design-Builder pursuant to this Section 11.2, but only with respect to the corrected portions of the Work. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 45 § 11.2.2.3 The one-year period for correction of Work shall not be extended by corrective Work performed by the Design-Builder pursuant to this Section 11.2.Not Used. § 11.2.3 The Design-Builder shall remove from the site portions of the Work that are not in accordance with the requirements of the Design-Build Documents and are neither corrected by the Design-Builder nor accepted by the Owner.Not Used. § 11.2.4 The Design-Builder shall bear the cost costs of correcting destroyed or damaged construction of the Owner or separate contractors, whether completed or partially completed, caused by the Design-Builder’s correction or removal of Work that is not in accordance with the requirements of the Design-Build Documents. These costs specifically include, but are not limited to such additional supervision, material, labor, equipment rental charges, home office overhead, and other expenditures necessitated to both rectify the non-complying conditions, protect adjacent Work, and restore Work by the Design-Builder and others necessarily damaged in the course of rectifying the non-complying conditions. § 11.2.5 Nothing contained in this Section 11.2 shall be construed to establish a period of limitation with respect to other obligations the Design-Builder has under the Design-Build Documents. Establishment of the one-year period for correction of Work as described in Section 11.2.2 relates only to the specific obligation of the Design-Builder to correct the Work, and has no relationship to the time within which the obligation to comply with the Design-Build Documents may be sought to be enforced, nor to the time within which proceedings may be commenced to establish the Design-Builder’s liability with respect to the Design-Builder’s obligations other than specifically to correct the Work. §11.2.6 The Design-Builder’s obligations under this Section 11.2 shall, without limitation, survive acceptance of the Work under the Contract and termination of the Contract. § 11.3 Acceptance of Nonconforming Work If the Owner prefers to accept Work that is not in accordance with the requirements of the Design-Build Documents, the Owner may do so instead of requiring its removal and correction, in which case the Contract Sum will be reduced as appropriate and equitable. Such adjustment shall be effected whether or not final payment has been made. In the event final payment has been made by the Owner subsequent to accepting such non-conforming Work, the Design-Builder shall pay the Owner, the reduction in the Contact Sum occasioned by such acceptance. ARTICLE 12 COPYRIGHTS AND LICENSESARTICLE 12 OWNERSHIP & USE OF DRAWINGS, SPECIFICATIONS, & OTHER DESIGN DOCUMENTS § 12.1 Drawings, specifications, and other documents furnished by the Design-Builder, including those in electronic form, are Instruments of Service. The Design-Builder, and the Architect, Consultants, Contractors, and any other person or entity providing services or work for any of them, shall be deemed the authors and owners of their respective Instruments of Service, including the Drawings and Specifications, and shall retain all common law, statutory and other reserved rights, including copyrights. Submission or distribution of Instruments of Service to meet official regulatory requirements, or for similar purposes in connection with the Project, is not to be construed as publication in derogation of the reserved rights of the Design-Builder and the Architect, Consultants, and Contractors, and any other person or entity providing services or work for any of them. Design Documents. Design Documents are the product of work made for hire. These are and shall remain the sole property of the Owner. The Design-Builder assigns to Owner all remaining proprietary rights that the Design-Builder may possess in the Design Documents including, without limitation, all copyright and other intellectual property rights. Disputes between the parties shall not impact this transfer of ownership, neither will a termination of this Agreement. In the event of a dispute between the parties regarding payment for Basic or Additional Services, the Design-Builder is not obligated to deliver additional Design Documents or services for which it claims that it has not been paid, but the Owner’s right to use the Design Documents and other services in its possession shall not be restricted. § 12.2 The Design-Builder and the Owner warrant that in transmitting Instruments of Service, or any other information, the transmitting party is the copyright owner of such information or has permission from the copyright owner to transmit such information for its use on the Project.Project is the property of the Owner, and, without limitation, the Design-Builder may not use the Design Documents for any purpose not related to the Project without the Owner’s prior written consent. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 46 § 12.3 Upon execution of the Agreement, the Design-Builder grants to the Owner a limited, irrevocable and non-exclusive license to use the Instruments of Service solely and exclusively for purposes of constructing, using, maintaining, altering and adding to the Project, provided that the Owner substantially performs its obligations, including prompt payment of all sums when due, under the Design-Build Documents. The license granted under this section permits the Owner to authorize its consultants and separate contractors to reproduce applicable portions of the Instruments of Service solely and exclusively for use in performing services or construction for the Project. If the Design-Builder rightfully terminates this Agreement for cause as provided in Section 13.1.4 or 13.2.1 the license granted in this Section 12.3 shall terminate. Design-Builder, the Architect, Consultants, Subcontractor and any other person or entity providing services or work for any of them are authorized to use and reproduce the Design Documents provided to them solely and exclusively for execution of the Work. All copies made under this authorization shall bear the copyright notice, if any, shown on the Design Documents. The Design-Builder, Architect, Consultants, Subcontractor and any other person or entity providing services or work for any of them may not use the Design Documents on other projects or for additions to this Project outside the scope of the Work without the specific written consent of the Owner. § 12.3.1 The Design-Builder shall obtain non-exclusive licenses from include in its agreements with the Architect, Consultants, and Contractors, Subcontractors, commitments that will allow the Design-Builder to satisfy its obligations to the Owner under this Article 12. The Design-Builder’s licenses from the Architect and its Consultants and Contractors shall also allow the Owner, in the event this Agreement is terminated for any reason other than the default of the Owner or in the event the Design-Builder’s Architect, Consultants, or Contractors terminate their agreements with the Design-Builder for cause, to obtain a limited, irrevocable and non-exclusive license solely and exclusively for purposes of constructing, using, maintaining, altering and adding to the Project, provided that the Owner (1) agrees to pay to the Architect, Consultant or Contractor all amounts due, and (2) provide the Architect, Consultant or Contractor with the Owner’s written agreement to indemnify and hold harmless the Architect, Consultant or Contractor from all costs and expenses, including the cost of defense, related to claims and causes of action asserted by any third person or entity to the extent such costs and expenses arise from the Owner’s alteration or use of the Instruments of Service. § 12.3.2 In the event the Owner alters the Instruments of Service Design Documents without the author’s written authorization or uses the Instruments of Service Design Documents without retaining the authors of the Instruments of Service, Design Documents, the Owner releases the Design-Builder, Architect, Consultants, Contractors and any other person or entity providing services or work for any of them, from all claims and causes of action arising from or related to such uses. The Owner, to the extent permitted by law, further agrees to indemnify and hold harmless the Design-Builder, Architect, Consultants, Contractors and any other person or entity providing services or work for any of them, from all costs and expenses, including the cost of defense, related to claims and causes of action asserted by any third person or entity to the extent such costs and expenses arise from the Owner’s alteration or use of the Instruments of Service under this Section 12.3.2. The terms of this Section 12.3.2 shall not apply if the Owner rightfully terminates this Agreement for cause under Sections 13.1.4 or 13.2.2. § 12.4 When requested by the Owner, the Design-Builder shall furnish to the Owner the most current Design Documents, to include, without limitation all the most current drawings, design and engineering calculations, specifications, and any other information which the Design-Builder, Architect or the Design-Builder’s Consultant(s) have created in connection with or for the Project. At a minimum this information shall be provided in electronic format compatible with the most recent versions of the industry standard software for such information. Specifically, drawings shall be compatible with AutoCADD; design and engineering calculations compatible with MS Excel; and specifications with MS Word. All layers and information shall be fully accessible (not "PDF", "protected", or "plot" files). § 12.5 Submittal or distribution of the Design Documents or any portion thereof to meet official regulatory requirements or for other purposes in connection with this Project is not to be construed as publication in derogation of the Owner’s reserved rights. § 12.6 The Design-Builder, at any time upon the request of the Owner, shall immediately return and surrender to the Owner, without limitation, all electronic and hard copies of any Project-related materials, records, notices, memoranda, recordings, drawings, specifications, mock-ups and any other documents furnished by the Architect to the Design-Builder. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 47 § 12.7 The representations and warranties contained in the Design-Build Documents shall survive the complete performance of the Work or earlier termination of this Agreement. ARTICLE 13 TERMINATION OR SUSPENSION § 13.1 Termination or Suspension Prior to Execution of the Design-Build Amendment § 13.1.1 If the Owner fails to make payments to the Design-Builder for Work prior to execution of the Design-Build Amendment in accordance with this Agreement, such failure shall be considered substantial nonperformance and cause for termination or, at the Design-Builder’s option, cause for suspension of performance of services under this Agreement. If the Design-Builder elects to suspend the Work, the Design-Builder shall give seven (7) days’ written notice to the Owner before suspending the Work. In the event of a suspension of the Work, the Design-Builder shall have no liability to the Owner for delay or damage caused by the suspension of the Work. Before resuming the Work, the Design-Builder shall be paid all sums due prior to suspension and any verifiable expenses reasonably and properly incurred in the interruption and resumption of the Design-Builder’s Work. The Design-Builder’s compensation for, and time to complete, the remaining Work shall be equitably adjusted. § 13.1.2 If the Owner suspends the Project, the Design-Builder shall be compensated for the Work performed prior to notice of such suspension. When the Project is resumed, the Design-Builder shall be compensated for verifiable expenses reasonably and properly incurred in the interruption and resumption of the Design-Builder’s Work. The Design-Builder’s compensation for, and time to complete, the remaining Work shall be equitably adjusted.adjusted as mutually agreed upon in writing by the Owner and Design-Builder. § 13.1.3 If the Owner suspends the Project for more than 90 ninety (90) cumulative days for reasons other than the fault of the Design-Builder, the Design-Builder may terminate this Agreement by giving not less than seven (7) days’ written notice. § 13.1.4 Either party may terminate this Agreement upon not less than seven (7) days’ written notice should the other party fail substantially to perform in accordance with the terms of this Agreement through no fault of the party initiating the termination. § 13.1.5 The Owner may terminate this Agreement upon not less than seven (7) days’ written notice to the Design-Builder for the Owner’s convenience and without cause. § 13.1.6 In the event of termination not the fault of the Design-Builder, the Design-Builder shall be compensated for Work performed prior to termination, together with Reimbursable Expenses then due and any other expenses directly attributable to termination for which the Design-Builder is not otherwise compensated. In no event shall the Design-Builder’s compensation under this Section 13.1.6 be greater than the compensation set forth in Section 2.1. § 13.2 Termination or Suspension Following Execution of the Design-Build Amendment § 13.2.1 Termination by the Design-Builder § 13.2.1.1 The Design-Builder may terminate the Contract if the Work is stopped for a period of 30 thirty (30) consecutive days through no act or fault of the Design-Builder, the Architect, a Consultant, or a Contractor, or their agents or employees, or any other persons or entities performing portions of the Work under direct or indirect contract with the Design-Builder, for any of the following reasons: .1 Issuance of an order of a court or other public authority having jurisdiction that requires all Work to be stopped; .2 An act of government, such as a declaration of national emergency that requires all Work to be stopped; or .3 Because the Owner has not issued a Certificate for Payment and has not notified the Design-Builder of the reason for withholding certification as provided in Section 9.5.1, or because the Owner has not made payment on a Certificate for Payment within the time stated in the Design-Build Documents; or Documents. .4 The Owner has failed to furnish to the Design-Builder promptly, upon the Design-Builder’s request, reasonable evidence as required by Section 7.2.7. § 13.2.1.2 The Design-Builder may terminate the Contract if, through no act or fault of the Design-Builder, the Architect, a Consultant, a Contractor, or their agents or employees or any other persons or entities performing portions of the Work under direct or indirect contract with the Design-Builder, repeated suspensions, delays or interruptions of the entire Work by the Owner as described in Section 13.2.3 constitute in the aggregate more than 100 percent one DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 48 hundred percent (100%) of the total number of days scheduled for completion, or 120 days in any 365-day one hundred and twenty (120) days in any three hundred and sixty-five (365) day period, whichever is less. § 13.2.1.3 If one of the reasons described in Section 13.2.1.1 or 13.2.1.2 exists, the Design-Builder may, upon seven (7) days’ written notice to the Owner, terminate the Contract and recover from the Owner payment for Work executed, including reasonable overhead and profit, costs incurred by reason of such termination, and damages. § 13.2.1.4 If the Work is stopped for a period of 60 sixty (60) consecutive days through no act or fault of the Design-Builder or any other persons or entities performing portions of the Work under contract with the Design-Builder because the Owner has repeatedly failed to fulfill the Owner’s obligations under the Design-Build Documents with respect to matters important to the progress of the Work, the Design-Builder may, upon seven (7) additional days’ written notice to the Owner, terminate the Contract and recover from the Owner as provided in Section 13.2.1.3. § 13.2.2 Termination by the Owner For Cause § 13.2.2.1 The Owner may terminate the Contract if the Design-Builder .1 fails to submit the Proposal by the date required by this Agreement, or if no date is indicated, within a reasonable time consistent with the date of Substantial Completion; .2 repeatedly refuses or fails to supply an Architect, or enough properly skilled Consultants, Contractors, or workers or proper materials; .3 fails to make payment to the Architect, Consultants, or Contractors for services, materials or labor in accordance with their respective agreements with the Design-Builder; .4 repeatedly disregards applicable laws, statutes, ordinances, codes, rules and regulations, or lawful orders of a public authority; or .5 is otherwise guilty of substantial breach of a provision of the Design-Build Documents. § 13.2.2.2 When any of the above reasons exist, the Owner may without prejudice to any other rights or remedies of the Owner and after giving the Design-Builder and the Design-Builder’s surety, if any, seven (7) days’ written notice, terminate employment of the Design-Builder and may, subject to any prior rights of the surety: .1 Exclude the Design-Builder from the site and take possession of all materials, equipment, tools, and construction equipment and machinery thereon owned by the Design-Builder; .2 Accept assignment of the Architect, Consultant and Contractor agreements pursuant to Section 3.1.15; and .3 Finish the Work by whatever reasonable method the Owner may deem expedient. Upon written request of the Design-Builder, the Owner shall furnish to the Design-Builder a detailed accounting of the costs incurred by the Owner in finishing the Work. § 13.2.2.3 When the Owner terminates the Contract for one of the reasons stated in Section 13.2.2.1, the Design-Builder shall not be entitled to receive further payment until the Work is finished. § 13.2.2.4 If the unpaid balance of the Contract Sum exceeds costs of finishing the Work and other damages incurred by the Owner and not expressly waived, such excess shall be paid to the Design-Builder. If such costs and damages exceed the unpaid balance, the Design-Builder shall pay the difference to the Owner. The obligation for such payments shall survive termination of the Contract. § 13.2.3 Suspension by the Owner for Convenience § 13.2.3.1 The Owner may, without cause, order the Design-Builder in writing to suspend, delay or interrupt the Work in whole or in part for such period of time as the Owner may determine. § 13.2.3.2 The Contract Sum and Contract Time shall be adjusted for increases in the cost and time caused by suspension, delay or interruption as described in Section 13.2.3.1. Adjustment of the Contract Sum shall include be as specified in Article 7 profit. No adjustment shall be made to the extent .1 that performance is, was or would have been so suspended, delayed or interrupted by another cause for which the Design-Builder is responsible; or .2 that an equitable adjustment is made or denied under another provision of the Contract. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 49 § 13.2.4 Termination by the Owner for Convenience § 13.2.4.1 The Owner may, at any time, terminate the Contract for the Owner’s convenience and without cause. § 13.2.4.2 Upon receipt of written notice from the Owner of such termination for the Owner’s convenience, the Design-Builder shall .1 cease operations as directed by the Owner in the notice; .2 take actions necessary, or that the Owner may direct, for the protection and preservation of the Work; and, .3 except for Work directed to be performed prior to the effective date of termination stated in the notice, terminate all existing Project agreements, including agreements with the Architect, Consultants, Contractors, and purchase orders, and enter into no further Project agreements and purchase orders. § 13.2.4.3 In case of Upon such termination for the Owner’s convenience, the Design-Builder shall be entitled to receive payment for Work executed, and costs incurred by reason of such termination, along with reasonable overhead and profit on the Work not executed.recover as its sole remedy payment for Work properly performed in connection with the terminated portion of the Work prior to the effective date of termination and for items properly and timely fabricated off the Project site, delivered and stored in accordance with the Design-Build Documents and Owner’s further instructions. The Design-Builder waives and forfeits all other claims for payment and damages, including, without limitation, anticipated profits, lost opportunity costs, and potential and actual unabsorbed overhead costs. The Owner shall be credited for (1) payments previously made to the Design-Builder for the terminated portion of the Work; (2) claims that the Owner has against the Design-Builder under the Contract; and (3) the value of the materials, supplies, equipment, or other items that are to be disposed of by the Design-Builder that are part of the Contract. ARTICLE 14 CLAIMS AND DISPUTE RESOLUTION § 14.1 Claims § 14.1.1 Definition. A Claim is a demand or assertion by one of the parties seeking, as a matter of right, payment of money, or other relief with respect to the terms of the Contract. The term "Claim" also includes other disputes and matters in question between the Owner and Design-Builder arising out of or relating to the Contract. The responsibility to substantiate Claims shall rest with the party making the Claim. § 14.1.2 Time Limits on Claims. The Owner and Design-Builder shall commence all claims and causes of action, whether in contract, tort, breach of warranty or otherwise, against the other, arising out of or related to the Contract in accordance with the requirements of the binding dispute resolution method selected in Section 1.3, within the time period specified by applicable law, but in any case not more than 10 years after the date of Substantial Completion of the Work. The Owner and Design-Builder waive all claims and causes of action not commenced in accordance with this Section 14.1.2.law. § 14.1.3 Notice of Claims § 14.1.3.1 Prior To Final Payment. Prior to Final Payment, Claims by either the Owner or Design-Builder must be initiated by written notice to the other party within 21 twenty-one (21) days after occurrence of the event giving rise to such Claim or within 21 twenty-one (21) days after the claimant first recognizes the condition giving rise to the Claim, whichever is later. The claimant shall use its best efforts to furnish the Initial Decision Maker and the other party, as expeditiously as possible, with notice of any Claim including, without limitation, those in connection with concealed or unknown conditions, once such claim is recognized, and shall cooperate with the party against whom the claim is made in any effort to mitigate the alleged or potential damages, delay, or other adverse consequences arising out of the condition that is the cause of such a Claim. § 14.1.3.2 Claims Arising After Final Payment. After Final Payment, Claims by either the Owner or Design-Builder that have not otherwise been waived pursuant to Sections 9.10.4 or 9.10.5, must be initiated by prompt written notice to the other party. The notice requirement in Section 14.1.3.1 and the Initial Decision requirement as a condition precedent to mediation in Section 14.2.1 shall not apply.within one hundred and eighty (180) days from the date of Final Payment by written notice to the Owner as a condition precedent to the Design-Builder’s right to sue on the Contract. § 14.1.4 Continuing Contract Performance. Pending final resolution of a Claim, except as otherwise agreed in writing or as provided in Section 9.7 and Article 13, the Design-Builder shall proceed diligently with performance of the Contract and the Owner shall continue to make payments in accordance with the Design-Build Documents. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 50 § 14.1.5 Claims for Additional Cost. If the Design-Builder intends to make a Claim for an increase in the Contract Sum, written notice as provided herein shall be given before proceeding to execute the portion of the Work that relates to the Claim. Prior notice is not required for Claims relating to an emergency endangering life or property arising under Section 10.4. § 14.1.6 Claims for Additional Time § 14.1.6.1 If the Design-Builder intends to make a Claim for an increase in the Contract Time, written notice as provided herein shall be given. The Design-Builder’s Claim shall include an estimate of cost and of probable effect of delay on progress of the Work. In the case of a continuing delay, only one Claim is necessary.in Section 8.3.4 and 8.3.5 shall be given. § 14.1.6.2 If adverse weather conditions are the basis for a Claim for additional time, such Claim shall be documented by data substantiating that weather conditions were abnormal for the period of time, could not have been reasonably anticipated, and had an adverse effect on the scheduled construction.in accordance with Section 8.3.5. § 14.1.7 Claims for Consequential Damages The Design-Builder and Owner waive Claims against each other for consequential damages arising out of or relating to this Contract. This mutual waiver includesincludes, but is not limited to: .1 damages incurred by the Owner for rental expenses, for losses of use, income, profit, financing, business and reputation, and for loss of management or employee productivity or of the services of such persons; and .2 damages incurred by the Design-Builder for principal office expenses including but not limited to the compensation of personnel stationed there, for losses of financing, business and reputation, impairment to or loss of bonding capacity, loss of business opportunities unabsorbed home office overhead, and for loss of profit except anticipated profit arising directly from the properly completed Work. This mutual waiver is applicable, without limitation, to all consequential damages due to either party’s termination in accordance with Article 13. Nothing contained in this Section 14.1.7 shall be deemed to preclude an award of liquidated damages, when applicable, in accordance with the requirements of the Design-Build Documents. § 14.2 Initial Decision § 14.2.1 An initial decision shall be required as a condition precedent to mediation of all Claims between the Owner and Design-Builder initiated prior to the date final payment is due, excluding those arising under Sections 10.3 and 10.4 of the Agreement and Sections B.3.2.9 and B.3.2.10 of Exhibit B to this Agreement, unless 30 unless thirty (30) days have passed after the Claim has been initiated with no decision having been rendered. Unless otherwise mutually agreed in writing, the The Owner shall render the initial decision on Claims. § 14.2.2 Procedure § 14.2.2.1 Claims Initiated by the Owner. If the Owner initiates a Claim, the Design-Builder shall provide a written response to Owner within ten (10) days after receipt of the notice required under Section 14.1.3.1. Thereafter, the Owner shall render an initial decision within ten (10) days of receiving the Design-Builder’s response: (1) withdrawing the Claim in whole or in part, (2) approving the Claim in whole or in part, or (3) suggesting a compromise. § 14.2.2.2 Claims Initiated by the Design-Builder. If the Design-Builder initiates a Claim, the Owner will take one or more of the following actions within ten (10) days after receipt of the notice required under Section 14.1.3.1: (1) request additional supporting data, (2) render an initial decision rejecting the Claim in whole or in part, (3) render an initial decision approving the Claim, (4) suggest a compromise or (5) indicate that it is unable to render an initial decision because the Owner lacks sufficient information to evaluate the merits of the Claim. § 14.2.3 In evaluating Claims, the Owner may, but shall not be obligated to, consult with or seek information from persons with special knowledge or expertise who may assist the Owner in rendering a decision. The retention of such persons shall be at the Owner’s expense. § 14.2.4 If the Owner requests the Design-Builder to provide a response to a Claim or to furnish additional supporting data, the Design-Builder shall respond, within ten (10) days after receipt of such request, and shall either (1) provide a response on the requested supporting data, (2) advise the Owner when the response or supporting data will be DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 51 furnished or (3) advise the Owner that no supporting data will be furnished. Upon receipt of the response or supporting data, if any, the Owner will either reject or approve the Claim in whole or in part. § 14.2.5 The Owner’s initial decision shall (1) be in writing; (2) state the reasons therefor; and (3) identify any change in the Contract Sum or Contract Time or both. The initial decision shall be final and binding on the parties but subject to mediation and, if the parties fail to resolve their dispute through mediation, to binding dispute resolution. § 14.2.6 Either party may file for mediation of an initial decision or request another method of alternative dispute resolution (ADR) other than mediation, as the parties may agree in writing at any time, subject to the terms of Section 14.2.6.1.Section 14.2.6.1, except that under no circumstances shall the agreed upon ADR include binding arbitration or binding mediation. § 14.2.6.1 Either party may, within 30 thirty (30) days from the date of an initial decision, demand in writing that the other party file for mediation within 60 or join in another method of ADR within sixty (60) days of the initial decision. If such a demand is made and the party receiving the demand fails to file for mediation agree to ADR within the time required, then both parties waive their rights to mediate or pursue binding dispute resolution ADR proceedings with respect to the initial decision. decision, and will default to litigation. § 14.2.7 In the event of a Claim against the Design-Builder, the Owner may, but is not obligated to, notify the surety, if any, of the nature and amount of the Claim. If the Claim relates to a possibility of a Design-Builder’s default, the Owner may, but is not obligated to, notify the surety and request the surety’s assistance in resolving the controversy. § 14.2.8 If a Claim relates to or is the subject of a mechanic’s lien, the party asserting such Claim may proceed in accordance with applicable law to comply with the lien notice or filing deadlines. § 14.3 Mediation § 14.3.1 Claims, disputes, or other matters in controversy arising out of or related to the Contract, except those waived as provided for in Sections 9.10.4, 9.10.5, and 14.1.7, shall be subject to mediation as a condition precedent to binding dispute resolution. Contract may be subject to nonbinding mediation or other ADR as mutually agreed by the parties. § 14.3.2 The parties shall endeavor to resolve their Claims by mediation which, unless the parties mutually agree otherwise, shall be administered by the American Arbitration Association in accordance with its Construction Industry Mediation Procedures in effect on the date of the Agreement. A request for mediation shall be made in writing, delivered to the other party to the Contract, and filed with the person or entity administering the mediation. The request may be made concurrently with the filing of binding dispute resolution proceedings but, in such event, mediation shall proceed in advance of binding dispute resolution proceedings, which shall be stayed pending mediation for a period of 60 days from the date of filing, unless stayed for a longer period by agreement of the parties or court order. If an arbitration proceeding is stayed pursuant to this Section 14.3.2, the parties may nonetheless proceed to the selection of the arbitrator(s) and agree upon a schedule for later proceedings.Not Used. § 14.3.3 The parties shall share the mediator’s fee and any filing fees equally. The mediation or ADR’s costs and fees and any filing fees equally if such process is utilized. The mediation or ADR shall be held in the place where the Project is located, unless another location is mutually agreed upon. Agreements reached in mediation shall be enforceable as settlement agreements in any court having jurisdiction. § 14.4 Arbitration § 14.4.1 If the parties have selected arbitration as the method for binding dispute resolution in Section 1.3, any Claim subject to, but not resolved by, mediation shall be subject to arbitration which, unless the parties mutually agree otherwise, shall be administered by the American Arbitration Association in accordance with its Construction Industry Arbitration Rules in effect on the date of the Agreement. A demand for arbitration shall be made in writing, delivered to the other party to the Contract, and filed with the person or entity administering the arbitration. The party filing a notice of demand for arbitration must assert in the demand all Claims then known to that party on which arbitration is permitted to be demanded. § 14.4.1.1 A demand for arbitration shall be made no earlier than concurrently with the filing of a request for mediation, but in no event shall it be made after the date when the institution of legal or equitable proceedings based on the Claim DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 52 would be barred by the applicable statute of limitations or statute of repose. For statute of limitations or statute of repose purposes, receipt of a written demand for arbitration by the person or entity administering the arbitration shall constitute the institution of legal or equitable proceedings based on the Claim. § 14.4.2 The award rendered by the arbitrator or arbitrators shall be final, and judgment may be entered upon it in accordance with applicable law in any court having jurisdiction. § 14.4.3 The foregoing agreement to arbitrate, and other agreements to arbitrate with an additional person or entity duly consented to by parties to the Agreement, shall be specifically enforceable under applicable law in any court having jurisdiction thereof. § 14.4.4 Consolidation or Joinder § 14.4.4.1 Either party, at its sole discretion, may consolidate an arbitration conducted under this Agreement with any other arbitration to which it is a party provided that (1) the arbitration agreement governing the other arbitration permits consolidation, (2) the arbitrations to be consolidated substantially involve common questions of law or fact, and (3) the arbitrations employ materially similar procedural rules and methods for selecting arbitrator(s). § 14.4.4.2 Either party, at its sole discretion, may include by joinder persons or entities substantially involved in a common question of law or fact whose presence is required if complete relief is to be accorded in arbitration, provided that the party sought to be joined consents in writing to such joinder. Consent to arbitration involving an additional person or entity shall not constitute consent to arbitration of any claim, dispute or other matter in question not described in the written consent. § 14.4.4.3 The Owner and Design-Builder grant to any person or entity made a party to an arbitration conducted under this Section 14.4, whether by joinder or consolidation, the same rights of joinder and consolidation as the Owner and Design-Builder under this Agreement. ARTICLE 15 MISCELLANEOUS PROVISIONS ARTICLE 15 MISCELLANEOUS PROVISIONS § 15.1 Governing Law The Contract shall be governed by the law of the place where the Project is located except that, if the parties have selected arbitration as the method of binding dispute resolution, the Federal Arbitration Act shall govern Section 14.4. This Agreement and all of the rights and obligations of the parties hereto and all of the terms and conditions hereof shall be construed, interpreted and applied in accordance with and governed by and enforced under the laws of the State of Texas. The exclusive venue for contract disputes and all other matters related to this Agreement shall be in a state district court having jurisdiction in Denton County, Texas. § 15.2 Successors and Assigns § 15.2.1 The Owner and Design-Builder, respectively, bind themselves, their partners, successors, assigns and legal representatives to the covenants, agreements and obligations contained in the Design-Build Documents. Except as provided in Section 15.2.2, neither party to the Contract shall assign the Contract as a whole without Contract, or any rights under the contract, in whole or in part without the written consent of the other. If either party attempts to make such an assignment without such consent, that party shall nevertheless remain legally responsible for all obligations under the Contract. § 15.2.2 The Owner may, without consent of the Design-Builder, assign the Contract to a lender providing construction financing for the Project, if the lender assumes the Owner’s rights and obligations under the Design-Build Documents. The Design-Builder shall execute all consents reasonably required to facilitate such assignment. § 15.2.3 If the Owner requests the Design-Builder, Architect, Consultants, or Contractors Subcontractors to execute certificates, other than those required by Section 3.1.10, the Owner shall submit the proposed language of such certificates for review at least 14 fourteen (14) days prior to the requested dates of execution. If the Owner requests the Design-Builder, Architect, Consultants, or Contractors to execute consents reasonably required to facilitate assignment to a lender, the Design-Builder, Architect, Consultants, or Contractors shall execute all such consents that are consistent with this Agreement, provided the proposed consent is submitted to them for review at least 14 fourteen (14) days prior to execution. The Design-Builder, Architect, Consultants, and Contractors shall not be required to DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 53 execute certificates or consents that would require knowledge, services or responsibilities beyond the scope of their services. § 15.3 Written Notice Written notice shall be deemed to have been duly served if delivered in person to the individual, to a member of the firm or entity, or to an officer of the corporation for which it was intended; or if delivered at, or sent by registered or certified mail or by courier service providing proof of delivery to, the last business address known to the party giving notice. § 15.4 Rights and Remedies § 15.4.1 Duties and obligations imposed by the Design-Build Documents, and rights and remedies available thereunder, shall be in addition to and not a limitation of duties, obligations, rights and remedies otherwise imposed or available by law. § 15.4.2 No action or failure to act by the Owner or Design-Builder shall constitute a waiver of a right or duty afforded them under the Contract, nor shall such action or failure to act constitute approval of or acquiescence in a breach thereunder, except as may be specifically agreed in writing. § 15.5 Tests and Inspections § 15.5 Tests and Inspections, and Quality Management § 15.5.1 Tests, inspections and approvals of portions of the Work shall be made as required by the Design-Build Documents and by applicable laws, statutes, ordinances, codes, rules and regulations or lawful orders of public authorities. Unless otherwise provided, the Design-Builder shall make arrangements for such tests, inspections and approvals with an independent testing laboratory or entity acceptable to the Owner, or with the appropriate public authority, and shall bear all related costs of tests, inspections and approvals. The Design-Builder shall give the Owner timely notice of when and where tests and inspections are to be made so that the Owner may be present for such procedures. The Owner shall bear costs of (1) tests, inspections or approvals that do not become requirements until after bids are received or negotiations concluded, and (2) tests, inspections or approvals where building codes or applicable laws or regulations prohibit the Owner from delegating their cost to the Design-Builder. As required by the provisions of Texas Government Code, Section 2269.058(a), the Owner shall provide or contract for the construction materials engineering, testing, and inspection services and the verification testing services necessary for acceptance of the facility by the Owner. To the extent that any of the provisions of this Section 15.5 or other provisions of this Agreement conflict with any of the provisions of Section 2269.058(a) such conflict is unintentional, and the provisions of the Texas Government Code shall control. § 15.5.2 If the Owner determines that portions of the Work require additional testing, inspection or approval not included under Section 15.5.1, the Owner will instruct the Design-Builder to make arrangements for such additional testing, inspection or approval by an entity acceptable to the Owner, and the Design-Builder shall give timely notice to the Owner of when and where tests and inspections are to be made so that the Owner may be present for such procedures. Such costs, except as provided in Section 15.5.3, shall be at the Owner’s expense. § 15.5.3 If such procedures for testing, inspection or approval under Sections 15.5.1 and 15.5.2 reveal failure of the portions of the Work to comply with requirements established by the Design-Build Documents, all costs made necessary by such failure including those of repeated procedures and compensation for the Architect’s services and expenses and all costs specified in Section 11.2 shall be at the Design-Builder’s expense. The Design-Builder also agrees the cost of testing, inspection, and approval services required for the convenience of the Design-Builder in scheduling and performance of the Work, and the cost of such similar services related to remedial operations performed to correct deficiencies in the Work shall be borne by the Design-Builder. § 15.5.4 Required certificates of testing, inspection or approval shall, unless otherwise required by the Design-Build Documents, be secured by the Design-Builder and promptly delivered to the Owner. § 15.5.5 If the Owner is to observe tests, inspections or approvals required by the Design-Build Documents, the Owner will do so promptly and, where practicable, at the normal place of testing. § 15.5.6 Tests or inspections conducted pursuant to the Design-Build Documents shall be made promptly to avoid unreasonable delay in the Work. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 54 § 15.5.7 It is the intent of the Design-Build Documents to require the Design-Builder to control the quality of the Work using the processes specified in the Design-Builder’s Quality Management, Commissioning and Turnover Plan contained within the most recent Construction Management Plan approved by the Owner. Tests or inspections conducted pursuant to the Design-Build Documents shall be made promptly to avoid unreasonable delay in the Work., and shall conform to the most recently approved Design-Builder’s Construction Schedule. § 15.5.8 The responsibility for implementing the Quality Management, Commissioning and Turnover Plan is the Design-Builder’s, as is the obligation to provide the Work and a complete and functional project per the Design-Build Documents. Notwithstanding anything herein, or in subsequently approved Quality Management, Commissioning and Turnover Plans, the Owner’s approval of such plan(s) does not relieve the Design-Builder in any way of this responsibility. § 15.5.9 The Design-Builder shall be in charge of testing and inspections of the Work, including but not limited to, the services of a certified testing laboratory which shall be contracted to and paid for by the Owner and which will perform the tests as called for in the Design-Build Documents. The conditions that apply to materials testing and inspections include, but are not limited to the following: .1 The frequency and type of Quality Control testing shall be established by the Design-Builder, and shall be sufficient to insure the delivery of the Work and a complete and functional project per the Design-Build Documents. The type and amount of testing required by the Design-Build Documents shall be seen as the minimum required, and shall be increased, if in the opinion of the Design-Builder, more testing is needed to meet the above requirements of the Design-Builder. .2 The Design-Builder shall concurrently provide the Owner copies of all test results it receives within three (3) business days of receipt of same. .3 The Owner shall provide such Quality Assurance testing as it deems adequate for its own needs. The Owner shall distribute the results of its own Quality Assurance tests as it, at its sole discretion, deems appropriate. The provision of Quality Assurance testing by the Owner, or lack thereof shall in no manner affect the responsibilities of the Design-Builder under this Agreement. § 15.5.10 The Design-Builder shall facilitate and conduct weekly (or more frequent if necessary) meetings on site for the coordination of all mechanical, electrical and special systems installation activities and possible interference(s) above ceilings, in mechanical rooms, etc. The mechanical trades shall typically have preference in the event of conflicts, and therefore the mechanical contractor’s coordinator will usually lead each meeting, unless the Design-Builder decides another trade or the Design-Builder should take the lead. The Owner shall be informed of the meetings at least seven (7) days in advance, and the appropriate Owner’s consultants should be invited to attend by the Design-Builder, as supplemented and coordinated by the Owner. § 15.5.11 The Design-Builder’s Quality Management, Commissioning and Turnover Plan shall specify that prior to completion and acceptance of any building system or phase, consistent with the Contract and applicable codes, Design-Builder will review, in detail, the steps for completing testing of all building systems with the Owner. This plan shall be coordinated with and shall be made part of the Design-Builder’s Construction Schedule. All testing shall be of each complete system, before covering, or of individually separable larger portions of each system and shall be performed in the presence of the appropriate Owner’s consultant(s), representatives of the Owner, and at its option. § 15.5.12 When heating, air conditioning, ventilating, exhaust, or other items of mechanical, electrical or other similar equipment are installed, or other systems or equipment requiring testing as may be specified in the Design-Builder’s Quality Management, Commissioning and Turnover Plan, it shall be the responsibility of the Design-Builder, Subcontractor or Sub-subcontractor installing such equipment to operate it for a period of time satisfactory to the Owner prior to acceptance and before the start of Warranty. The duration of such operation shall be as the Owner, Owner’s consultant(s), Owner’ employees and other Owner’s representatives (the Turnover Team) shall reasonably require for proper testing of the respective system and thorough instruction of the Owner’s operating personnel. § 15.5.13 All equipment, testing instruments, instruction materials and incidentals required for proper testing of such systems and thorough instruction of the Owner’s operating personnel on each system’s operations and maintenance DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 55 shall be provided by the Design-Builder, Subcontractor or Sub-subcontractor responsible for providing and installing the equipment. Such tests and instruction shall be in meetings held solely for this purpose (the Turnover Meetings), which shall be coordinated and managed by the Design-Builder, who shall show their dates in the Design-Builder’s Construction Schedule at least sixty (60) days prior to occurrence. The Design-Builder shall schedule the Turnover Meetings at times reasonably convenient for the Owner’s consultant(s), Owner’s employees and other Owner’s representatives that the Owner agrees are necessary to attend for each system. The Owner may attend such Turnover Meetings at its discretion. § 15.5.14 The Design-Builder shall provide a digital video record to the Owner, with copies to the Owner of all meetings for the purpose of Owner operational staff instruction or training; as well as commissioning of equipment. These videos will become a permanent part of all Operations and Maintenance manuals as applicable. § 15.5.15 The Design-Builder shall prepare a digital video record of the project for the Owner at such stages as shall be indicated by the Owner for the purpose of documenting the location of piping, conduit, equipment, or other construction to be concealed at a later date; recording key inspections and tests; providing evidence of unforeseeable conditions encountered by the Design-Builder on site; and other construction issues as the Owner may reasonably require from time to time. § 15.5.16 The Design-Builder shall layout and mark any plantings, shrubs and trees which will require removal a minimum of five (5) business days prior to their removal. The Design-Builder shall notify the Owner in writing immediately upon completion of this marking, and the Owner will have the location of these marked plantings, shrubs and trees reviewed and approved (if correct) by the Owner. The Owner will then give permission for removal in writing to the Design-Builder. Plantings, shrubs, and trees shall not be removed or damaged without such permission. § 15.6 Confidential Information If the Owner or Design-Builder transmits Confidential Information, the transmission of such Confidential Information constitutes a warranty to the party receiving such Confidential Information that the transmitting party is authorized to transmit the Confidential Information. If a party receives Confidential Information, the receiving party shall keep the Confidential Information strictly confidential and shall not disclose it to any other person or entity except as set forth in Section 15.6.1. § 15.6.1 A party receiving Confidential Information may disclose the Confidential Information as required by law or court order, including a subpoena or other form of compulsory legal process issued by a court or governmental entity. A party receiving Confidential Information may also disclose the Confidential Information to its employees, consultants or contractors in order to perform services or work solely and exclusively for the Project, provided those employees, consultants and contractors are subject to the restrictions on the disclosure and use of Confidential Information as set forth in this Contract. § 15.6.2 See Exhibit "J" – Confidentiality of the Project for more direction on confidentiality. § 15.7 Capitalization Terms capitalized in the Contract include those that are (1) specifically defined, (2) the titles of numbered articles or (3) the titles of other documents published by the American Institute of Architects. § 15.8 Interpretation § 15.8.1 In the interest of brevity the Design-Build Documents frequently omit modifying words such as "all" and "any" and articles such as "the" and "an," but the fact that a modifier or an article is absent from one statement and appears in another is not intended to affect the interpretation of either statement. § 15.8.2 Unless otherwise stated in the Design-Build Documents, words which have well-known technical or construction industry meanings are used in the Design-Build Documents in accordance with such recognized meanings. § 15.9 Release of Retainage at Substantial Completion Notwithstanding any other provision in the Design-Build Documents to the contrary, upon Substantial Completion of the Work the Owner shall be entitled to retain from the Contract Sum due to the Design-Builder an amount equal to the DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 56 greater of: (a) the product obtained by multiplying eight (8) times the total cost of completion of the Punch List items as estimated by the Owner; or (b) twenty-five thousand dollars ($25,000). § 15.10 Measurement Before ordering any material or doing any Work, the Design-Builder shall verify all measurements for Work completed at the Project and shall be responsible for their accuracy. Any differences found shall be submitted to the Owner for consideration before proceeding with the Work. The Design-Builder shall use its utmost efforts to identify discrepancies in dimensions in a timely fashion and notify the Owner of these prior to commencing any Work affected by the ambiguous dimensions. No extra charge or compensation shall be allowed because of differences between actual measurements and the dimensions indicated on the drawings. § 15.11 Expediting Materials The Design-Builder shall immediately, after receipt of Notice to Proceed and approval of the list of subcontractors and material suppliers, place orders for all equipment, materials, and supplies required for the Work, and shall submit to the Owner evidence that such orders have been placed in accordance with the Design-Builder’s Construction Schedule. § 15.12 Addressing the Owner’s Additional Needs and Concerns § 15.12.1 Notwithstanding the above, the Owner has a unique set of stakeholders and organizational structure that creates special challenges the Design-Builder must completely and successfully address to the satisfaction of the Owner in the performance of the Work under this Agreement. The actions that shall be taken to address these special challenges include, but are not limited to, the following: .1 The Design-Builder shall provide the superintendent once per month for a scheduled meeting with the Owner for a progress update on the project if requested by the Owner. A walk-through of the site may be held as a part of this meeting, which shall be scheduled for 4pm or shortly thereafter on a standard business day. .2 The Design-Builder may be required to provide the superintendent for one meeting per month with the Owner in preparing a newsletter for distribution to the Project stakeholders. The actual preparation and distribution of the newsletter shall be performed by the Owner. .3 In addition to the meetings required to complete the Project, it is anticipated the Owner may request tours from time to time of the project and the site. The Design-Builder shall indicate in writing when such activity will be permitted and when the site is off limits. These requirements shall be coordinated through the Owner. § 15.13 Additional Provisions § 15.13.1 In the event that any provision herein is held to be unlawful or against public policy, or a violation of the Charter of Ordinances of Denton, Texas, such provision shall be modified to make it valid, or if modification is not possible, such provision shall be deleted and the remainder of this Agreement shall remain in full force and effect. § 15.13.2 Each party hereto agrees to, without limitation, perform all acts; provide all services, material, equipment, labor and supervision; and to make, execute, and deliver such written instruments, as shall from time to time be reasonably required to carry out the terms and provisions of the Design-Build Documents. § 15.13.3 All exhibits referred to in the Design-Build Documents are, by reference, incorporated herein for all purposes. § 15.13.4 The captions of the paragraphs are set forth only for convenience and reference, and are not intended in any way to define, limit, or describe the scope or intent of the Design-Build Documents. § 15.13.5 Any specific requirement in this Agreement that require responsibilities or obligations of the Design-Builder also apply to a Subcontractor is added for emphasis and is also hereby deemed to include a Subcontractor, Sub-subcontractor or supplier of any tier. The omission of a reference to a Subcontractor in connection with any of the Design-Builder’s responsibilities or obligations shall not be construed to diminish, abrogate, or limit any DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 57 responsibilities or obligations of a Subcontractor, Sub-subcontractor or supplier of any tier under the Design-Build Documents or the applicable subcontract. § 15.13.6 The provisions of the Design-Build Documents shall not be changed, amended, waived, or otherwise modified in any respect except by a written document signed by Owner. No person is authorized on behalf of Owner to orally change, amend, waive, or otherwise modify the terms of the Design-Build Documents or any of the Design-Builder’s duties or obligations under or arising out of the Design-Build Documents. Any change, waiver, approval, or consent granted to the Design-Builder shall be limited to the specific material restated in the written document signed by Owner, and shall not relieve Design-Builder of any other of the duties and obligations under the Design-Build Documents. No "constructive" changes under any Agreement with the Owner shall be allowed. § 15.13.7 The Design-Builder shall provide and file, as required by law, all notices required or permitted by the laws of the state in which the Project is located for protection of Owner from liens and claims of lien if permitted or required by applicable law. Design-Builder shall be responsible for filing in the appropriate court or other governmental office records all such notices as required or permitted by the laws of the state in which the Project is located. § 15.13.8.1 The Design-Builder shall provide Owner with copies of all notices received by Design-Builder from Subcontractors, Sub-subcontractors, and/or suppliers to Design-Builder. § 15.13.8.2 Notices. All legal notices, consents, approvals, demands, requests or other communications provided for or permitted to be given under any of the provisions of this Agreement shall be in writing and shall be deemed to have been duly given or served when delivered by hand delivery or when deposited in the U.S. mail by registered or certified mail, return receipt requested, postage prepaid, and addressed as follows: If to Owner: Todd Hileman City of Denton 215 East McKinney Street Denton, TX 76201 With a copy to Owner’s staff point of contact: Larry Chan City of Denton 869 South Woodrow LnDenton, TX 76201 Larry.Chan@cityofdenton.com (940)-349-7755 And with a copy to City Attorney’s point of contact: Larry Collister City of Denton 215 East McKinney St. Denton, TX 76201 And with a copy to Owner’s Independent Representative: Debbie Fulwiler Elements of Architecture 1201 6th Ave, Suite 100 Fort Worth, TX 76104 dfulwiler@elementsofarc.com (817)-333-2880 Main If to Design-Builder: Martin Lehman DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 58 Thos. S Byrne, Inc 551 East Berry St. Fort Worth, TX 76104 mlehman@tsbyrne.com (817)-335-3394 Main §15.13.9 Owner affirmatively represents that its governing body has duly appropriated such sums which are equal to or in excess of the contract amount, and that such contract amount may be lawfully paid by Owner to Design-Builder subject to the terms and conditions of the Design-Build Documents. In the event that Owner approves a Change Order, Construction Change Directive or other additional compensable Work to be performed by Design-Builder, (other than that contemplated by the Design-Build Documents under any remedy-granting provision), Owner will issue a written assurance at the time of such approval that such additional compensation to be paid has also been duly appropriated by the Owner’s governing body. §15.13.10 Design-Builder shall comply with the requirements in Texas Government Code Sec. 2252.032. § 15.13.11 In the event the Owner is required to further advertise the completion of the Work or the Project under any local, state or Federal law, the Design-Builder shall notify the Owner of such requirement(s) in writing not less than thirty (30) days in advance, and attach a copy of the specific advertising and noticing required. §15.13.12 The Design-Builder shall, in addition to compliance with the requirements of Section 5.5.5 and Section 5.5.6 and without limitation, not knowingly employ or contract with an illegal alien to perform any of the Work under this Agreement. The Design-Builder shall not knowingly contract with a Subcontractor that (i) knowingly employs or contracts with an illegal alien to perform work under this Agreement or (ii) fails to certify to the Design-Builder that the Subcontractor will not knowingly employ or contract with an illegal alien to perform work under this Agreement. §15.13.12.1 The Design-Builder has verified or attempted to verify through participation in the basic pilot program of the State of Texas ("Basic Pilot Program") that the Design-Builder does not employ any illegal aliens or the Design-Builder verifies that the Design-Builder has not been accepted into the Basic Pilot Program prior to entering into this Agreement. The Design-Builder further verifies that if the Design-Builder has not been accepted into the Basic Pilot Program, the Design-Builder will apply to participate in the Basic Pilot Program every three months until the Design-Builder is accepted or this Agreement is completed, whichever is earlier. If the Basic Pilot Program is discontinued, this Section 15.13.12.1 shall not be required or be effective. §15.13.12.2 The Design-Builder shall not use Basic Pilot Program procedures to undertake pre-employment screening of job applicants while performing under this Agreement. §15.13.12.3 The Design-Builder shall comply with any reasonable request of the Texas Workforce Commission made in the course of an investigation pursuant to state law. §15.13.12.4 In addition to any other legal or equitable remedy, and notwithstanding anything to the contrary in the Design-Build Document the Owner may be entitled to for a breach of the Agreement, if the Owner terminates this Agreement, in whole or in part, due to Design-Builder’s breach of the obligations set forth above in this Section 15.13.12 Design-Builder shall be liable for actual and consequential damages to the Owner. § 15.13.13 It is the express intention of the parties that this Agreement is not to be construed as a waiver of any immunities or defenses of the Owner under Texas law. § 15.13.14 This Agreement is and shall be subject to those provisions required of political subdivisions by the laws of the State of Texas. The Design-Builder understands that the Owner is a Texas home rule municipality and that the project is subject to applicable provisions of Texas law including bid requirements, bonding, and final settlement provisions. § 15.13.15 Design-Builder understands that certain information, including this Agreement, are public records available for public inspection and copying under the Texas Open Records Act., Texas Government Code Ch. 552, as amended, and other applicable laws. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 59 § 15.13.16 Design-Builder certifies and warrants that no gratuities, kickbacks or contingency fees were paid in connection with this Agreement, nor were any fees, commissions, gifts or other considerations made contingent upon the award of this Agreement. Design-Builder warrants that to the best of Design-Builder’s knowledge, there exists no actual or potential conflict of interest, and no financial or substantial interest as may be prohibited by Texas law, the Charter, or Code of Ethics of the City of Denton between Design-Builder and Owner. In recognition of this requirement, the Design-Builder has attested to this fact in Exhibit R – Ethics Affidavit. § 15.13.17 Design-Builder shall comply with the disclosure and reporting requirements in Local Government Code Chapters 171 and 176, and Texas Government Code Sec. 2252.908. Under Sec. 2252.908, if City Council approval is required to award this Agreement or if this Agreement has a value of at least $1,000,000, the City may not enter into the Agreement unless the Design-Builder submits a disclosure of interested parties to the City at the time the executed Agreement is presented to the City. The disclosure must be made on the form prescribed by the Texas Ethics Commission and the City is required to submit a copy of the disclosure statement to the Texas Ethics Commission not later than the thirtieth (30th) day after the disclosure is received by the City. § 15.13.18 The Owner is a Texas home-rule municipality and as such is generally exempt from taxation under Texas law, which may include the purchase of items, materials, or supplies purchased on behalf of the Owner for this public works project. Design-Builder shall confirm that the Owner is exempt before paying taxes for items, materials, or supplies that may not be lawfully charged to the Owner. § 15.13.19 Some or all of the Owner’s duties, approvals and actions required under this Agreement may be provided by third parties by mutual agreement of the Owner and such third parties. When notified in writing of the specific duties and responsibilities of such third party, the Design-Builder will recognize the actions and approvals of the third party as sufficient to fulfill the Owner’s responsibilities under this Agreement. § 15.13.20 The Design-Builder shall provide sufficient supporting documentation in form and with a level of detail wholly acceptable to the Owner and Design-Builder to substantiate any Application for Payment, request for Change to the Contract Sum or Contract Time, and all contract Allowances provided within the Design-Builder’s Contract Sum for this scope of work. Failure to timely provide all supporting documentation, in and of itself, may result in rejection of the Application for Payment or requested change to the Contract Sum or Contract Time, or payment for work charged to the Allowance(s). § 15.13.21 Proof of purchase and warehouse insurance naming the Owner and Design-Builder as additional insureds, together with inspection rights for the Owner and Design-Builder is to be provided for any billed materials by the Design-Builder for the work not physically stored at the Project site. § 15.13.22 Time limits set out in or under this Agreement are solely for the protection and benefit of the Owner and create no third-party beneficiary rights in any other party. § 15.13.23 The parties agree that they will execute any further instrument or instruments, and that they will perform any act or acts, which are or may become necessary to effectuate any of the terms or provisions of this Agreement. § 15.13.24 Nothing contained in this Agreement shall create a contractual relationship with a cause of action in favor of a third party against either the Owner or Design-Builder. § 15.13.25 This Agreement has been created jointly and ambiguity cannot be construed against either party. § 15.13.26 Notwithstanding anything to the contrary in the Design-Build Documents, the Contract and all of its terms and conditions are subject to approval or modification by the Owner’s lender or financial institution (the "Lender"), if any. The Design-Builder acknowledges that the Owner is financing the Work with a Lender, or by bonds, notes, certificates of obligation, and other obligations authorized to be issued by the Owner and will use its best efforts to comply with the requirements of such Lender, including, without limitation, making the site of the Work available at reasonable times for inspection by such Lender; curing defaults existing under the Design-Build Documents; and executing a consent to assignment of the Design-Build Documents in the form required by such Lender and any other documents such Lender may reasonably request. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 60 § 15.13.27 If required by the Owner or the Lender, if any, all payments to the Design-Builder shall be made through a construction escrow (hereinafter referred to as the "Escrow") established with the escrow trustee or such other entity as may be identified in Exhibit "S" – Escrow and Financing Conditions, (hereinafter referred to as the "Escrowee") mutually acceptable to the Owner, the Lender and the Design-Builder. The Lender, if any, may also impose other reasonable conditions consistent with the standards of the industry for construction financing. The Design-Builder hereby agrees to execute an escrow agreement that shall be consistent with the requirements of the Design-Build Documents, except as the standard procedures of the Escrowee may otherwise require; structured to provide that the Escrowee may disburse funds directly to Subcontractors or to the Design-Builder and Subcontractors payable jointly, if so directed by the Owner; and otherwise reasonably satisfactory to the Owner, the Architect, and the Design-Builder (the "the Escrow and Financing Conditions"). All parties thereto shall use their best efforts to cooperate with the Escrowee. After full execution, the Escrow and Financing Conditions shall be attached hereto and made part hereof as Exhibit "S" – Escrow and Financing Conditions. § 15.13.28 Financial obligations of the Owners payable after the current fiscal year are contingent upon funds for that purpose being appropriated, budgeted, and otherwise made available. § 15.13.29 No term or condition of the Agreement shall be construed or interpreted as a waiver, express or implied, of any of the governmental or soverign immunities, rights, benefits, or protections of the Owner. § 15.13.30 Design-Builder warrants that the products, processes, techniques and methodologies provided by Design-Builder shall not infringe upon the copyright, patent or other proprietary rights of others. § 15.13.31 In case any provision hereof shall, for any reason, be held invalid or unenforceable in any respect, such invalidity or unenforceability shall not affect any other provision hereof, and this Contract shall be construed as if such invalid or unenforceable provision had not been included herein. § 15.13.32 Design-Builder understands and agrees that time is of the essence. § 15.13.33 This Agreement may be executed by the parties hereto in separate counterparts, each of which when so executed and delivered shall be an original, but all such counterparts shall together constitute one and the same instrument. Each counterpart may consist of any number of copies hereof each signed by less than all, but together signed by all of the parties hereto. § 15.13.34 Design-Builder makes the following representations and warranties to Owner, each of which is true and correct as of the Effective Date of this Agreement: .1 Design-Builder is a corporation duly organized, existing and in good standing under the laws of the State of Texas; Design-Builder possesses all requisite power and authority to enter into and perform this Agreement and to carry out the transactions contemplated herein; and Design-Builder has all legal power and authority to own and use its properties and to transact the business in which it is engaged and holds or expects to obtain in a timely manner all material franchises, licenses and permits required hereunder; .2 Design-Builder’s execution, delivery and performance of this Agreement have been duly authorized by, and are in accordance with, its limited partnership agreement; this Agreement has been duly executed and delivered for it by the signatories so authorized; and this Agreement constitutes Design-Builder’s legal, valid and binding obligation; .3 Design-Builder is not currently in breach of, in default under, or in violation of, and the execution and delivery of this Agreement and the performance of its obligations hereunder will not constitute or result in any breach of, default under or violation of, any Governmental Rule, or the provisions of Design-Builder’s limited partnership agreement, or any franchise or license, or any provision of any indenture or any evidence of indebtedness or security therefor, lease, contract, license or other agreement by which it is bound, except for such breaches, defaults or violations as will not, either individually or in the aggregate, result in a material adverse effect on the ability of Design-Builder to perform its obligations hereunder; DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 61 .4 No suit, claim, action, arbitration, or legal, administrative or other proceeding is pending or, to the best knowledge of Design-Builder, threatened against Design-Builder that could affect the validity or enforceability of this Agreement, the ability of Design-Builder to fulfill its commitments hereunder in any material respect, or that would result in any material adverse change in the business or financial condition of Design-Builder; .5 Design-Builder certifies that it (i) is a duly qualified, capable and otherwise bondable business entity, (ii) is not in receivership and does not contemplate same, (iii) has not filed for bankruptcy, and is not currently delinquent with respect to payment of property taxes to the City of Denton or within Denton County, and (iv) is duly licensed and/or registered in the State of Texas, to the extent required by the laws of the State of Texas, to perform the design-build services described or referenced in this Agreement. § 15.13.35 Any of the representations, warranties, covenants, and obligations of the Parties, as well as any rights and benefits of the Parties, pertaining to a period of time following the termination of this Agreement shall survive termination. ARTICLE 16 SCOPE OF THE AGREEMENT § 16.1 This Agreement is comprised of the following documents listed below: .1 AIA Document A141™–2014, Standard Form of Agreement Between Owner and Design-Builder .2 AIA Document A141™–2014, Exhibit A, Design-Build Amendment, if executed .3 AIA Document A141™–2014, Exhibit B, Insurance and Bonds .4 AIA Document A141™–2014, Exhibit C, Sustainable Projects, if completed .5 AIA Document E203™–2013, Building Information Modeling and Digital Data Exhibit, if completed, Exhibit C, Project Management Process, or the following: N/A .6 Other: Exhibit "D" – Design Criteria Exhibit "E" – Control Estimate # 01 Exhibit "F.1" – Scheduling Requirements This Agreement entered into as of the day and year first written above.Exhibit "F.2" – Design-Builder’s Project Schedule Exhibit "G" – Key Firms and Personnel Exhibit "H" – Design-Builder’s Fee & Cost Proposal Exhibit "I" – Billing Rates Exhibit "J" – Confidentiality of the Project Exhibit "K" – Rental Rates Exhibit "L" – Alternates with Costs and Expiration Dates Exhibit "M" – Unit Costs Exhibit "N" – Allowances Exhibit "O" – Schedule of Values Exhibit "P" – Disputed Work Schedule Exhibit "Q" – Equal Opportunity Employment Exhibit "R" – Ethics Affidavit Exhibit "S" – Escrow and Financing Conditions Exhibit "Z" – Schedule of Exhibits § 16.2 Entire Agreement This Agreement represents the entire and integrated Agreement between Owner and Design-Builder and supersedes all prior negotiations, representations, or agreements, either oral or written. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 62 OWNER (Signature)DESIGN-BUILDER (Signature) (Printed name and title)(Printed name and title) DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Init. / AIA Document A141™ – 2014. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 63 THIS AGREEMENT HAS BEEN BOTH REVIEWED AND APPROVED as to financial and operational obligations and business terms. _______________ ________________ SIGNATURE PRINTED NAME __________________________________ TITLE __________________________________ DEPARTMENT ATTEST: ROSA RIOS, CITY SECRETARY By;_______________________________ APPROVED AS TO LEGAL FORM: AARON LEAL, CITY ATTORNEY By;_______________________________ DESIGN-BUILDER BY: _______________________________ AUTHORIZED SIGNATURE Date: _______________________________ Printed Name: ________________________ Title: _______________________________ _______________________________ PHONE NUMBER _______________________________ EMAIL ADDRESS _______________________________ TEXAS ETHICS COMMISSION CERTIFICATE NUMBER CITY OF DENTON, TEXAS A Texas Municipal Corporation By: _________________________ TODD HILEMAN CITY MANAGER DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E #$!% !%$&#!" #%! ! $$$%!%%&!# #!$& #!$& AIA Document D401™ – 2003. Copyright © 1992 and 2003 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This document was produced by AIA software at 00:31:03 ET on 02/28/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1920217711) 1 Certification of Document’s Authenticity AIA® Document D401™ – 2003 I, Chris Squadra, hereby certify, to the best of my knowledge, information and belief, that I created the attached final document simultaneously with this certification at 00:31:03 ET on 02/28/2020 under Order No. 6456438273 from AIA Contract Documents software and that in preparing the attached final document I made no changes to the original text of AIA® Document A141™ – 2014, Standard Form of Agreement Between Owner and Design-Builder , as published by the AIA in its software, other than changes shown in the attached final document by underscoring added text and striking over deleted text. _____________________________________________________________ (Signed) _____________________________________________________________ (Title) _____________________________________________________________ (Dated) 27-FEB-2020 gg ________________________________________________________________________________ igne(Signed) Chris Squadra, Principal DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Document A141TM – 2014 Exhibit A Design-Build Amendment AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 1 This document has important legal consequences. Consultation with an attorney is encouraged with respect to its completion or modification. Consultation with an attorney is also encouraged with respect to professional licensing requirements in the jurisdiction where the Project is located. ELECTRONIC COPYING of any portion of this AIA® Document to another electronic file is prohibited and constitutes a violation of copyright laws as set forth in the footer of this document. This Amendment is incorporated into the accompanying AIA Document A141™–2014, Standard Form of Agreement Between Owner and Design-Builder dated the Twenty Fifth day of February in the year Two Thousand Twenty (the "Agreement") (In words, indicate day, month and year.) for the following PROJECT: (Name and location or address) City of Denton’s Development Services Building 401 North Elm Street Denton, TX 76201 THE OWNER: (Name, legal status and address) City of Denton 215 East McKinney Street Denton, TX 76201 THE DESIGN-BUILDER: (Name, legal status and address) Thos. S. Byrne, Inc. 551 East Berry Street Fort Worth, TX 76104 The Owner and Design-Builder hereby amend the Agreement as follows. TABLE OF ARTICLES A.1 CONTRACT SUM A.2 CONTRACT TIME A.3 INFORMATION UPON WHICH AMENDMENT IS BASED A.4 DESIGN-BUILDER’S PERSONNEL, CONTRACTORS AND SUPPLIERS A.5 COST OF THE WORK ARTICLE A.1 CONTRACT SUM § A.1.1 The Owner shall pay the Design-Builder the Contract Sum in current funds for the Design-Builder’s performance of the Contract after the execution of this Amendment. The Contract Sum shall be one of the following and shall not include compensation the Owner paid the Design-Builder for Work performed prior to execution of this Amendment: (Check the appropriate box.) [ ] Stipulated Sum, in accordance with Section A.1.2 below [ ] Cost of the Work plus the Design-Builder’s Fee, in accordance with Section A.1.3 below DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 2 [ ] Cost of the Work plus the Design-Builder’s Fee with a Guaranteed Maximum Price, in accordance with Section A.1.4 below (Based on the selection above, complete Section A.1.2, A.1.3 or A.1.4 below.) § A.1.2 Stipulated Sum § A.1.2.1 The Stipulated Sum shall be ($ ), subject to authorized adjustments as provided in the Design-Build Documents. § A.1.2.2 The Stipulated Sum is based upon the following alternates, if any, which are described in the Design-Build Documents and are hereby accepted by the Owner: (State the numbers or other identification of accepted alternates. If the Owner is permitted to accept other alternates subsequent to the execution of this Amendment, attach a schedule of such other alternates showing the change in Stipulated Sum for each and the deadline by which the alternate must be accepted.) See Exhibit "A.1" – Guaranteed Maximum Price § A.1.2.3 Unit prices, if any: (Identify item, state the unit price, and state any applicable quantity limitations.) Item Units and Limitations Price per Unit ($0.00) Exhibit "A.2" – Unit Costs § A.1.3 Cost of the Work Plus Design-Builder’s Fee § A.1.3.1 The Cost of the Work is as defined in Article A.5, Cost of the Work. § A.1.3.2 The Design-Builder’s Fee: (State a lump sum, percentage of Cost of the Work or other provision for determining the Design-Builder’s Fee, and the method for adjustment to the Fee for changes in the Work.) § A.1.3 Not Used § A.1.4 Cost of the Work Plus Design-Builder’s Fee With a Guaranteed Maximum Price § A.1.4.1 The Cost of the Work is as defined in Article A.5, Cost of the Work. § A.1.4.2 The Design-Builder’s Fee: (State a lump sum, percentage of Cost of the Work or other provision for determining the Design-Builder’s Fee and the method for adjustment to the Fee for changes in the Work.) The Design-Builder shall receive a Preconstruction Fee of two hundred and six thousand, one hundred and fifty dollars ($206,150) As limited by the Guaranteed Maximum Price set forth in Section 5.2; and not including the Preconstruction Services Fee above, a total, basic fee (the "Design-Builder’s Fee") equal to six point four six percent (6.46%) of the Cost of Work shall be used in all of the Design-Builder’s estimates, until acceptance of the final update to the Guaranteed Maximum Price, when it will be converted to and fixed as a lump sum. This percentage is based on a Contract Sum of three million five hundred thousand dollars ($3,500,00). In the event the final Contract Sum is above or below this amount, the Design-Builder’s Fee shall be adjusted accordingly, as shown in Exhibit "H" – Design Builder’s Fee and Cost Proposal in the A141 Owner – Design-Builder Agreement. § A.1.4.2.1 For changes in the Work, the rate of the Design-Builder’s Fee shall be the same six point four six percent (6.46%) as above. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 3 § A.1.4.2.2 The Design-Builder’s Fee includes without limitation, all required off-site corporate management personnel; contract and trade contract negotiations; administration; accounting; information technology and related labor costs; off-site corporate office equipment, infrastructure and staff; and other corporate office requirements the Design-Builder may need for its operations or to complete the Work. Design-Builder shall not charge any of said costs as Costs of Work. § A.1.4.3 Guaranteed Maximum Price § A.1.4.3.1 The sum of the Cost of the Work and the Design-Builder’s Fee is guaranteed by the Design-Builder not to exceed ($ ), subject to additions and deductions for changes in the Work as provided in the Design-Build Documents. Costs that would cause the Guaranteed Maximum Price to be exceeded shall be paid by the Design-Builder without reimbursement by the Owner. (Insert specific provisions if the Design-Builder is to participate in any savings.) All savings beneath the Guaranteed Maximum Price shall revert to the Owner. § A.1.4.3.2 Itemized Statement of the Guaranteed Maximum Price Provided below is an itemized statement of the Guaranteed Maximum Price organized by trade categories, allowances, contingencies, alternates, the Design-Builder’s Fee, and other items that comprise the Guaranteed Maximum Price. (Provide information below or reference an attachment.) See Attachment A.1 – Guaranteed Maximum Price § A.1.4.3.3 The Guaranteed Maximum Price is based on the following alternates, if any, which are described in the Design-Build Documents and are hereby accepted by the Owner: (State the numbers or other identification of accepted alternates. If the Owner is permitted to accept other alternates subsequent to the execution of this Amendment, attach a schedule of such other alternates showing the change in the Cost of the Work and Guaranteed Maximum Price for each and the deadline by which the alternate must be accepted.) § A.1.4.3.4 Unit Prices, if any: are per Exhibit "A.2" – Unit Costs: Such unit prices shall be considered complete and include: .1 all materials, equipment, labor, delivery, installation, supervision, overhead, profit , and fee; and .2 any other costs or expenses in connection with, or incidental to the Construction Manager’s and Subcontractor’s onsite and offsite performance of that portion of the Work to which such unit prices apply: (Identify item, state the unit price, and state any applicable quantity limitations.) Item Units and Limitations Price per Unit ($0.00) See Exhibit "A.2" – Unit Costs § A.1.4.3.5 Assumptions, if any, on which the Guaranteed Maximum Price is based: § A.1.5 Payments § A.1.5.1 Progress Payments § A.1.5.1.1 Based upon Applications for Payment Payment, including all supporting documentation as hereinafter provided, submitted to the Owner by the Design-Builder, and upon review and approval by the Owner submitted to the Owner by the Design-Builder, the Owner shall make progress payments on account of the Contract Sum to the Design-Builder as provided below and elsewhere in the Design-Build Documents. § A.1.5.1.2 The period covered by each Application for Payment shall be one calendar month ending on the last day of the month, or as follows:month. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 4 N/A § A.1.5.1.3 Provided that an Application for Payment is received not later than the twenty-fifth (25th) day of the month, and said Application for Payment is approved, the Owner shall make payment of the certified amount to the Design-Builder not later than the day of the month. If an Application for Payment is received by the Owner after the application date fixed above, payment shall be made by the Owner not later than ( ) days after the Owner receives the Application for Payment.thirty (30) days after the approval. (Federal, state or local laws may require payment within a certain period of time.) § A.1.5.1.4 With each Application for Payment where the Contract Sum is based upon the Cost of the Work, or the Cost of the Work with a Guaranteed Maximum Price, the Design-Builder shall submit payrolls, petty cash accounts, receipted invoices or invoices with check vouchers attached, and any other evidence required by the Owner to demonstrate that cash disbursements already made by the Design-Builder on account of the Cost of the Work equal or exceed (1) progress payments already received by the Design-Builder, less (2) that portion of those payments attributable to the Design-Builder’s Fee; plus (3) payrolls for the period covered by the present Application for Payment. § A.1.5.1.5 With each Application for Payment where the Contract Sum is based upon a Stipulated Sum or Cost of the Work with a Guaranteed Maximum Price, the Design-Builder shall submit the most recent schedule of values in accordance with the Design-Build Documents. The schedule of values shall allocate the entire Contract Sum among the various portions of the Work. Compensation for design services, if any, shall be shown separately. Where the Contract Sum is based on the Cost of the Work with a Guaranteed Maximum Price, the Design-Builder’s Fee shall be shown separately. The schedule of values shall be prepared in such form and supported by such data to substantiate its accuracy as the Owner may require. This schedule of values, unless objected to by the Owner, shall be used as a basis for reviewing the Design-Builder’s Applications for Payment. § A.1.5.1.6 In taking action on the Design-Builder’s Applications for Payment, the Owner shall be entitled to rely on the accuracy and completeness of the information furnished by the Design-Builder and shall not be deemed to have made a detailed examination, audit or arithmetic verification of the documentation submitted in accordance with Sections A.1.5.1.4 or A.1.5.1.5, or other supporting data; to have made exhaustive or continuous on-site inspections; or to have made examinations to ascertain how or for what purposes the Design-Builder has used amounts previously paid. Such examinations, audits and verifications, if required by the Owner, will be performed by the Owner’s auditors acting in the sole interest of the Owner. § A.1.5.1.7 Except with the Owner’s prior approval, the Design-Builder shall not make advance payments to suppliers for materials or equipment which have not been delivered and stored at the site. § A.1.5.2 Progress Payments—Stipulated Sum § A.1.5.2.1 Applications for Payment where the Contract Sum is based upon a Stipulated Sum shall indicate the percentage of completion of each portion of the Work as of the end of the period covered by the Application for Payment. § A.1.5.2.2 Subject to other provisions of the Design-Build Documents, the amount of each progress payment shall be computed as follows: .1 Take that portion of the Contract Sum properly allocable to completed Work as determined by multiplying the percentage completion of each portion of the Work by the share of the Contract Sum allocated to that portion of the Work in the schedule of values, less retainage of five percent ( 5.0 %) on the Work. Pending final determination of cost to the Owner of Changes in the Work, amounts not in dispute shall be included as provided in Section 6.3.9 of the Agreement; .2 Add that portion of the Contract Sum properly allocable to materials and equipment delivered and suitably stored at the site for subsequent incorporation in the completed construction (or, if approved in advance by the Owner, suitably stored off the site at a location agreed upon in writing), less retainage of five percent ( 5.0 %); .3 Subtract the aggregate of previous payments made by the Owner; and .4 Subtract amounts, if any, the Owner has withheld or nullified, as provided in Section 9.5 of the Agreement. § A.1.5.2.3 The progress payment amount determined in accordance with Section A.1.5.2.2 shall be further modified under the following circumstances: DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 5 .1 Add, upon Substantial Completion of the Work, a sum sufficient to increase the total payments to the full amount of the Contract Sum, less such amounts as the Owner shall determine for incomplete Work, retainage applicable to such work and unsettled claims; and (Section 9.8.6 of the Agreement discusses release of applicable retainage upon Substantial Completion of Work.) .2 Add, if final completion of the Work is thereafter materially delayed through no fault of the Design-Builder, any additional amounts payable in accordance with Section 9.10.3 of the Agreement. § A.1.5.2.4 Reduction or limitation of retainage, if any, shall be as follows: (If it is intended, prior to Substantial Completion of the entire Work, to reduce or limit the retainage resulting from the percentages inserted in Sections A.1.5.2.2.1 and A.1.5.2.2.2 above, and this is not explained elsewhere in the Design-Build Documents, insert provisions here for such reduction or limitation.) § A.1.5.3 Progress Payments—Cost of the Work Plus a Fee § A.1.5.3.1 Where the Contract Sum is based upon the Cost of the Work plus a fee without a Guaranteed Maximum Price, Applications for Payment shall show the Cost of the Work actually incurred by the Design-Builder through the end of the period covered by the Application for Payment and for which Design-Builder has made or intends to make actual payment prior to the next Application for Payment. § A.1.5.3.2 Subject to other provisions of the Design-Build Documents, the amount of each progress payment shall be computed as follows: .1 Take the Cost of the Work as described in Article A.5 of this Amendment; .2 Add the Design-Builder’s Fee, less retainage of percent ( %). The Design-Builder’s Fee shall be computed upon the Cost of the Work described in the preceding Section A.1.5.3.2.1 at the rate stated in Section A.1.3.2; or if the Design-Builder’s Fee is stated as a fixed sum in that Section, an amount which bears the same ratio to that fixed-sum Fee as the Cost of the Work in that Section bears to a reasonable estimate of the probable Cost of the Work upon its completion; .3 Subtract retainage of percent ( %) from that portion of the Work that the Design-Builder self-performs; .4 Subtract the aggregate of previous payments made by the Owner; .5 Subtract the shortfall, if any, indicated by the Design-Builder in the documentation required by Section A.1.5.1.4 or resulting from errors subsequently discovered by the Owner’s auditors in such documentation; and .6 Subtract amounts, if any, for which the Owner has withheld or withdrawn a Certificate of Payment as provided in the Section 9.5 of the Agreement. § A.1.5.3.3 The Owner and Design-Builder shall agree upon (1) a mutually acceptable procedure for review and approval of payments to the Architect, Consultants, and Contractors and (2) the percentage of retainage held on agreements with the Architect, Consultants, and Contractors, and the Design-Builder shall execute agreements in accordance with those terms. § A.1.5.4 Progress Payments—Cost of the Work Plus a Fee with a Guaranteed Maximum Price § A.1.5.4.1 Applications for Payment where the Contract Sum is based upon the Cost of the Work Plus a Fee with a Guaranteed Maximum Price shall show the percentage of completion of each portion of the Work as of the end of the period covered by the Application for Payment. The percentage of completion shall be the lesser of (1) the percentage of that portion of the Work which has actually been completed; or (2) the percentage obtained by dividing (a) the expense that has actually been incurred by the Design-Builder on account of that portion of the Work for which the Design-Builder has made or intends to make actual payment prior to the next Application for Payment by (b) the share of the Guaranteed Maximum Price allocated to that portion of the Work in the schedule of values. § A.1.5.4.2 Subject to other provisions of the Design-Build Documents, the amount of each progress payment shall be computed as follows: DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 6 .1 Take that portion of the Guaranteed Maximum Price properly allocable to completed Work as determined by multiplying the percentage of completion of each portion of the Work by the share of the Guaranteed Maximum Price allocated to that portion of the Work in the schedule of values. Pending final determination of cost to the Owner of changes in the Work, amounts not in dispute shall be included as provided in Section 6.3.9 of the Agreement. .2 Add that portion of the Guaranteed Maximum Price properly allocable to materials and equipment delivered and suitably stored at the site for subsequent incorporation in the Work, or if approved in advance by the Owner, suitably stored off the site at a location agreed upon in writing; .3 Add the Design-Builder’s Fee, less retainage of five percent ( 5.0 %). The Design-Builder’s Fee shall be computed upon the Cost of the Work at the rate stated in Section A.1.4.2 or, if the Design-Builder’s Fee is stated as a fixed sum in that Section, shall be an amount that bears the same ratio to that fixed-sum fee as the Cost of the Work bears to a reasonable estimate of the probable Cost of the Work upon its completion; .4 Subtract retainage of five percent ( 5.0 %) from that portion of the Work that the Design-Builder self-performs; .5 Subtract the aggregate of previous payments made by the Owner; .6 Subtract the shortfall, if any, indicated by the Design-Builder in the documentation required by Section A.1.5.1.4 to substantiate prior Applications for Payment, or resulting from errors subsequently discovered by the Owner’s auditors in such documentation; and .7 Subtract amounts, if any, for which the Owner has withheld or nullified a payment as provided in Section 9.5 of the Agreement. § A.1.5.4.3 The Owner and Design-Builder shall agree upon (1) a mutually acceptable procedure for review and approval of payments to the Architect, Consultants, and Contractors and (2) the percentage of retainage held on agreements with the Architect, Consultants, and Contractors; and the Design-Builder shall execute agreements in accordance with those terms. § A.1.5.5 Final Payment § A.1.5.5.1 Final payment, constituting the entire unpaid balance of the Contract Sum, shall be made by the Owner to the Design-Builder not later than 30 days after the Design-Builder has fully performed the Contract and the requirements of Section 9.10 of the Agreement have been satisfied, except for the Design-Builder’s responsibility to correct non-conforming Work discovered after final payment or to satisfy other requirements, if any, which extend beyond final payment. § A.1.5.5.2 If the Contract Sum is based on the Cost of the Work, the Owner’s auditors will review and report in writing on the Design-Builder’s final accounting within 30 days after the Design-Builder delivers the final accounting to the Owner. Based upon the Cost of the Work the Owner’s auditors report to be substantiated by the Design-Builder’s final accounting, and provided the other conditions of Section 9.10 of the Agreement have been met, the Owner will, within seven days after receipt of the written report of the Owner’s auditors, either issue a final Certificate for Payment, or notify the Design-Builder in writing of the reasons for withholding a certificate as provided in Section 9.5.1 of the Agreement. ARTICLE A.2 CONTRACT TIME § A.2.1 Contract Time, as defined in the Agreement at Section 1.4.13, is the period of time, including authorized adjustments, for Substantial Completion of the Work. § A.2.2 The Design-Builder shall achieve Substantial Completion of the Work not later than ( ) days from the date of this Amendment, or as follows: (Insert number of calendar days. Alternatively, a calendar date may be used when coordinated with the date of commencement. If appropriate, insert requirements for earlier Substantial Completion of certain portions of the Work.) See Exhibit A.3 – Guaranteed Maximum Price Schedule Portion of Work Substantial Completion Date N/A , subject to adjustments of the Contract Time as provided in the Design-Build Documents. DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 7 (Insert provisions, if any, for liquidated damages relating to failure to achieve Substantial Completion on time or for bonus payments for early completion of the Work.) ARTICLE A.3 INFORMATION UPON WHICH AMENDMENT IS BASED § A.3.1 The Contract Sum and Contract Time set forth in this Amendment are based on the following: § A.3.1.1 The Supplementary and other Conditions of the Contract: Document Title Date Pages § A.3.1.2 The Specifications: (Either list the specifications here or refer to an exhibit attached to this Amendment.) See Exhibit A.4 – Specifications Section Title Date Pages N/A § A.3.1.3 The Drawings: (Either list the drawings here or refer to an exhibit attached to this Amendment.) See Exhibit A.5 – Drawings Number Title Date N/A § A.3.1.4 The Sustainability Plan, if any: (If the Owner identified a Sustainable Objective in the Owner’s Criteria, identify the document or documents that comprise the Sustainability Plan by title, date and number of pages, and include other identifying information. The Sustainability Plan identifies and describes the Sustainable Objective; the targeted Sustainable Measures; implementation strategies selected to achieve the Sustainable Measures; the Owner’s and Design-Builder’s roles and responsibilities associated with achieving the Sustainable Measures; the specific details about design reviews, testing or metrics to verify achievement of each Sustainable Measure; and the Sustainability Documentation required for the Project, as those terms are defined in Exhibit C to the Agreement.) Title Date Pages See A.6 – Sustainable Objective Plan Other identifying information: § A.3.1.5 Allowances and Contingencies: (Identify any agreed upon allowances and contingencies, including a statement of their basis.) .1 Allowances See Exhibit A.7 – Allowances .2 Contingencies See Exhibit A.1 – Guaranteed Maximum Price § A.3.1.6 Design-Builder’s assumptions and clarifications: DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 8 See Exhibit A.1 – Guaranteed Maximum Price § A.3.1.7 Deviations from the Owner’s Criteria as adjusted by a Modification: See Exhibit A.1 – Guaranteed Maximum Price § A.3.1.8 To the extent the Design-Builder shall be required to submit any additional Submittals to the Owner for review, indicate any such submissions below: See Exhibit A.3 – Schedule ARTICLE A.4 DESIGN-BUILDER’S PERSONNEL, CONTRACTORS AND SUPPLIERS § A.4.1 The Design-Builder’s key personnel are identified below: (Identify name, title and contact information.) .1 Superintendent Exhibit A.8 – Key Firms & Personnel .2 Project Manager Exhibit A.8 – Key Firms & Personnel .3 Others Exhibit A.8 – Key Firms & Personnel § A.4.2 The Design-Builder shall retain the following Consultants, Contractors and suppliers, identified below: (List name, discipline, address and other information.) ARTICLE A.5 COST OF THE WORK § A.5.1 Cost To Be Reimbursed as Part of the Contract § A.5.1.1 Labor Costs § A.5.1.1.1 Wages of construction workers directly employed by the Design-Builder to perform the construction of the Work at the site or, with the Owner’s prior approval, at off-site workshops.for labor in the direct employ of Design-Builder shown in Exhibit "G" – Design-Builder’s Fee & Cost Proposal in the performance of the Work at the rates set forth in Exhibit "J" – Hourly Rates. § A.5.1.1.2 With the Owner’s prior approval, wages or salaries of the Design-Builder’s supervisory and administrative personnel when stationed at the site. (If it is intended that the wages or salaries of certain personnel stationed at the Design-Builder’s principal or other offices shall be included in the Cost of the Work, identify below the personnel to be included, whether for all or only part of their time, and the rates at which their time will be charged to the Work.) Person Included Status (full-time/part-time) Rate ($0.00) Rate (unit of time) N/A § A.5.1.1.3 Wages and salaries of the Design-Builder’s supervisory or administrative personnel engaged at factories, workshops or on the road, in expediting the production or transportation of materials or equipment required for the Work, but only for that portion of their time required for the Work.Charges for Design-Builder’s personnel, when stationed at the field office and engaged exclusively in the performance of the Work, or other personnel as Design-Builder and Owner may mutually agree, as provided and set forth in Exhibit "J" – Hourly Rates. § A.5.1.1.4 Costs paid or incurred by the Design-Builder for taxes, insurance, (unless defined otherwise herein), contributions, assessments and benefits required by law or collective bargaining agreements and, for personnel not DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 9 covered by such agreements, customary benefits such as sick leave, medical and health benefits, holidays, vacations and pensions, but not merit bonuses or profit-sharing provided such costs are based on wages and salaries included in the Cost of the Work under Section A.5.1.1. Charges for such costs shall not exceed the Design-Builder’s actual cost and, as a result, when computing amounts chargeable for such costs Design-Builder shall give proper consideration to what portion of such charges are solely attributable to the Work and the effect of any annual or other periodic limitations on any such charges. § A.5.1.1.5 Bonuses, profit sharing, incentive compensation and any other discretionary payments paid to anyone hired by the Design-Builder or paid to the Architect or any Consultant, Contractor or supplier, with the Owner’s prior approval. Notwithstanding Exhibit "J" – Hourly Rates to be used by the Design Builder for progress billings, the Owner shall have the right to audit the Design Builder’s actual labor costs, burdens, and related expenditures before final payment, and adjust the Owner’s payment to the Design Builder for variations found accordingly § A.5.1.2 Contract Costs. Payments made by the Design-Builder to the Architect, Consultants, Contractors and suppliers in accordance with the requirements of their subcontracts.subcontracts properly entered into under this Agreement.. § A.5.1.3 Costs of Materials and Equipment Incorporated in the Completed Construction § A.5.1.3.1 Costs, including transportation and temporary storage, of materials and equipment incorporated or to be incorporated in the completed construction. § A.5.1.3.2 Costs of materials described in the preceding Section A.5.1.3.1 in excess of those actually installed to allow for reasonable waste and installed, but required to provide allowance for waste and for spoilage. Unused excess materials, if any, shall become the Owner’s property be properly stored at the site, or in accordance with the Owner’s instructions, provided to the Owner at the completion of the Work or, at the Owner’s option, shall be sold by the Design-Builder. Any amounts realized Design-Builder; amounts realized, if any, from such sales shall be credited to the Owner as a deduction from the Cost of the Work. Design-Builder shall use its best efforts and judgment to avoid purchasing excess materials without the prior approval of the Owner. § A.5.1.4 Costs of Other Materials and Equipment, Temporary Facilities and Related Items § A.5.1.4.1 Costs of transportation, storage, installation, maintenance, dismantling and removal of materials, supplies, temporary facilities, machinery, equipment and hand tools not customarily owned by construction workers that are provided by the Design-Builder at the site and fully Costs, including transportation and maintenance, of all materials, supplies, equipment, temporary facilities and hand tools (not owned by the workers) consumed in the performance of the Work. Costs of materials, supplies, temporary facilities, machinery, equipment and tools that are not fully consumed shall be based on the cost or value of the item at the time it is first used on the Project site less the value of the item when it is no longer used at the Project site. Costs for items not fully consumed by the Design-Builder shall mean fair market value.Any such items used but not consumed, which are paid for by the Owner, shall become the property of the Owner and shall be delivered to the Owner upon completion of the Work in accordance with instructions furnished by the Owner. If the Owner elects, however, the Design-Builder shall purchase any items from the Owner at a purchase price equal to the original cost charged to the Owner, less the reduction in fair market value resulting directly from any use of such item in connection with the Work or such other price which is mutually acceptable for the Owner and the Design-Builder. Upon demand by the Owner, the Design-Builder shall furnish the Owner with any information and documentation necessary to verify the period of time for which items were used in connection with the Work. § A.5.1.4.2 Rental charges for temporary facilities, machinery, equipment and hand tools not customarily owned by construction workers that are provided by the Design-Builder at the site and costs of transportation, installation, minor repairs, dismantling and removal. The total rental cost of any Design-Builder-owned item may not exceed the purchase price of any comparable item. Rates of Design-Builder-owned equipment and quantities of equipment shall be subject to the Owner’s prior approval.of all necessary machinery and equipment, exclusive of hand tools, not used at the site of the Work, whether rented from the Design-Builder or others, including installation, minor repairs and replacements, dismantling, removal, transportation and delivery costs thereof. Such rental charges shall not exceed the amount set forth in Exhibit "K" – Rental Rates, attached hereto and made part hereof. In the absence of any appropriate rental amount set forth in Exhibit "K" – Rental Rates, rental charges shall be consistent with those generally prevailing in the location of the Project. The Design-Builder shall obtain bids for all machinery and equipment to be rented from no less than two (2) responsible suppliers other than the Design-Builder itself, or an Related Party as defined herein. The Owner shall, with the advice of the Design-Builder, determine which bid is to be DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 10 accepted. In no event shall the Design-Builder be entitled to reimbursement for any cumulative total of rental charges in connection with any single piece of machinery or equipment in excess of sixty percent (60%) of its fair market value as of the date that such machinery or equipment is first put into service in connection with the Work. The Design-Builder shall pay any excess rental charges. Design-Builder shall disclose to the Owner if any rental arrangements include a lease to purchase component as a result of which rental payments chargeable to Owner as costs are applied, in whole or in part, to Design-Builder’s acquisition of such rented equipment, in which event the rental rate otherwise provided for shall be reduced by fifty percent (50%). § A.5.1.4.3 Costs of removal of debris from the site of the Work and its proper and legal disposal. § A.5.1.4.4 Costs of document reproductions, electronic communications, postage and parcel delivery charges, dedicated data and communications services, teleconferences, Project websites, extranets and reasonable Reproductions costs, electronic communications, and tele-data connections at the site, postage and express delivery charges, and reasonable and documented petty cash expenses of the site office. § A.5.1.4.5 Costs of materials and equipment suitably stored off the site at a mutually acceptable location, with the Owner’s prior approval.approval, when stored and maintained in compliance with the Design-Build Documents. § A.5.1.5 Miscellaneous Costs § A.5.1.5.1 Premiums for that portion of insurance and bonds required by the Design-Build Documents That portion of insurance and bond premiums that can be directly attributed to the Contract. and required by this Agreement, provided, however, that such costs shall not be included in the Cost of the Work for purposes of calculating the Design-Builder’s fee. Expenses shall be substantiated by documentation in form of substance satisfactory to Owner. With the Owner’s prior approval self-insurance for either full or partial amounts of the coverages required by the Design-Build Documents. § A.5.1.5.2 Sales, use or similar taxes imposed by a governmental authority that are related to the Work and for which the Design-Builder is liable. § A.5.1.5.3 Fees and assessments for the building permit and for other permits, licenses and inspections for which the Design-Builder is required by the Design-Build Documents to pay. § A.5.1.5.4 Fees of testing laboratories for tests required by the Design-Build Documents, except those related to defective or nonconforming Work for which reimbursement is excluded by Section 15.5.3 of the Agreement or by other provisions of the Design-Build Documents, and which do not fall within the scope of Section A.5.1.6.3. nonconforming Work other than that which payment is permitted under the Design-Build Documents. § A.5.1.5.5 Royalties and license fees paid for the use of a particular design, process process, or product required by the Design-Build Documents; the cost of defending suits or claims for infringement of patent rights arising from such requirement of the Design-Build Documents; and payments made in accordance with legal judgments against the Design-Builder resulting from such suits or claims and payments of settlements made with the Owner’s consent. However, such costs of legal defenses, judgments and settlements shall not be included in the calculation of the Design-Builder’s Fee or subject to the Guaranteed Maximum Price. If such royalties, fees and costs are Documents and provided such royalties, fees, and costs are not excluded by the second to last sentence of Section 3.1.13.2 of the Agreement or other provisions of the Design-Build Documents, then they shall not be included in the Cost of the Work.Documents. § A.5.1.5.6 With the Owner’s prior approval, costs for electronic equipment and software directly related to the Work. § A.5.1.5.7 Deposits lost for causes other than the Design-Builder’s negligence or failure to fulfill a specific responsibility in the Design-Build Documents. § A.5.1.5.8 With the Owner’s prior approval, which shall not be unreasonably withheld, legal, mediation and arbitration costs, including attorneys’ fees, other than those arising from disputes between the Owner and DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 11 Design-Builder, reasonably incurred by the Design-Builder after the execution of the Agreement and in the performance of the Work. § A.5.1.5.9 With the Owner’s prior approval, expenses The cost of travel more than 100 miles from the site by; and commercial lodging, rental housing and meals for the Design-Builder’s supervisory personnel properly and reasonably incurred in the performance of the Work is "Travel and Subsistence". Travel and Subsistence incurred in accordance with the Design-Builder’s standard written personnel policy for relocation, and temporary living allowances of, the Design-Builder’s personnel required for the Work.written personnel policy for actual and verifiable relocation and temporary living expenses of personnel required for the Work, in case it is necessary to relocate such personnel from locations further than one hundred (100) miles from the site, when approved by the Owner in advance and in writing, and not in excess of the line item amount shown for this purpose in Exhibit "G" – Design-Builder’s Fee & Cost Proposal .. § A.5.1.5.10 That portion of the reasonable expenses of the Design-Builder’s supervisory or administrative personnel incurred while traveling in discharge of duties connected with the Work. § A.5.1.6 Other Costs and Emergencies § A.5.1.6.1 Other costs incurred in the performance of the Work if, and to the extent, approved in advance in writing by the Owner. § A.5.1.6.2 Costs incurred in taking action to prevent threatened damage, injury or loss in case of an emergency affecting the safety of persons and property.property to the extent not (1) caused by the Design-Builder, a subcontractor, or anyone for whom either is responsible, or (2) capable of being prevented through timely notice of an unsafe condition to the Owner. § A.5.1.6.3 Costs of repairing or correcting damaged or nonconforming Work executed by the Design-Builder, Contractors or suppliers, provided that such damaged or nonconforming Work was not caused by negligence or failure to fulfill a specific responsibility of the Design-Builder resulted from causes other than the fault, negligence, or neglect of Design-Builder or its subcontractors, vendors or suppliers, in whole or in part, or failure of Design-Builder or its subcontractors, vendors or suppliers to comply with all of the requirements of the Design-Build Documents or the failure of the Design-Builder’s personnel to adequately supervise the Work of the Subcontractors or suppliers and only to the extent that the cost of repair or correction is not recovered by the Design-Builder from insurance, sureties, Contractors, suppliers, or others.recoverable by the Design-Builder from Subcontractors or suppliers. § A.5.1.6.4 Any costs which comprise the Cost of Work, which are also set forth in the Cost Proposal Detail portion of Exhibit "G" – Design-Builder’s Fee & Cost Proposal ("General Conditions"), shall not exceed the total amount shown in aggregate therein for such expenditures. However, any single line item in General Conditions, with the sole exceptions of those included in "Weather Protection" and "Travel and Subsistence", may be exceeded if offset by the aggregate of corresponding or greater underages at other line items, and the total cost for General Conditions is not exceeded. § A.5.1.6.4.1 Design-Builder’s Change Order Requests will include additional General Conditions costs as justifiable, and to the extent the actual expenditures of General Conditions cost items are increased by reason of increase(s) in: the duration of the Work; the quantity of Design-Builder’s facilities and equipment required; or number or duration of supervisory personnel on site directly required to enact the requested change. General Conditions costs shall not be increased for additional personnel and labor costs not actually incurred by the Design-Builder and documented to the satisfaction of the Owner. § A.5.1.6.4.2 Notwithstanding the above, the Design-Builder has included in General Conditions sufficient supervision and project controls personnel to prepare and process a standard amount of project documentation, including without limitation, requests for information, meeting minutes, Proposal Requests, Change Order Requests, Change Orders, and other Design-Builder’s administration and deliverables normally required on similar projects. The Design-Builder will not be additionally compensated above the amount shown in General Conditions for preparing or processing these documents. § A.5.1.6.5 The cost of properly and reasonably maintaining access to the Work in spite of, facilitating progress of the Work during, and protecting the Work itself from the impact of inclement weather is "Weather Protection". Weather DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 12 Protection shall not exceed the total of the line items shown for this purpose in the General Conditions, given the Work is performed during average weather conditions for the Project site, as such average is defined in the Design-Build Documents. § A.5.1.6.5.1 Line items in General Conditions that shall be considered, in their aggregate, for the purpose of calculating the Weather Protection maximum costs allowable under this Agreement include weather protection, snow removal, temporary heat, and temporary protection. § A.5.1.6.6 The actual costs for General Conditions, Weather Protection, and Travel and Subsistence will be billed on an "as incurred" and actual cost basis, and any unused portion of such amounts will revert to the Owner as savings below the Guaranteed Maximum Price. § A.5.1.6.6.1 The Design-Builder shall, without limitation keep such separate and distinct records as are required for the Design-Builder to easily validate the accuracy of the Design-Builder’s billing for the costs of General Conditions, Weather Protection, and Travel and Subsistence. § A.5.1.6.6.2 In the event the Design-Builder believes General Conditions, Weather Protection, or Travel and Subsistence line item(s) included in the Guaranteed Maximum Price should be increased due to changes in the Work or circumstances beyond the Design-Builder’s responsibilities to control under this Agreement; or the Owner or Design-Builder believes such line items should be lowered based on better circumstances for performing the Work than originally anticipated by the Owner and Design-Builder, the Guaranteed Maximum Price shall then be adjusted as provided in the Design-Build Documents for changes in the Work. § A.5.1.6.7 The Design-Builder’s Contingency portion of Exhibit A.1 – Guaranteed Maximum Price is a lump sum provided within the Guaranteed Maximum Price for the Design-Builder’s use during the Preconstruction Phase in protecting the Guaranteed Maximum Price from estimating errors and the market conditions at the time of Subcontractor bidding. As it is not provided for the Design-Builder’s unlimited access and use during the Construction Phase, at the Construction Phase it shall be reduced to the lump sum obtained by using the percentage shown for this purpose in Exhibit A.1 – Guaranteed Maximum Price, or if no percentage is shown therein, to zero (0) at Notice to Proceed with the Work. § A.5.1.6.7.1 Under no circumstances is the Design-Builder’s Contingency to be used by the Owner for increases in the scope, quality or quantity of the Work; nor by the Design-Builder for correcting nonconforming Work; Work items discovered during the Construction Phase not to be coordinated among the Subcontractor’s scope of work due to an oversight of the Design-Builder; or similar Design-Builder’s errors or omissions. § A.5.1.6.7.2 Design-Builder’s access to the Design-Builder’s Contingency shall be approved in writing on a per instance basis by the Owner as being in compliance with the above requirements, such approval not to be unreasonably withheld. § A.5.1.7 Related Party Transactions § A.5.1.7.1 For purposes of Section A.5.1.7, the term "related party" and elsewhere in this Agreement, the term "Related Party" shall mean any party or entity related to or affiliated with the Design-Builder or in which the Design-Builder has direct or indirect ownership or control, including without limitation: (1) a parent, subsidiary, affiliate or other entity having common ownership or management with the Design-Builder; (2) any entity in which any stockholder in, or management employee of, the Design-Builder owns any interest in excess of ten percent in the aggregate; or officer, director, partner or employee of, the Design-Builder or any entity owned by the Design-Builder has any direct or indirect interest in; (3) any party or entity with an excess of ten percent (10%) interest in the Design-Builder in the aggregate; or (4) any person or entity which has the right to control the business or affairs of the Design-Builder. The term "related party" "Related Party" includes any member of the immediate family of any person identified above. § A.5.1.7.2 If after the Design-Builder having followed the stipulations in this Agreement, any of the costs to be reimbursed are contemplated to arise from a transaction between the Design-Builder and a related party, Related Party outside of the bidding process so described, the Design-Builder shall notify the Owner of the specific nature of the contemplated transaction, including the identity of the related party Related Party and the anticipated cost to be incurred, before any such transaction is consummated or cost incurred. If the Owner, after such notification, authorizes the proposed transaction, then the cost incurred shall be included as a cost to be reimbursed, and the Design-Builder DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 13 shall procure the Work, equipment, goods or service from the related party, Related Party, as a Contractor, according to the terms of Section A.5.4. If the Owner fails to authorize the transaction, the Design-Builder shall procure the Work, equipment, goods or service from some person or entity other than a related party Related Party according to the terms of Section A.5.4. § A.5.2 Costs Not to Be Reimbursed as Part of this Contract The Cost of the Work shall not include (unless otherwise specifically stated in Exhibit "G" – Design-Builder’s Fee & Cost Proposal) the items listed below: .1 Salaries and other compensation of the Design-Builder’s personnel stationed at the Design-Builder’s principal office or offices other than the site office, except as specifically provided in Section A.5.1.1; .2 Expenses of the Design-Builder’s principal office and offices other than the site office; .3 Overhead and general expenses, except as may be expressly included in Section A.5.1; .4 The Design-Builder’s capital expenses, including interest on the Design-Builder’s capital employed for the Work; .5 Rental costs of machinery and equipment, except as specifically provided herein; .6 Except as provided in Section A.5.1.6.3 of this Agreement, costs due to the negligence or failure of the Design-Builder, Contractors and suppliers or anyone directly or indirectly employed by any of them or for whose acts any of them may be liable to fulfill a specific responsibility of the Contract; .6 .7 Costs incurred in the performance of Preconstruction Phase Services (unless specifically stated in Exhibit "G" – Design-Builder’s Fee & Cost Proposal); .8 Any cost not specifically and expressly described in Section A.5.1; and .7 .9 Costs, other than costs included in Change Orders approved by the Owner, that would cause the Guaranteed Maximum Price to be exceeded. .10 Services and expenses of the estimating, personnel, accounting, budget control, audit and management information systems (other than pre-construction services) relating to accounting in Design-Builder ’s office and even if at the site, except as specifically identified herein; .11 Interest on Design-Builder ’s capital or on money borrowed by Design-Builder, including the capital employed by Design-Builder in the performance of the Work. .12 Amounts required to be paid by Design-Builder for Federal and/or State income, franchise taxes or other business taxes, but not including any applicable sales taxes; .13 Legal, accounting, or other similar professional services provided by or to Design-Builder, in regard to disputes, arbitrations, litigations or other such proceedings with Subcontractors, with municipal authorities, with Owner or any other person or entity relating to the Project or otherwise; .14 Sales, entertainment, and meal expenses; .15 Employee vehicle expenses, including fuel above the "Travel & Subsistence" topset; .16 Weather Protection and Travel and Subsistence in excess of the line items shown in General Conditions; .17 Other General Conditions costs in excess of those defined in Section A.5.1.6.4; and .18 Costs related to Design-Builder’s indemnification obligations. § A.5.3 Discounts, Rebates, and Refunds § A.5.3.1 Cash discounts obtained on payments made by the Design-Builder shall accrue to the Owner if (1) before making the payment, the Design-Builder included them in an Application for Payment and received payment from the Owner, or (2) the Owner has deposited funds with the Design-Builder with which to make payments; otherwise, cash discounts shall accrue to the Design-Builder. payments. Trade discounts, rebates, refunds and amounts received from sales of surplus materials and equipment shall accrue to the Owner, and the Design-Builder shall make provisions so that they can be obtained.secured. The Design-Builder shall not obtain for its own benefit any discounts, rebates or refunds in connection with the Work from any source including but not limited to its Subcontractors, vendors, or other suppliers of goods, insurance or other services without providing the Owner with at least thirty (30) days prior written notice of the potential discount, rebate or refund and an opportunity to furnish funds if and when necessary to obtain such discount, rebate or refund on behalf of the Owner in accordance with the requirements of this Section A.5.3.1. § A.5.3.2 Amounts that accrue to the Owner in accordance with Section A.5.3.1 shall be credited to the Owner as a deduction from the Cost of the Work. § A.5.4 Other Agreements § A.5.4.1 When the Design-Builder has provided a Guaranteed Maximum Price, and a specific bidder (1) is recommended to the Owner by the Design-Builder; (2) is qualified to perform that portion of the Work; and (3) has DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 14 submitted a bid that conforms to the requirements of the Design-Build Documents without reservations or exceptions, but the Owner requires that another bid be accepted, then the Design-Builder may require that a Change Order be issued to adjust the Guaranteed Maximum Price by the difference between the bid of the person or entity recommended to the Owner by the Design-Builder and the amount of the subcontract or other agreement actually signed with the person or entity designated by the Owner. § A.5.4.2 Agreements between the Design-Builder and Contractors shall conform to the applicable payment provisions of the Design-Build Documents, and shall not be awarded on the basis of cost plus a fee without the prior consent of the Owner. If an agreement between the Design Builder and a Contractor is awarded on a cost plus a fee basis, the Design-Builder shall provide in the agreement for the Owner to receive the same audit rights with regard to the Cost of the Work performed by the Contractor as the Owner receives with regard to the Design-Builder in Section A.5.5, below. § A.5.4.3 The agreements between the Design-Builder and Architect and other Consultants identified in the Agreement shall be in writing. These agreements shall be promptly provided to the Owner upon the Owner’s written request. § A.5.5 Accounting Records The Design-Builder shall keep full and detailed records and accounts related to the cost of the Work and exercise such controls as may be necessary for proper financial management under the Contract and to substantiate all costs incurred. The accounting and control systems shall be satisfactory to the Owner. Owner and the Design-Builder, and be in accordance with the Construction Management Plan. The Owner and the Owner’s auditors shall, during regular business hours and upon reasonable notice, be afforded access to, and shall be permitted to audit audit, inspect and copy, without limitation, the Design-Builder’s records and accounts, including complete documentation supporting actual, direct and "bare" labor costs, job – cost coded labor reports, accounting entries, books, correspondence, instructions, drawings, receipts, subcontracts, Contractor’s proposals, purchase orders, vouchers, memoranda and other data relating to the Contract. The Design-Builder shall preserve these records records, for a period of three five (5) years after final payment, or for such longer period as may be required by law. All records shall be maintained in accordance with generally accepted accounting procedures consistently applied. Subcontractors retained by the Design-Builder on a cost-plus basis shall have the same obligation to retain records and permit audits, inspections and copying as required of the Design-Builder under this Agreement. § A.5.6 Relationship of the Parties The Design-Builder accepts the relationship of trust and confidence established by this Agreement and covenants with the Owner to exercise the Design-Builder’s skill and judgment in furthering the interests of the Owner; to furnish efficient construction administration, management services and supervision; to furnish at all times an adequate supply of workers and materials; and to perform the Work in an expeditious and economical manner consistent with the Owner’s interests. The Owner agrees to furnish or approve, in a reasonably timely manner, information required by the Design-Builder and to make payments to the Design-Builder in accordance with the requirements of the Design-Build Documents when requested in advance and in writing, and in accordance with Texas Government Code Ch. 2251. This Amendment to the Agreement entered into as of the day and year first written above. OWNER (Signature)DESIGN-BUILDER (Signature) (Printed name and title)(Printed name and title) DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E AIA Document A141™ – 2014 Exhibit A. Copyright © 2004 and 2014 by The American Institute of Architects. All rights reserved. WARNING: This AIA® Document is protected by U.S. Copyright Law and International Treaties. Unauthorized reproduction or distribution of this AIA® Document, or any portion of it, may result in severe civil and criminal penalties, and will be prosecuted to the maximum extent possible under the law. This draft was produced by AIA software at 22:17:10 ET on 02/09/2020 under Order No.6456438273 which expires on 05/27/2020, and is not for resale. User Notes: (1397050163) 15 THIS AGREEMENT HAS BEEN BOTH REVIEWED AND APPROVED as to financial and operational obligations and business terms. __________________ ____________________ SIGNATURE PRINTED NAME _________________________________________ TITLE ________________________________________ DEPARTMENT ATTEST: ROSA RIOS, CITY SECRETARY By;_______________________________ APPROVED AS TO LEGAL FORM: AARON LEAL, CITY ATTORNEY By;_______________________________ DESIGN-BUILDER BY: ________________________________ AUTHORIZED SIGNATURE Date: _______________________________ Printed Name: ________________________ Title: _______________________________ ____________________________________ PHONE NUMBER ____________________________________ EMAIL ADDRESS ____________________________________ TEXAS ETHICS COMMISSION CERTIFICATE NUMBER CITY OF DENTON, TEXAS A Texas Municipal Corporation By: _________________________________ TODD HILEMAN CITY MANAGER Martin Lehman President, North Texas (817) 335-3394 mlehman@tsbyrne.com 2020-586060 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH $2ZQHU'HVLJQ%XLOGHU$JUHHPHQW±([KLELW% ,QVXUDQFHDQG%RQGV § B.1 Design-Builder’s Liability Insurance § B.1.17KH'HVLJQ%XLOGHUVKDOOSXUFKDVHDQGPDLQWDLQLQDFRPSDQ\RUFRPSDQLHVODZIXOO\DXWKRUL]HGWRGREXVLQHVV LQ7H[DVDQGDVIXUWKHUTXDOLILHGLQ3DUDJUDSK%VXFKLQVXUDQFH DV ZLOO SURWHFW WKH 'HVLJQ%XLOGHU DQG WKH ,QGHPQLWHHVIURPFODLPVVHWIRUWKEHORZZKLFKPD\DULVHRXWRIRUUHVXOWIURPWKH'HVLJQ%XLOGHU¶VRSHUDWLRQVDQG FRPSOHWHGRSHUDWLRQVXQGHUWKH&RQWUDFWLQFOXGLQJWKH'HVLJQ%XLOGHU¶VDFWVDQGRURPLVVLRQVDQGIRUZKLFKWKH 'HVLJQ%XLOGHUPD\EHOHJDOO\OLDEOHZKHWKHUVXFKRSHUDWLRQVEHE\WKH'HVLJQ%XLOGHURUE\D6XEFRQWUDFWRURUE\ DQ\RQHGLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPRUE\DQ\RQHIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOH .1 &ODLPVXQGHUZRUNHUV¶FRPSHQVDWLRQGLVDELOLW\EHQHILWDQGRWKHUVLPLODUHPSOR\HHEHQHILWDFWVZKLFKDUH DSSOLFDEOHWRWKH:RUNWREHSHUIRUPHGLQFOXGLQJSULYDWHHQWLWLHVSHUIRUPLQJ:RUNDWWKHVLWHDQGH[HPSW IURPWKHFRYHUDJHRQDFFRXQWRIQXPEHURIHPSOR\HHVRURFFXSDWLRQZKLFKHQWLWLHVVKDOOPDLQWDLQYROXQWDU\ FRPSHQVDWLRQFRYHUDJHDWWKHVDPHOLPLWVVSHFLILHGIRUPDQGDWRU\FRYHUDJHIRUWKHGXUDWLRQRIWKH3URMHFW .2 &ODLPVIRUGDPDJHVEHFDXVHRIERGLO\LQMXU\RFFXSDWLRQDOVLFNQHVVRUGLVHDVHRUGHDWKRIWKH'HVLJQ %XLOGHU¶VHPSOR\HHVRUSHUVRQVRUHQWLWLHVH[HPSWE\VWDWXWHIURPWKHUHTXLUHPHQWVRI6HFWLRQ%EXW UHTXLUHGE\WKH'HVLJQ%XLOG'RFXPHQWVWRSURYLGHWKHLQVXUDQFHUHTXLUHGE\WKDW6HFWLRQ .3 &ODLPVIRUGDPDJHVEHFDXVHRIERGLO\LQMXU\VLFNQHVVRUGLVHDVHRUGHDWKRIDQ\SHUVRQRWKHUWKDQWKH 'HVLJQ%XLOGHU¶VHPSOR\HHV .4 &ODLPVIRUGDPDJHVLQVXUHGE\XVXDOSHUVRQDOLQMXU\OLDELOLW\FRYHUDJH .5 &ODLPVIRUGDPDJHVRWKHUWKDQWRWKH:RUNLWVHOIEHFDXVHRILQMXU\WRRUGHVWUXFWLRQRIWDQJLEOHSURSHUW\ LQFOXGLQJORVVRIXVHUHVXOWLQJWKHUHIURP .6 &ODLPVIRUGDPDJHVEHFDXVHRIERGLO\LQMXU\GHDWKRIDSHUVRQRUSURSHUW\GDPDJHDULVLQJRXWRI RZQHUVKLSPDLQWHQDQFHRUXVHRIDPRWRUYHKLFOHLQFOXGLQJSROOXWLRQFOHDQXSLIKDXOLQJKD]DUGRXV PDWHULDOV .7 &ODLPVIRUERGLO\LQMXU\RUSURSHUW\GDPDJHDULVLQJRXWRIFRPSOHWHGRSHUDWLRQVZKLFKFRYHUDJHVKDOOEH PDLQWDLQHGIRUQROHVVWKDQWHQ\HDUVIROORZLQJILQDOSD\PHQWDQG .8 &ODLPVIRUGDPDJHVWRWKH:RUNDQGRUPDWHULDOVDQGHTXLSPHQWXVHGVWRUHGDWWKH:RUNDVPD\EH FRYHUHGXQGHUDQ\%XLOGHU¶V5LVNLQVXUDQFHSROLF\. § B.1.27KH'HVLJQ%XLOGHU¶V&RPPHUFLDO*HQHUDO/LDELOLW\,QVXUDQFHVKRXOGEHZULWWHQRQ,62)RUP&* RULWVHTXLYDOHQWDQGSURYLGHWKHIROORZLQJ .1 3UHPLVHVRSHUDWLRQV,QFOXGLQJ;&8FRYHUDJHV .2 ,QGHSHQGHQW&RQWUDFWRUV .3 3URGXFWVDQGFRPSOHWHGRSHUDWLRQVZLWKDSHUSURMHFWDJJUHJDWHOLPLWZKLFKFRYHUDJHVKDOOEHPDLQWDLQHG IRUDSHULRGRIWHQ\HDUVIURPWKHGDWHRIWKH)LQDO3D\PHQW .4 3HUVRQDOLQMXU\OLEHOVODQGHUIDOVHDUUHVWOLDELOLW\ZLWKHPSOR\PHQWH[FOXVLRQGHOHWHG .5 %ODQNHW &RQWUDFWXDO LQFOXGLQJ EXW QRW OLPLWHG WR D VSHFLILHG SURYLVLRQ IRU WKH 'HVLJQ%XLOGHU¶V REOLJDWLRQVXQGHU6HFWLRQRIWKH$JUHHPHQWRIWKH'HVLJQ%XLOG'RFXPHQWV .6 %URDGIRUPSURSHUW\GDPDJHLQFOXGLQJEXWQRWOLPLWHGWRFRPSOHWHGRSHUDWLRQV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH .7 3ULPDU\DQG1RQ&RQWULEXWRU\HQGRUVHPHQWLQIDYRURI,QGHPQLWHHVDQG 8. &RQWDLQD:DLYHURI6XEURJDWLRQLQIDYRURI,QGHPQLWHHV § B.1.3 3URIHVVLRQDO(UURUVDQG2PLVVLRQV/LDELOLW\,QVXUDQFHLVUHTXLUHGIRUDOOOLFHQVHGDQGFHUWLILHGSURIHVVLRQDOV LQFOXGLQJEXWQRWOLPLWHGWRWKH'HVLJQ%XLOGHUHQJLQHHUVDUFKLWHFWVDQGRWKHUGHVLJQSURIHVVLRQDOVDVIROORZV .1 7KHUHWURDFWLYHGDWHSUHFHGLQJWKHGDWHRIWKHFRQWUDFWDQG .2 $QH[WHQGHGUHSRUWLQJSHULRGRIWKUHH\HDUVSDVW6XEVWDQWLDO&RPSOHWLRQ § B.1.4 Notice of Cancellation or Expiration of Design-Builder’s Required Insurance.:LWKLQWKUHHEXVLQHVVGD\VRI WKHGDWHWKH'HVLJQ%XLOGHUEHFRPHVDZDUHRIDQLPSHQGLQJRUDFWXDOFDQFHOODWLRQRUH[SLUDWLRQRIDQ\LQVXUDQFH UHTXLUHGE\WKH'HVLJQ%XLOG'RFXPHQWVWKH'HVLJQ%XLOGHUVKDOOSURYLGHQRWLFHWRWKH2ZQHURIVXFKLPSHQGLQJ RUDFWXDOFDQFHOODWLRQRUH[SLUDWLRQ8SRQUHFHLSWRIQRWLFHIURPWKH'HVLJQ%XLOGHUWKH2ZQHUVKDOOXQOHVVWKH ODSVHLQFRYHUDJHDULVHVIURPDQDFWRURPLVVLRQRIWKH2ZQHUKDYHWKHULJKWWRVWRSWKH:RUNXQWLOWKHODSVHLQ FRYHUDJHKDVEHHQFXUHGE\WKHSURFXUHPHQWRIUHSODFHPHQWFRYHUDJHE\WKH'HVLJQ%XLOGHU7KHIXUQLVKLQJRI QRWLFHE\WKH'HVLJQ%XLOGHUVKDOOQRWUHOLHYHWKH'HVLJQ%XLOGHURIDQ\FRQWUDFWXDOREOLJDWLRQWRSURYLGHDQ\ UHTXLUHGFRYHUDJH § B.1.57KH'HVLJQ%XLOGHUVKDOOIRUWKHSURWHFWLRQDQGEHQHILWRIWKH,QGHPQLWHHVDQGWKH'HVLJQ%XLOGHUDQGDVSDUW RIWKH'HVLJQ%XLOGHU¶VHIIRUWVWRVDWLVI\WKHREOLJDWLRQVVHWIRUWKLQWKLV([KLELW³%´SURFXUHSD\IRUDQGPDLQWDLQ LQIXOOIRUFHDQGHIIHFWDWDOOWLPHVGXULQJWKHSHUIRUPDQFHRIWKH:RUNXQWLOILQDODFFHSWDQFHRIWKH:RUNDQGIRU VXFKGXUDWLRQDVUHTXLUHGLQWKH'HVLJQ%XLOG'RFXPHQWVSROLFLHVRILQVXUDQFHLVVXHGE\DUHVSRQVLEOHFDUULHUV DFFHSWDEOHWRWKH2ZQHUDQGLQIRUPDQGVXEVWDQFHVDWLVIDFWRU\WRWKH2ZQHUWKDWDIIRUGWKHFRYHUDJHVVHWIRUWKLQ WKH6FKHGXOHRI,QVXUDQFHDWWDFKHGWRWKH&RQWUDFWDQGPDGHDSDUWRILWDV([KLELW³;´±'HVLJQ%XLOGHU¶V,QVXUDQFH &HUWLILFDWHV$OOVXFKLQVXUDQFHVKDOOEHZULWWHQRQDQRFFXUUHQFHEDVLVZLWKWKHVROHH[FHSWLRQRI3URIHVVLRQDO(UURUV DQG2PLVVLRQV/LDELOLW\,QVXUDQFH,QWKHHYHQWSURIHVVLRQDOOLDELOLW\FRYHUDJHLVQRWDYDLODEOHRQ³DQRFFXUUHQFH´ EDVLVD³FODLPVPDGH´EDVLVSROLF\ZLWKHIIHFWLYHDQGUHWURDFWLYHGDWHVSULRUWRWKHHIIHFWLYHGDWHRIWKH'HVLJQ%XLOG 'RFXPHQWVDQGDQH[WHQGHGUHSRUWLQJSHULRGRIDWOHDVWWKUHH\HDUVEH\RQG6XEVWDQWLDO&RPSOHWLRQRUDVRWKHUZLVH UHTXLUHGE\WKH'HVLJQ%XLOG'RFXPHQWVZKLFKHYHULVJUHDWHUPD\EHVXEVWLWXWHGZLWKWKHZULWWHQFRQVHQWDQG DSSURYDORIWKH2ZQHU7KH'HVLJQ%XLOGHU¶VFRPSOHWHGRSHUDWLRQVFRYHUDJHVKDOOEHPDLQWDLQHGXQWLOWKHH[SLUDWLRQ RIWKHSHULRGIRUFRUUHFWLRQRI:RUNRUIRUVXFKRWKHUSHULRGIRUPDLQWHQDQFHRIFRPSOHWHGRSHUDWLRQVFRYHUDJHDV VSHFLILHGLQWKH'HVLJQ%XLOG'RFXPHQWV § B.1.67KH'HVLJQ%XLOGHUDJUHHVWRGHOLYHUWRWKH2ZQHUZLWKLQWHQGD\VRIWKHGDWHRIWKH2ZQHU'HVLJQ %XLOGHU$JUHHPHQWDQGSULRUWREULQJLQJDQ\HTXLSPHQWRUSHUVRQQHORQWRWKHVLWHRIWKH:RUNRUWKH3URMHFWVLWHDQG WKHUHDIWHUXSRQUHQHZDORUUHSODFHPHQWRIHDFKUHTXLUHGSROLF\RILQVXUDQFHFHUWLILHGFRSLHVRIDOOUHTXLUHGLQVXUDQFH SROLFLHVSURFXUHGE\WKH'HVLJQ%XLOGHUXQGHURUSXUVXDQWWRWKLV([KLELW³%´RUZLWKWKHZULWWHQFRQVHQWRIWKH 2ZQHU&HUWLILFDWHVRI,QVXUDQFHLQIRUPDQGVXEVWDQFHVDWLVIDFWRU\WRWKH2ZQHUHYLGHQFLQJWKHUHTXLUHGFRYHUDJHV ZLWKOLPLWVQRWOHVVWKDQWKRVHVSHFLILHGLQ6HFWLRQ%EHORZDQGDOOHQGRUVHPHQWVDVUHTXLUHGLQWKLV([KLELW³%´ KHUHLQ7KHFRYHUDJHDIIRUGHGXQGHUDQ\LQVXUDQFHSROLF\REWDLQHGXQGHURUSXUVXDQWWRWKLV6HFWLRQ%VKDOOEH SULPDU\WRDQ\YDOLGDQGFROOHFWLEOHLQVXUDQFHFDUULHGVHSDUDWHO\E\DQ\RIWKH,QGHPQLWHHV)XUWKHUPRUHDOOSROLFLHV DQG&HUWLILFDWHVRI,QVXUDQFHVKDOOH[SUHVVO\SURYLGHWKDWQROHVVWKDQWKLUW\GD\VSULRUZULWWHQQRWLFHWHQ GD\V IRU QRQSD\PHQW RI SUHPLXP VKDOO EH JLYHQ WKH 2ZQHU LQ WKH HYHQW RI PDWHULDO DOWHUDWLRQ FDQFHOODWLRQ QRQUHQHZDORUH[SLUDWLRQRIWKHFRYHUDJHFRQWDLQHGLQVXFKSROLF\RUHYLGHQFHGE\VXFKFHUWLILHGFRS\RU&HUWLILFDWH RI,QVXUDQFH$QDGGLWLRQDOFHUWLILFDWHHYLGHQFLQJFRQWLQXDWLRQRIOLDELOLW\FRYHUDJHLQFOXGLQJFRYHUDJHIRUFRPSOHWHG RSHUDWLRQVVKDOOEHVXEPLWWHGZLWKWKHILQDO$SSOLFDWLRQIRU3D\PHQWDVUHTXLUHGE\6HFWLRQRIWKH$JUHHPHQW DQGWKHUHDIWHUXSRQUHQHZDORUUHSODFHPHQWRIVXFKFRYHUDJHXQWLOWKHH[SLUDWLRQRIWKHWLPHUHTXLUHGE\6HFWLRQ% ,QIRUPDWLRQFRQFHUQLQJUHGXFWLRQRIFRYHUDJHVKDOOEHIXUQLVKHGE\WKH'HVLJQ%XLOGHUZLWKUHDVRQDEOHSURPSWQHVV § B.1.7&HUWLILFDWHVRI,QVXUDQFHZLWKWKHIROORZLQJRUVLPLODUZRUGLQJDUHQRWDFFHSWDEOH³)DLOXUHWRQRWLI\WKH FHUWLILFDWHKROGHUVKDOOLPSRVHQRREOLJDWLRQRUOLDELOLW\RIDQ\NLQGXSRQWKHLQVXUHULWVDJHQWVRUUHSUHVHQWDWLYHV´ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH § B.1.8,QQRHYHQWVKDOODQ\IDLOXUHRIWKH2ZQHUWRUHFHLYHFHUWLILHGFRSLHVRUFHUWLILFDWHVRISROLFLHVUHTXLUHGXQGHU 3DUDJUDSK%RUWRGHPDQGUHFHLSWRIVXFKFHUWLILHGFRSLHVRUFHUWLILFDWHVSULRUWRWKH'HVLJQ%XLOGHU¶VFRPPHQFLQJ WKH:RUNEHFRQVWUXHGDVDZDLYHUE\WKH2ZQHURIWKH'HVLJQ%XLOGHU¶VREOLJDWLRQVWRREWDLQLQVXUDQFHSXUVXDQWWR WKLV([KLELW³%´ § B.1.9 :KHQDQ\UHTXLUHGLQVXUDQFHGXHWRWKHDWWDLQPHQWRIQRUPDOH[SLUDWLRQGDWHRUUHQHZDOGDWHVKDOOH[SLUHWKH 'HVLJQ%XLOGHUVKDOOIXUQLVKWRWKH2ZQHU&HUWLILFDWHVRI,QVXUDQFHDQGDPHQGDWRU\ULGHUVRUHQGRUVHPHQWVWKDWFOHDUO\ HYLGHQFHWKHFRQWLQXDWLRQRIDOOFRYHUDJHLQWKHVDPHPDQQHUOLPLWVRISURWHFWLRQDQGVFRSHRIFRYHUDJHDVZDV SURYLGHGE\WKHSUHYLRXVSROLF\IRUW\ILYHGD\VSULRUWRUHQHZDOGDWH,QWKHHYHQWDQ\UHQHZDORUUHSODFHPHQW SROLF\IRUZKDWHYHUUHDVRQREWDLQHGRUUHTXLUHGLVZULWWHQE\DFDUULHURWKHUWKDQWKDWZLWKZKRPWKHFRYHUDJHZDV SUHYLRXVO\SODFHGRUWKHVXEVHTXHQWSROLF\GLIIHULQDQ\ZD\IURPWKHSUHYLRXVSROLF\WKH'HVLJQ%XLOGHUVKDOODOVR IXUQLVKWKH2ZQHUZLWKDFHUWLILHGFRS\RIWKHUHQHZDORUUHSODFHPHQWSROLF\XQOHVVWKH2ZQHUSURYLGHVWKH'HVLJQ %XLOGHUZLWKSULRUZULWWHQFRQVHQWWRVXEPLWRQO\D&HUWLILFDWHRI,QVXUDQFHIRUDQ\VXFKSROLF\$OOUHQHZDODQG UHSODFHPHQWSROLFLHVVKDOOEHLQIRUPDQGVXEVWDQFHVDWLVIDFWRU\WRWKH2ZQHUDQGZULWWHQE\FDUULHUVDFFHSWDEOHWRWKH 2ZQHU § B.1.10 $Q\$JJUHJDWHOLPLWXQGHUWKH'HVLJQ%XLOGHU¶VOLDELOLW\LQVXUDQFHVKDOOE\HQGRUVHPHQWDSSO\WRWKLV3URMHFW VHSDUDWHO\ § B.1.11 7KH'HVLJQ%XLOGHUVKDOOQRWLI\WKH2ZQHULQZULWLQJRIDQ\UHGXFWLRQLQFROOHFWLEOHOLPLWVDJJUHJDWHOLPLWV E\DQDPRXQWLQH[FHVVRI)LIW\7KRXVDQG'ROODUVDQGWKH'HVLJQ%XLOGHUVKDOOSURPSWO\SURFXUHDWQR H[SHQVHWRWKH2ZQHUVXFKDGGLWLRQDOFRYHUDJHDVQHFHVVDU\WRUHVWRUHWKHYDOLGDQGFROOHFWLEOHOLPLWVRIVXFK LQVXUDQFHWRWKDWUHTXLUHGXQGHUWKH'HVLJQ%XLOG'RFXPHQWV § B.1.12 7KH'HVLJQ%XLOGHUVKDOOFDXVHHDFK6XEFRQWUDFWRUWRSURFXUHLQVXUDQFHFRQJUXHQWZLWKWKH'HVLJQ%XLOGHU¶V LQVXUDQFHUHTXLUHPHQWVDVVSHFLILHGLQWKH'HVLJQ%XLOG'RFXPHQWVDQGVDWLVIDFWRU\WRWKH2ZQHUDQGQDPHHDFKRI WKH ,QGHPQLWHHV DV DGGLWLRQDO LQVXUHGV XQGHU WKH 6XEFRQWUDFWRU¶V FRPPHUFLDO JHQHUDO OLDELOLW\ DXWRPRELOH DQG XPEUHOODH[FHVVOLDELOLW\SROLFLHV7KHDGGLWLRQDOLQVXUHGHQGRUVHPHQWLQFOXGHGRQWKH6XEFRQWUDFWRU¶VFRPPHUFLDO JHQHUDOOLDELOLW\SROLF\VKDOOVWDWHWKDWFRYHUDJHLVDIIRUGHGWKHDGGLWLRQDOLQVXUHGVZLWKUHVSHFWWRFODLPVDULVLQJRXW RIDOORQJRLQJDQGFRPSOHWHGRSHUDWLRQVSHUIRUPHGE\RURQEHKDOIRIWKH'HVLJQ%XLOGHU(DFKSROLF\LQFOXGLQJ :RUNHUV¶&RPSHQVDWLRQVKDOOFRQWDLQD:DLYHURI6XEURJDWLRQLQIDYRURIWKH,QGHPQLWLHVSURYLGHIRUIRUW\ILYH GD\QRWLFHRIFDQFHOODWLRQRUQRQUHQHZDODQGEHSULPDU\ZLWKRXWFRQWULEXWLRQLIWKHDGGLWLRQDOLQVXUHGVKDYHRWKHU LQVXUDQFHWKDWLVDSSOLFDEOHWRWKHORVV,IWKHDGGLWLRQDOLQVXUHGVKDYHRWKHULQVXUDQFHWKDWLVDSSOLFDEOHWRWKHORVV VXFKRWKHULQVXUDQFHVKDOOEHRQDQH[FHVVRUFRQWLQJHQWEDVLV7KHDPRXQWRIWKHLQVXUHU¶VOLDELOLW\XQGHUWKLVLQVXUDQFH VKDOOQRWEHUHGXFHGE\WKHH[LVWHQFHRIVXFKRWKHULQVXUDQFH § B.1.13 7KH,QGHPQLWHHVVKDOOEHVKRZQDV³$GGLWLRQDO,QVXUHGV´RQWKHFRPPHUFLDOJHQHUDOOLDELOLW\DXWRPRELOH OLDELOLW\DQGXPEUHOODH[FHVVOLDELOLW\SROLFLHVDQGHYLGHQFHRIVDPHPXVWEHLQFOXGHGLQ&HUWLILFDWHVRI,QVXUDQFH &RSLHVRISROLF\HQGRUVHPHQWVPXVWEHSURYLGHGOLVWLQJWKH,QGHPQLWLHVDV$GGLWLRQDO,QVXUHGVXVLQJ,62IRUPV &*&*&$&$RUWKHLUHTXLYDOHQWVDQGDSSURYHGDVWRIRUPE\2ZQHU § B.1.14 $³ZDLYHURIVXEURJDWLRQ´FODXVHLQIDYRURIWKH2ZQHUZLOOEHDWWDFKHGWRWKHZRUNHUV¶FRPSHQVDWLRQ FRPPHUFLDOJHQHUDOOLDELOLW\XPEUHOODH[FHVVOLDELOLW\DXWRPRELOHDQGDQ\DSSOLFDEOHSURSHUW\LQVXUDQFHSROLFLHV DQGHYLGHQFHRIVDPHPXVWEHLQFOXGHGLQ&HUWLILFDWHVRI,QVXUDQFH&RSLHVRISROLF\HQGRUVHPHQWVPXVWEH SURYLGHGVKRZLQJZDLYHUVRIVXEURJDWLRQLQIDYRURIWKH,QGHPQLWLHVXVLQJ,62IRUPV&*&$&$ :&RUWKHLUHTXLYDOHQWVDQGDSSURYHGDVWRIRUPE\2ZQHU § B.1.15 7KH 2ZQHU UHVHUYHV WKH ULJKW WR UHYLHZ WKH LQVXUDQFH UHTXLUHPHQWV GXULQJ WKH HIIHFWLYH SHULRG RI LWV $JUHHPHQWZLWKWKH'HVLJQ%XLOGHUDQGSURYLGHDZULWWHQUHTXHVWIRUWKH'HVLJQ%XLOGHUWRPDNHDQ\UHDVRQDEOHDQG FRPPHUFLDOO\DYDLODEOHDGMXVWPHQWVWRLQVXUDQFHFRYHUDJHVDQG?RUOLPLWVZKHQGHHPHGUHDVRQDEO\SUXGHQWE\WKH 2ZQHUEDVHGXSRQLWVXQLODWHUDOLQWHUSUHWDWLRQRIFKDQJHVLQVWDWXWRU\ODZFRXUWGHFLVLRQVRUWKH2ZQHU¶VSRWHQWLDO LQFUHDVHLQH[SRVXUHWRORVV § B.1.16 1HLWKHU 'HVLJQ%XLOGHU 6XEFRQWUDFWRU 6XEVXEFRQWUDFWRU QRU DQ\ RI WKHLU LQVXUDQFH FDUULHU¶V OLDELOLW\ REOLJDWLRQVVKDOOEHOLPLWHGWRWKHPLQLPXPOLPLWVRIFRYHUDJHRILQVXUDQFHPDLQWDLQHGRUUHTXLUHGWREHPDLQWDLQHG E\WKH'HVLJQ%XLOG'RFXPHQWV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH § B.2 Owner’s Liability Insurance § B.2.1 7KH2ZQHUVKDOOEHUHVSRQVLEOHIRUSXUFKDVLQJDQGPDLQWDLQLQJWKH2ZQHU¶VXVXDOOLDELOLW\LQVXUDQFH § B.3 Property Insurance § B.3.12ZQHUVKDOOSXUFKDVHDQGPDLQWDLQ³EXLOGHU¶VULVN´SURSHUW\LQVXUDQFHRUFRPSDUDEOHFRYHUDJHIRUWKHIXOO UHSODFHPHQWFRVWYDOXHWKHUHRIIRULWKH:RUNWKDWLVWREHGRQHLLDOOLQVXUDEOHLWHPVRI:RUNWLWOHWRZKLFKKDV EHHQDFTXLUHGE\2ZQHULQDFFRUGDQFHZLWKWKH'HVLJQ%XLOG'RFXPHQWVDQGLLLDOOPDWHULDOVWREHLQFRUSRUDWHGLQ WKH:RUNLIVXFKPDWHULDOVDUHLQRUXSRQWKH3UHPLVHVRULQWUDQVLWWR3UHPLVHVZKHWKHURUQRWWLWOHKDVEHHQ DFTXLUHGE\2ZQHU6XFKLQVXUDQFHVKDOOQRWFRYHUDQ\SURSHUW\RZQHGOHDVHGRURWKHUZLVHXVHGLQFRQQHFWLRQ ZLWKWKH:RUNE\'HVLJQ%XLOGHU'HVLJQ%XLOGHU¶V6XEFRQWUDFWRUVRUWKHDJHQWVRUHPSOR\HHVRIWKHPWKDWLVQRW IRUPLQJDSHUPDQHQWSDUWRIWKH3URMHFW7KLVLQVXUDQFHVKDOOLQFOXGHWKHLQWHUHVWVRI2ZQHU'HVLJQ%XLOGHUDQG 6XEFRQWUDFWRUVDQGVKDOOSURYLGHFRYHUDJHDJDLQVWORVVIRU³GLUHFWSK\VLFDOGDPDJH´SUHYLRXVO\NQRZQDV³DOOULVN´ FRYHUDJHLQFOXGLQJEXWQRWOLPLWHGWRZLWKRXWGXSOLFDWLRQRIFRYHUDJHILUHH[WHQGHGFRYHUDJHYDQGDOLVPDQG PDOLFLRXVPLVFKLHIWKHIWFROODSVHHDUWKTXDNHIORRGILUHVSULQNOHUOHDNDJHZLQGVWRUPWHVWLQJDQGVWDUWXS WHPSRUDU\EXLOGLQJVDQGGHEULVUHPRYDOLQFOXGLQJGHPROLWLRQDQGLQFUHDVHGFRVWRIFRQVWUXFWLRQRFFDVLRQHGE\ HQIRUFHPHQWRIDQ\DSSOLFDEOHOHJDOUHTXLUHPHQWV § B.3.2$Q\FRYHUDJHUHODWHGWRWKHEXLOGHU¶VULVNSURSHUW\LQVXUDQFHPDLQWDLQHGE\2ZQHUIRUWLPHLQFOXGLQJGHOD\LQ RSHQLQJDQGRUH[WUDH[SHQVHVVKDOOLQXUHWRWKHEHQHILWRI2ZQHURQO\2ZQHUVKDOOEHWKHRQO\SDUW\LQVXUHGXQGHU VXFKSROLF\ZLWKWKHVROHH[FHSWLRQWKDW'HVLJQ%XLOGHUPD\EHHQWLWOHGWRSD\PHQWRILWVIHHDQGJHQHUDOFRQGLWLRQV DVVRFLDWHGZLWKWKHUHFRQVWUXFWLRQOHVVDQ\GHGXFWLEOH § B.3.3 ,I2ZQHUGRHVQRWLQWHQGWRSXUFKDVHEXLOGHU¶VULVNSURSHUW\LQVXUDQFHIRUWKHIXOOUHSODFHPHQWFRVWYDOXHRI WKHHQWLUH:RUN2ZQHUVKDOOLQIRUP'HVLJQ%XLOGHURIVXFKLQWHQWLRQLQZULWLQJSULRUWRFRPPHQFHPHQWRIWKH:RUN 'HVLJQ%XLOGHUPD\WKHQREWDLQLQVXUDQFHWKDWZLOOSURWHFWWKHLQWHUHVWVRILWVHOILWV6XEFRQWUDFWRUVDQGWKH6XE VXEFRQWUDFWRUVLQWKH:RUNDQGWKHFRVWWKHUHRIPD\EHFKDUJHGWR2ZQHUE\DSSURSULDWH&KDQJH2UGHU,I'HVLJQ %XLOGHUSURYLGHVLQVXUDQFHLQOLHXRI2ZQHUVXFKLQVXUDQFHVKDOOFRYHUDJDLQVWORVVIRU³GLUHFWSK\VLFDOGDPDJH´ SUHYLRXVO\NQRZQDV³DOOULVN´FRYHUDJHZLWKVXIILFLHQWOLPLWVWRSURWHFWWKHIXOOUHSODFHPHQWFRVWYDOXHRIWKH:RUN § B.3.4 ,IE\WKHWHUPVRIWKHSURSHUW\LQVXUDQFHWKHUHLVDGHGXFWLEOHDPRXQWLQWKHHYHQWRIDORVVFRYHUHGE\VXFK LQVXUDQFH'HVLJQ%XLOGHUVKDOOEHUHVSRQVLEOHIRUDOOGHGXFWLEOHVSHURFFXUUHQFHZKLFKVKDOOEHFRQVLGHUHGD&RVWRI WKH:RUNIRUDOOLQVXUDEOHLWHPVRI:RUNDQGPDWHULDOVWREHLQFRUSRUDWHGLQWKH:RUNWLWOHWRZKLFKKDVQRWEHHQ DFTXLUHGE\2ZQHULQDFFRUGDQFHZLWKWKH'HVLJQ%XLOG'RFXPHQWV([FHSWIRU'HVLJQ%XLOGHU¶VGHGXFWLEOHULVN 2ZQHULVEHDULQJDOOULVNRIORVVWRWKH3URSHUW\IRUZKLFK2ZQHU'HVLJQ%XLOGHUDQGRWKHUVKDYHDQLQVXUDEOHRU ILQDQFLDOLQWHUHVWGXULQJFRQVWUXFWLRQDQGLQWKHHYHQWRIDORVVWRWKHSURSHUW\GXULQJFRQVWUXFWLRQ2ZQHUDJUHHVWR UHO\VROHO\WRWKHSURFHHGVRIWKH%XLOGHU¶V5LVN,QVXUDQFHZKLFK2ZQHUKDVDJUHHGWRIXUQLVK § B.3.57RWKHH[WHQWSHUPLWWHGE\ODZ2ZQHUDQG'HVLJQ%XLOGHUZDLYHDOOULJKWVDJDLQVWHDFKRWKHUDQGDQ\RI WKHLU 6XEFRQWUDFWRUV VXEVXEFRQWUDFWRUV DJHQWV DQG HPSOR\HHV HDFK RI WKH RWKHU DQG 2ZQHU¶V 6HSDUDWH &RQWUDFWRUVLIDQ\DQGDQ\RIWKHLUVXEFRQWUDFWRUVVXEVXEFRQWUDFWRUVDJHQWVDQGHPSOR\HHVIRUGDPDJHVFDXVHG E\ILUHRURWKHUFDXVHVRIORVVWRWKHH[WHQWFRYHUHGE\SURSHUW\LQVXUDQFHREWDLQHGSXUVXDQWWRWKLV6HFWLRQRURWKHU SURSHUW\LQVXUDQFHDSSOLFDEOHWRWKH:RUN2ZQHURU'HVLJQ%XLOGHUDVDSSURSULDWHVKDOOUHTXLUHRI2ZQHU¶V 6HSDUDWH&RQWUDFWRUVLIDQ\DQGWKH6XEFRQWUDFWRUVVXEVXEFRQWUDFWRUVDJHQWVDQGHPSOR\HHVRIDQ\RIWKHPE\ ZULWWHQDSSURSULDWHDJUHHPHQWVLPLODUZDLYHUVHDFKLQIDYRURIRWKHUSDUWLHVHQXPHUDWHGKHUHLQ § B.3.67RWKHGHJUHHDOORZHGE\WKHLQVXUHUWKH'HVLJQ%XLOGHUVKDOOKDYHLWVSROLFLHVHQGRUVHGWRSURYLGHIRUD ZDLYHURIWKHULJKWRIVXEURJDWLRQDJDLQVWWKH2ZQHU. § B.3.7$Q\ORVVLQVXUHGSXUVXDQWWRWKLV6HFWLRQ%3URSHUW\,QVXUDQFHLVWREHDGMXVWHGE\2ZQHUDQGPDGHSD\DEOH WR2ZQHUDVWUXVWHHIRUWKHLQVXUHGVDVWKHLULQWHUHVWVPD\DSSHDUVXEMHFWWRWKHUHTXLUHPHQWVRIDQ\DSSOLFDEOH PRUWJDJHHFODXVH'HVLJQ%XLOGHUVKDOOSD\HDFK6XEFRQWUDFWRUDMXVWVKDUHRIDQ\LQVXUDQFHPRQLHVUHFHLYHGE\ 'HVLJQ%XLOGHUDQGE\DSSURSULDWHZULWWHQDJUHHPHQWVKDOOUHTXLUHHDFK6XEFRQWUDFWRUWRPDNHSD\PHQWVWRLWVVXE VXEFRQWUDFWRUVLQVLPLODUPDQQHU DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH § B.4 Performance Bond and Payment Bond § B.4.1 7KH 'HVLJQ%XLOGHU PXVW IXUQLVK ERQGV FRYHULQJ IDLWKIXO SHUIRUPDQFH RI WKH &RQWUDFW DQG SD\PHQW RI REOLJDWLRQVDULVLQJWKHUHXQGHUDVVWLSXODWHGLQELGGLQJUHTXLUHPHQWVRUVSHFLILFDOO\UHTXLUHGLQWKH'HVLJQ%XLOG 'RFXPHQWVRQWKHGDWHRIH[HFXWLRQRIWKH&RQWUDFW6XFKERQGVVKDOOEHLVVXHGLQDQDPRXQWHTXDOWRWKHWRWDO&RQWUDFW 6XPE\DVXUHW\FRPSDQ\OLFHQVHGLQWKHVWDWHZKHUHWKH3URMHFWLVORFDWHGZLWKDFXUUHQW$0%HVWUDWLQJRIDWOHDVW $;LQFOXGHGRQWKH867UHDVXU\'HSDUWPHQW¶VOLVWLQJRIDSSURYHGVXUHWLHVDQGDFFHSWDEOHWRWKH2ZQHURUDV H[SUHVVO\DJUHHGRWKHUZLVHE\WKH2ZQHULQZULWLQJ .1([FHSWDVRWKHUZLVHUHTXLUHGE\VWDWXWHWKHIRUPDQGVXEVWDQFHRIVXFKERQGVVKDOOEHVDWLVIDFWRU\WRWKH 2ZQHULQWKH2ZQHU VVROHMXGJPHQWDQGVKDOOVDWLVI\WKHUHTXLUHPHQWV7H[DV*RYHUQPHQW&RGH&KDSWHUV DQG .27KH3HUIRUPDQFH%RQGDQGWKH/DERUDQG0DWHULDO3D\PHQW%RQGVKDOOHDFKEHLQDQDPRXQWHTXDOWRWKH &RQWUDFW6XPDQGDOOVXEVHTXHQWLQFUHDVHV .3(YHU\%RQGXQGHUWKLV6HFWLRQ%PXVWGLVSOD\WKH6XUHW\ V%RQG1XPEHUDQGDULGHULQFOXGLQJWKH IROORZLQJSURYLVLRQVZKLFKVKDOOEHDWWDFKHGWRHDFK%RQG a.7KH 6XUHW\ KHUHE\ DJUHHV WKDW LWFRQVHQWV WR DQG ZDLYHV QRWLFHRI DQ\ DGGLWLRQ DOWHUDWLRQ RPLVVLRQFKDQJHRURWKHUPRGLILFDWLRQRIWKH'HVLJQ%XLOG'RFXPHQWV b.$Q\DGGLWLRQDOWHUDWLRQFKDQJHH[WHQVLRQRIWLPHRURWKHUPRGLILFDWLRQRIWKH'HVLJQ%XLOG 'RFXPHQWVRUDIRUEHDUDQFHRQWKHSDUWRIHLWKHUWKH2ZQHURUWKH'HVLJQ%XLOGHUWRWKHRWKHU VKDOOQRWUHOHDVHWKH6XUHW\RILWVREOLJDWLRQVKHUHXQGHUDQGQRWLFHWRWKH6XUHW\RIVXFKPDWWHUV LVKHUHE\ZDLYHGDQG c.7KH6XUHW\DJUHHVWKDWLWLVREOLJDWHGXQGHUWKHERQGVWRDQ\VXFFHVVRUJUDQWHHRUDVVLJQHHRIWKH 2ZQHU § B.4.28SRQWKHUHTXHVWRIDQ\SHUVRQRUHQWLW\DSSHDULQJWREHDSRWHQWLDOEHQHILFLDU\RIERQGVFRYHULQJSD\PHQWRI REOLJDWLRQVDULVLQJXQGHUWKH&RQWUDFWWKH'HVLJQ%XLOGHUVKDOOSURPSWO\IXUQLVKDFRS\RIWKHERQGVRUVKDOODXWKRUL]H DFRS\WREHIXUQLVKHG § B.4.3 7KH%RQG)RUPVKDOOEH3HUIRUPDQFH%RQG$,$'RFXPHQW$(GLWLRQSDJHVRQHWKURXJKIRXU WRJHWKHUZLWK³3D\PHQW%RQG´$,$'RFXPHQW$(GLWLRQSDJHVRQHWKURXJKIRXU § B.4.4$GGLWLRQDO3HUIRUPDQFHDQG3D\PHQW%RQGVPD\EHUHTXLUHGE\WKH2ZQHUDWWKH2ZQHU¶VVROHGLVFUHWLRQ IURPDQ\6XEFRQWUDFWRU7KH2ZQHUZLOOSD\VXFKDFWXDODGGLWLRQDOH[SHQGLWXUHVDV&RVWRIWKH:RUNXVLQJWKH SURFHVVVSHFLILHGLQ$UWLFOHRIWKH$JUHHPHQWIRU&KDQJHVLQWKH:RUN$OOVXFKERQGVVKDOOEHLQIRUPDQGVXEVWDQFH VDWLVIDFWRU\WRWKH2ZQHU § B.4.57KH'HVLJQ%XLOGHUVKDOOGHOLYHUWKHUHTXLUHGERQGVWRWKH2ZQHUQRODWHUWKDQWKUHHEXVLQHVVGD\V IROORZLQJWKHGDWHRIWKH$JUHHPHQWLVHQWHUHGLQWRRULIWKH:RUNLVWREHFRPPHQFHGSULRUWRWKHGDWHWKH$JUHHPHQW LVHQWHUHGLQWRLQUHVSRQVHWRDQRWLILFDWLRQRIDZDUG7KH'HVLJQ%XLOGHUVKDOOSULRUWRWKHFRPPHQFHPHQWRIWKH :RUNVXEPLWHYLGHQFHVDWLVIDFWRU\WRWKH2ZQHUWKDWVXFKERQGVZLOOEHIXUQLVKHG § B.4.67KH'HVLJQ%XLOGHUVKDOOUHTXLUHWKHDWWRUQH\LQIDFWZKRH[HFXWHVWKHUHTXLUHGERQGRQEHKDOIRIWKHVXUHW\ WRDIIL[WKHUHWRDFHUWLILHGDQGFXUUHQWFRS\RIWKHSRZHURIDWWRUQH\ § B.5 Adjustment and Settlement of Insured Loss 3ULRUWRVHWWOHPHQWRIDQLQVXUHGORVVWKH2ZQHUVKDOOQRWLI\WKH'HVLJQ%XLOGHURIWKHWHUPVRIWKHSURSRVHG VHWWOHPHQWDVZHOODVWKHSURSRVHGDOORFDWLRQRIWKHLQVXUDQFHSURFHHGV7KH'HVLJQ%XLOGHUVKDOOKDYHIRXUWHHQ GD\VIURPUHFHLSWRIQRWLFHWRREMHFWWRWKHSURSRVHGVHWWOHPHQWRUDOORFDWLRQRIWKHSURFHHGV,IWKH'HVLJQ%XLOGHU GRHVQRWREMHFWWKH2ZQHUVKDOOVHWWOHWKHORVVDQGWKH'HVLJQ%XLOGHUVKDOOEHERXQGE\WKHVHWWOHPHQWDQG DOORFDWLRQ8SRQUHFHLSWWKH2ZQHUVKDOOGHSRVLWWKHLQVXUDQFHSURFHHGVLQDVHSDUDWHDFFRXQWDQGPDNHWKH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH DSSURSULDWHGLVWULEXWLRQV7KHUHDIWHULIQRRWKHUDJUHHPHQWLVPDGHRUWKH2ZQHUGRHVQRWWHUPLQDWHWKH&RQWUDFWIRU FRQYHQLHQFHWKH2ZQHUDQG'HVLJQ%XLOGHUVKDOOH[HFXWHD&KDQJH2UGHUIRUUHFRQVWUXFWLRQRIWKHGDPDJHGRU GHVWUR\HG:RUNLQWKHDPRXQWDOORFDWHGIRUWKDWSXUSRVH,IWKH'HVLJQ%XLOGHUWLPHO\REMHFWVWRHLWKHUWKHWHUPVRI WKHSURSRVHGVHWWOHPHQWRUWKHDOORFDWLRQRIWKHSURFHHGVWKH2ZQHUPD\SURFHHGWRVHWWOHWKHLQVXUHGORVVDQGDQ\ GLVSXWHEHWZHHQWKH2ZQHUDQG'HVLJQ%XLOGHUDULVLQJRXWRIWKHVHWWOHPHQWRUDOORFDWLRQRIWKHSURFHHGVVKDOOEH UHVROYHGSXUVXDQWWR$UWLFOHRIWKH$JUHHPHQW3HQGLQJUHVROXWLRQRIDQ\GLVSXWHWKH2ZQHUPD\LVVXHD &RQVWUXFWLRQ&KDQJH'LUHFWLYHIRUWKHUHFRQVWUXFWLRQRIWKHGDPDJHGRUGHVWUR\HG:RUN § B.6 Insurance Companies $OOLQVXUDQFHFRYHUDJHSURFXUHGE\WKH'HVLJQ%XLOGHUVKDOOEHSURYLGHGE\LQVXUDQFHFRPSDQLHVKDYLQJFXUUHQW SROLF\KROGHUUDWLQJVQRORZHUWKDQ³$;´E\$0%HVWDQGDFFHSWDEOHE\WKH2ZQHURUDVH[SUHVVO\DJUHHGRWKHUZLVH E\WKH2ZQHULQZULWLQJ6XFKFRPSDQLHVPXVWEHOLFHQVHGWRGREXVLQHVVLQWKH6WDWHRI7H[DV § B.7 Failure to Purchase Insurance ,IRQHRUPRUHRIWKH,QGHPQLWHHVRUWKH'HVLJQ%XLOGHULVGDPDJHGE\WKHIDLOXUHRIHLWKHUWKH2ZQHURUWKH'HVLJQ %XLOGHUWRSXUFKDVHRUPDLQWDLQWKHLQVXUDQFHUHTXLUHGXQGHUWKLV([KLELW³%´WKHQWKHSDUW\ZKRIDLOHGWRSXUFKDVH RUPDLQWDLQWKHLQVXUDQFHVKDOOEHDUDOOUHDVRQDEOHFRVWVLQFOXGLQJDWWRUQH\V¶IHHVDQGFRXUWDQGVHWWOHPHQWH[SHQVHV SURSHUO\DWWULEXWDEOHWRWKHIDLOXUH § B.8 Insurance Limits Required § B.8.1 7KHIROORZLQJLQVXUDQFHOLPLWVDUHWKHPLQLPXPVWREHFDUULHGE\WKH2ZQHU¶VRWKHUFRQVXOWDQWVWKH'HVLJQ %XLOGHUDQGWKH6XEFRQWUDFWRUVVXEVXEFRQWUDFWRUVDQGVXSSOLHUVXQOHVVKLJKHUOLPLWVDUHUHTXLUHGE\WKHLUUHVSHFWLYH $JUHHPHQWVRU7H[DVODZLQZKLFKFDVHWKRVHOLPLWVVKDOOFRQWURO $XWRPRELOH/LDELOLW\ &RPELQHG6LQJOH/LPLW &RPPHUFLDO*HQHUDO/LDELOLW\ 3HU2FFXUUHQFH *HQHUDO$JJUHJDWH 3URGXFWV&RPSOHWHG2SHUDWLRQV$JJUHJDWH 3HUVRQDODQG$GYHUWLVLQJ,QMXU\ )LUH'DPDJH 0HGLFDO3D\PHQWV 3URIHVVLRQDO(UURUV 2PLVVLRQV/LDELOLW\ $PRXQWHTXDOWRWKH&RQWUDFW6XPDQGDOOVXEVHTXHQWLQFUHDVHV 2FFXUUHQFH $JJUHJDWH0LQLPXP 2FFXUUHQFH $JJUHJDWH0D[LPXP :RUNHUV¶&RPSHQVDWLRQ 6WDWXWRU\/LPLWV (PSOR\HUV/LDELOLW\ 8PEUHOODRU([FHVV/LDELOLW\ 2FFXUUHQFH $JJUHJDWH0D[LPXP 2FFXUUHQFH $JJUHJDWH0D[LPXPIRU6XE'HVLJQ%XLOGHUV 'HVLJQ%XLOGHU¶V3ROOXWLRQFRYHUDJH 2FFXUUHQFHRU&ODLP 3ROLF\$JJUHJDWH %XLOGHU¶V5LVNZKHUHDSSOLFDEOH RIWKHWRWDOYDOXHRIWKHZRUN DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $OOULJKWVUHVHUYHGE\3HDN3URJUDP9DOXH//& $([KLELW%,QVXUDQFHWR7HDP3DJH § B.8.2 /LPLWVIRUSULPDU\SROLFLHVPD\GLIIHUIURPWKRVHVKRZQZKHQ8PEUHOODRU([FHVV/LDELOLW\LQVXUDQFHLV SURYLGHGDVORQJDVDOOFRYHUDJHLVHTXDOWRRUJUHDWHUWKDQWKHPLQLPXPOLPLWVUHTXLUHGKHUHLQ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW&±3URMHFW0DQDJHPHQW3URFHVV 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E WƌŽũĞĐƚĞƐŝŐŶĂŶĚŽŶƐƚƌƵĐƚŝŽŶƌŝƚĞƌŝĂ /ŶĚĞǆ EŽǀĞŵďĞƌϲ͘ϮϬϭϵ y,//d /͘^ƉĂĐĞWƌŽŐƌĂŵ //͘WůĂŶƐ Ă͘ WƌŽƉŽƐĞĚ^ŝƚĞWůĂŶ ď͘ ^ŚĞůů&ůŽŽƌWůĂŶǁŝƚŚĨŝǆĞĚĞůĞŵĞŶƚƐʹƉƌĞĨĞƌƌĞĚƚŽƌĞŵĂŝŶŝŶƉůĂĐĞ͘ ///͘ŽŶƐƚƌƵĐƚŝŽŶĂŶĚŶŐŝŶĞĞƌŝŶŐZĞƋƵŝƌĞŵĞŶƚƐ /s͘ŝƚǇŽĨĞŶƚŽŶd^ůŽƐĞƚ'ƵŝĚĞůŝŶĞƐ;ǁŝƚŚƌŽŽŵĞǆĂŵƉůĞƐͿ s͘ƌĐŚŝƚĞĐƚʹŶŐŝŶĞĞƌ^ĞƌǀŝĐĞƐĂŶĚZĞƋƵŝƌĞŵĞŶƚƐ City of Denton's Development Services Building AIA A141 Owner-Consultant Agreement Exhibit D - Design Criteria DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E y,//d/s>KWDEd&/>/d/^h/>/E'^WZYh/ZDEd^ƉƉƌŽǆŝŵĂƚĞƵŝůĚŝŶŐ'ƌŽƐƐƌĞĂϮϴ͕ϬϬϬƐƋƵĂƌĞĨĞĞƚƉƉƌŽǆŝŵĂƚĞƵŝĚŝŶŐhƐĞĂďůĞƌĞĂϮϳ͕ϭϵϱƐƋƵĂƌĞĨĞĞƚ^h'ZKhW/E'^^ƚĂĨĨŽƵŶƚ ^ƋƵĂƌĞ&ĞĞƚ ^ƉĂĐĞ ^ƉĂĐĞdǇƉĞEŽƚĞƐƉĞƌ^ƉĂĐĞ ^ƵďdŽƚĂůƐ tĂůůƐ &ůŽŽƌ ĂƐĞ ĞŝůŝŶŐĞƉĂƌƚŵĞŶƚŝƌĞĐƚŽƌϮ ϭϲϬ ϯϮϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂŽƚŚƐƉĂĐĞƐƚŽďĞĂĚũĂĐĞŶƚƚŽŽŶĞĂŶŽƚŚĞƌĞƉĂƌƚŵĞŶƚĞƉƵƚǇŝƌĞĐƚŽƌϮ ϭϮϬ ϮϰϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂDĂŶĂŐĞƌϭ ϭϮϬ ϭϮϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĞǀĞůŽƉŵĞŶƚ&ĂĐŝůŝƚĂƚŽƌϮ ϭϬϬ ϮϬϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂŶŐŝŶĞĞƌŝŶŐ&ĂĐŝůŝƚĂƚŽƌϯ ϭϬϬ ϯϬϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂh^dKDZ^Zs/ƵƐƚŽŵĞƌ^ĞƌǀŝĐĞZĞƉƌĞƐĞŶƚĂƚŝǀĞƐϵ ϭϬϬ ϵϬϬ KƉĞŶKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĚŵŝŶŝƐƚƌĂƚŝǀĞƐƐŝƐƚĂŶƚƐϰ ϭϬϬ ϰϬϬ KƉĞŶKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂs>KWDEd^Zs/^WůĂŶŶŝŶŐ ƵƐŝŶĞƐƐŶĂůǇƐƚϭ ϵϬ ϵϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƌŝŶĐŝƉĂůWůĂŶŶĞƌϮ ϭϬϬ ϮϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^ĞŶŝŽƌWůĂŶŶĞƌϰ ϭϬϬ ϰϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂƐƐŝƐƚĂŶƚWůĂŶŶĞƌϮ ϭϬϬ ϮϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ'͘/͘^͘ŐƌŽƵƉϯ ϵϬ ϮϳϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWůĂŶŶĞƌͲZĞĂůƐƚĂƚĞϭ ϭϬϬ ϭϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWůĂŶŶŝŶŐdĞĐŚŶŝĐŝĂŶƐϰ ϵϬ ϯϲϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂƵŝůĚŝŶŐ/ŶƐƉĞĐƚŝŽŶƐ ƵŝůĚŝŶŐKĨĨŝĐŝĂůϭ ϭϲϬ ϭϲϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĞƉƵƚǇƵŝůĚŝŶŐKĨĨŝĐŝĂůϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWůĂŶƐǆĂŵŝŶĞƌϲ ϲϱ ϯϵϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĞƉƵƚǇƵŝůĚŝŶŐKĨĨŝĐŝĂůϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂƵŝůĚŝŶŐ/ŶƐƉĞĐƚŽƌƐϭϭ ϲϱ ϳϭϱKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐ ĂƌƉĞƚdŝůĞĂƐƌĞƋƵŝƌĞĚнϮĂƚĂŽŶŝŶŐŽŵƉůŝĂŶĐĞϮ ϲϱ ϭϯϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ,ĞĂůƚŚ DĂŶĂŐĞƌϭ ϭϬϬ ϭϬϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ,ĞĂůƚŚ/ŶƐƉĞĐƚŽƌƐϯ ϲϱ ϭϵϱKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^ƵďͲdŽƚĂůƐ ϲϲ ϲ͕ϬϯϬE'/EZ/E'ŶŐŝŶĞĞƌŝƌĞĐƚŽƌWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ^ĞĞĞƉĂƌƚŵĞŶƚŝƌĞĐƚŽƌĂďŽǀĞĞƉƵƚǇŝƌĞĐƚŽƌϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƵďůŝĐtŽƌŬƐ/ŶƐƉĞĐƚŽƌƐ Wt/DĂŶĂŐĞƌϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWt/^ƵƉĞƌǀŝƐŽƌƐϮ ϭϬϬ ϮϬϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWt/^ƚĂĨĨϭϮ ϲϱ ϳϴϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂdƌĂĨĨŝĐ ŝƚǇdƌĂĨĨŝĐŶŐŝŶĞĞƌϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂdƌĂĨĨŝĐDĂŶĂŐĞƌϭ ϭϬϬ ϭϬϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂdƌĂĨĨŝĐ^ƚĂĨĨϴ ϲϱ ϱϮϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂŶŐŝŶĞĞƌŝŶŐ^ĞƌǀŝĐĞƐ ŶŐŝŶĞĞƌDĂŶĂŐĞƌϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ&ůŽŽĚWůĂŝŶͬƌĂŝŶĂŐĞŶŐŝŶĞĞƌϭ ϭϬϬ ϭϬϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĞǀĞůŽƉŵĞŶƚ ĞƉƵƚǇŝƌĞĐƚŽƌϭ ϭϮϬ ϭϮϬWƌŝǀĂƚĞKĨĨŝĐĞWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂĞǀĞůŽƉŵĞŶƚ^ƚĂĨĨϱ ϲϱ ϯϮϱKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƌŽũĞĐƚDĂŶĂŐĞŵĞŶƚKĨĨŝĐĞͬƵƐŝŶĞƐƐ^ƵƉƉŽƌƚWDKĞƉƵƚǇŝƌĞĐƚŽƌ ϭ ϭϮϬ ϭϮϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWDKDĂŶĂŐĞƌϭ ϭϬϬ ϭϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWDK^ƚĂĨĨϲ ϲϱ ϯϵϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂZĞĂůƐƚĂƚĞ ĞƉƵƚǇŝƌĞĐƚŽƌϭ ϭϮϬ ϭϮϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂZĞĂůƐƚĂƚĞ^ƚĂĨĨϳ ϲϱ ϰϱϱKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƌŽũĞĐƚĞůŝǀĞƌǇ ƐƐŝƐƚĂŶƚŝƚǇŶŐŝŶĞĞƌϭ ϭϮϬ ϭϮϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƌŽũĞĐƚDĂŶĂŐĞƌƐϮ ϭϬϬ ϮϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂWƌŽũĞĐƚĞǀůŝĞƌǇ^ƚĂĨĨϲ ϲϱ ϯϵϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐĂƌƉĞƚdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^hdKd> ϱϵ ϰ͕ϱϮϬ&/Z/E^Wd/KEDĂŶĂŐĞƌ ϭ ϭϬϬ ϭϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ&ŝƌĞ/ŶƐƉĞĐƚŽƌƐϭϬ ϲϱ ϲϱϬKĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐWĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^hdKd> ϭϭ ϳϱϬDĂŶĂŐĞƌ ϭ ϭϬϬ ϭϬϬ WƌŝǀĂƚĞKĨĨŝĐĞ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^ƚĂĨĨ ϭϭ ϲϱ ϳϭϱ KĨĨŝĐĞƐǇƐƚĞŵĐƵďŝĐůĞƐ ĂƌƉĞƚdŝůĞ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂ^hdKd> ϭϭ ϴϭϱKDDhE/dz/DWZKsDEd^Zs/^ZŽŽŵ&ŝŶŝƐŚůĞĐƚƌŝĐĂůZĞƋƵŝƌĞŵĞŶƚƐ&͗Ͱϭ;ͿEd&^ͰϬϬϬϬϬϬͰϬϬϬϬͲŝƚǇŽĨĞŶƚŽŶͰϬϬϬͲĞƐŝŐŶƵŝůĚͰWƌŽŐƌĂŵ^ĐŽƉĞͰĂǇďƌĞĂŬ^ƉĂĐĞWƌŽŐƌĂŵ͘ǆůƐǆ ϭŽĨϮϭϬͬϯϭͬϮϬϭϵDocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E y,//d/s>KWDEd&/>/d/^h/>/E'^WZYh/ZDEd^^h'ZKhW/E'^^ƚĂĨĨŽƵŶƚ ^ƋƵĂƌĞ&ĞĞƚ ^ƉĂĐĞ ^ƉĂĐĞdǇƉĞEŽƚĞƐƉĞƌ^ƉĂĐĞ ^ƵďdŽƚĂůƐ tĂůůƐ &ůŽŽƌ ĂƐĞ ĞŝůŝŶŐZŽŽŵ&ŝŶŝƐŚůĞĐƚƌŝĐĂůZĞƋƵŝƌĞŵĞŶƚƐdKd>^d&&KhEdϭϰϳ^hdKd>ZZYh/ZDEdϭϮ͕ϭϭϱ^hWWKZd^W^>ŽďďǇͬZĞĐĞƉƚŝŽŶƌĞĂ Ϯ͕ϬϬϬ͘ϬϬ Ϯ͕ϬϬϬ͘ϬϬ KƉĞŶƌĞĂ WĂŝŶƚ ĂƌƉĞƚdŝůĞZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ĂƐƌĞƋƵŝƌĞĚнϮĂƚĂƵƐƚŽŵĞƌĐŽƵŶƚĞƌǁŝƚŚƐƉĂĐĞĨŽƌϲĂƚƚĞŶĚĞŶƚƐ^ŵĂůůĞƌŐƌŽƵƉŵĞĞƚŝŶŐĂƌĞĂƐͲƚŽĂĐĐŽŵŵŽĚĂƚĞϰͲϲƉĞŽƉůĞ͕ŶŝĐŚĞƐŽĨĨůŽďďǇ<ŝŽƐŬƐdƌĂŝŶŝŶŐͬůĂƐƐZŽŽŵ;ϭϬϬŽĐĐƵƉĂŶƚƐͿǁͬĂĚũĂĐĞŶƚƐŵĂůůƌĞĂŬZŽŽŵϭ͕ϲϬϬ ϭ͕ϲϬϬ ZŽŽŵ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞWƌŽǀŝƐŝŽŶĨŽƌƐŵĂƌƚďŽĂƌĚƐ͕ƌĞĐĞƉƚĂĐůĞƐĂƐƌĞƋƵŝƌĞĚнϰĂƚĂůƵƐƚĞƌŵĞĞƚŝŶŐƐƉĂĐĞƐWůĂŶͲdŽƵĐŚ^ĐƌĞĞŶdĂďůĞƐ^ŵĂůůĂĚũĂĐĞŶƚƌĞĂŬZŽŽŵŝŶĐůƵĚĞĚŝŶƐ͘Ĩ͘ƌĞƋƵŝƌĞŵĞŶƚDĞĞƚŝŶŐZŽŽŵ;ϭϱŽĐĐƵƉĂŶƚƐͿϰZĞƋƵŝƌĞĚϮϱϬ ϭϬϬϬ ZŽŽŵ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞWƌŽǀŝƐŝŽŶĨŽƌƐŵĂƌƚďŽĂƌĚƐ͕ƌĞĐĞƉƚĂĐůĞƐĂƐƌĞƋƵŝƌĞĚнϮĂƚĂůƵƐƚĞƌŵĞĞƚŝŶŐƐƉĂĐĞƐWůĂŶͲdŽƵĐŚ^ĐƌĞĞŶdĂďůĞƐdĞĂŵƌĞĂƐ;ϴͿ ϲϱ ϱϮϬ KƉĞŶKĨĨŝĐĞ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞƐƌĞƋƵŝƌĞĚнϮĂƚĂ ϰƉĞƌƐŽŶĐĂƉĂĐŝƚǇͲǀĂƌŝŽƵƐůŽĐĂƚŝŽŶƐǁͬĚĞƉĂƌƚŵĞŶƚƐƌĞĂŬZŽŽŵ;ϭͿϮϬϬ ϮϬϬ ŶĐůŽƐĞĚ^ƉĂĐĞ WĂŝŶƚ sd ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ƐƌĞƋƵŝƌĞĚнϮĂƚĂWůŽƚƚĞƌƌĞĂ;ϭͿ ϮϬϬ ϮϬϬ ZŽŽŵ WĂŝŶƚ sd ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞǆŚĂƵƐƚ&ĂŶ͕ůĞĐƚƌŝĐĂůƌĞĐĞƉƚĂĐůĞƐĂƐƌĞƋƵŝƌĞĚнϰĂƚĂdŽŝůĞƚZŽŽŵ;ϮZĞƋƵŝƌĞĚͿϯǁĂƚĞƌĐůŽƐĞƚƐͬϮǁĂƐŚďĂƐŝŶƐĞĂĐŚϮϬϬ ϰϬϬ^ĞƉĂƌĂƚĞDĞŶΖƐĂŶĚtŽŵĞŶĨĂĐŝůŝƚŝĞƐ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ƐƌĞƋƵŝƌĞĚͻƵŝůĚŽǀĞƌĞǆŝƐƚŝŶŐƚŽŝůĞƚƐĂŶĚƌĞƵƐĞƵŶĚĞƌƐůĂďƉůƵŵďŝŶŐͻĞƌĂŵŝĐŇŽŽƌĂŶĚǁĂůůƟůĞŝƐĞŶĐŽƵƌĂŐĞĚ͘hƐĞŵĞĚŝƵŵƚŽĚĂƌŬŐƌŽƵƚŽŶĨůŽŽƌ͘tŚŝƚĞŐƌŽƵƚŝƐĂĐĐĞƉƚĂďůĞ͕ďƵƚŶŽƚƌĞƋƵŝƌĞĚ͕ŽŶǁĂůůƐ͘ͻϮǆϰůĂǇŝŶĐĞŝůŝŶŐƐĂƌĞĂĐĐĞƉƚĂďůĞ͘ͻƵƚŽŵĂƟĐŇƵƐŚĚĞǀŝĐĞƐĂƌĞĞŶĐŽƵƌĂŐĞĚ͘ͻDŽƟŽŶĐŽŶƚƌŽůůĞĚƐŝŶŬĨĂƵĐĞƚƐĂƌĞĞŶĐŽƵƌĂŐĞĚ͘ĂƩĞƌǇƉŽǁĞƌ͘ͻDŽƟŽŶĐŽŶƚƌŽůůĞĚůŝŐŚƚƐĂƌĞĞŶĐŽƵƌĂŐĞĚ͘ͻ^ĂŶŝƚĂƌǇŶĂƉŬŝŶĚŝƐƉĞŶƐĞƌƐǁŝůůŶŽƚďĞƵƐĞĚ͕ďƵƚĚŝƐƉŽƐĂůďŝŶƐǁŝůů͘ͻĂŐƚǇƉĞƐŽĂƉĚŝƐƉĞŶƐĞƌƐĂƌĞĞŶĐŽƵƌĂŐĞĚ͘ͻ&ůŽŽƌŵŽƵŶƚƚŽŝůĞƚƐͻWĂƌƟƟŽŶƐďĞƚǁĞĞŶƵƌŝŶĂůƐ͘ͻ&ůŽŽƌͲŵŽƵŶƚƚŽŝůĞƚƉĂƌƟƟŽŶƐ͘ͻWĂƌƟƟŽŶƐƐŚŽƵůĚƐĐƌĂƚĐŚĂŶĚŐƌĂĸƟƌĞƐŝƐƚĂŶƚƚŽĚŝƐĐŽƵƌĂŐĞǀĂŶĚĂůŝƐŵ͘ͻEKd͗>ĂƌŐĞďƵŝůĚŝŶŐƐƐŚŽƵůĚŚĂǀĞĂƐŝŶŐůĞƉĂŝƌŽĨƌĞƐƚƌŽŽŵƐƌĂƚŚĞƌƚŚĂŶĚŝƐƉĞƌƐĞĚƉĂŝƌƐ͘/ĨƚŚĞƐƉĂĐĞŝƐĂǀĂŝůĂďůĞĨŽƌǀŝƐŝŽŶďůŽĐŬŝŶŐǀĞƐƚŝďƵůĞƐ͕ƚŚĞƌĞƐƚƌŽŽŵƐƐŚŽƵůĚďĞĚŽŽƌůĞƐƐ͘/ĨŵƵůƚŝŽĐĐƵƉĂŶƚƌĞƐƚƌŽŽŵƐŚĂǀĞĚŽŽƌƐ͕ƚŚĞǇǁŝůůŚĂǀĞŚĂŶĚůĞƐĂŶĚƉƵƐŚƉůĂƚĞƐŽŶůǇ͘dŽŝůĞƚ;ϭͿϴϬ ϴϬ hŶŝƐĞǆ ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ^ĞĞŶŽƚĞƐ ƐƌĞƋƵŝƌĞĚ^ĞĞEŽƚĞƐĂďŽǀĞ^ƚŽƌĂŐĞϮϬϬ ϱϬϬ ZŽŽŵ WĂŝŶƚ sd ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ƐƌĞƋƵŝƌĞĚƐŶĞĞĚĞĚ͘KŶĞůĂƌŐĞŽƌƐĞƉĂƌĂƚĞƐƉƌĞĂĚĂƉĂƌƚŝŶĚŝǀŝĚƵĂůƐƉĂĐĞƐĂŵŽŶŐĚĞƉĂƌƚŵĞŶƚƐdĞĐŚŶŽůŽŐǇ^ĞƌǀŝĐĞƐůŽƐĞƚϭϬϬ ϭϬϬ ZŽŽŵ WĂŝŶƚsdŽƌ^ĞĂůĞĚŽŶĐƌĞƚĞZƵďďĞƌ KƉĞŶĂďŽǀĞ &ŽƵƌƌĞĐĞƉƚĂĐůĞƐнƋƵŝƉŵĞŶƚďǇ͘K͘͘ͲĂůůŽǁĨŽƌŽŶĞϭϬΖǆϭϬΖƐƉĂĐĞ͘^ĞĞĂůƐŽǆŚŝďŝƚ:ĂŶŝƚŽƌΖƐůŽƐĞƚϳϬ ϳϬ ZŽŽŵ WĂŝŶƚsdŽƌ^ĞĂůĞĚŽŶĐƌĞƚĞZƵďďĞƌ 'ǇƉ͘Ě͘ ƐƌĞƋƵŝƌĞĚ:ĂŶŝƚŽƌΖƐƐŝŶŬ͕ŵŽƉƌĂĐŬĂŶĚǁĂůůŵŽƵŶƚĞƌƐŚĞůǀŝŶŐŝƌĐƵůĂƚŝŽŶ^ƉĂĐĞϰ͕ϱϬϬ ϰ͕ϱϬϬ Ͳ WĂŝŶƚ ĂƌƉĞƚdŝůĞ ZƵďďĞƌ ĐŽƵƐƚŝĐĂůdŝůĞ ƐƌĞƋƵŝƌĞĚ,ŽƵƐĞŬĞĞƉŝŶŐƌĞĐĞƉƚĂĐůĞƐĂƐƌĞƋƵŝƌĞĚ͘ǆŝƐƚŝŶŐůĞĐƚƌŝĐĂůͬDĞĐŚĂŶŝĐĂů^ƉĂĐĞϰϱϬ ϰϱϬ ZŽŽŵ WĂŝŶƚsdŽƌ^ĞĂůĞĚŽŶĐƌĞƚĞZƵďďĞƌ KƉĞŶĂďŽǀĞ ƐƌĞƋƵŝƌĞĚǆŝƐƚŝŶŐ^ƉĂĐĞƐĂƐƉĞƌƉůĂŶ͘^hdKd>ZZYh/ZDEdϭϭ͕ϲϮϬdKd>dEEd&/E/^,KhdZZYh/ZDEdϮϯ͕ϳϯϱZD/E/E'^,>>Zϯ͕ϰϲϬ&͗Ͱϭ;ͿEd&^ͰϬϬϬϬϬϬͰϬϬϬϬͲŝƚǇŽĨĞŶƚŽŶͰϬϬϬͲĞƐŝŐŶƵŝůĚͰWƌŽŐƌĂŵ^ĐŽƉĞͰĂǇďƌĞĂŬ^ƉĂĐĞWƌŽŐƌĂŵ͘ǆůƐǆ ϮŽĨϮϭϬͬϯϭͬϮϬϭϵDocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV y,//d//ĂʹWZKWK^^/dW>E EŽƚƚŽ^ĐĂůĞ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E 14 13 12 9 A 1 RISER 1.1 ELEC/MECH 15 11 10 T.S. CLOS. EXHIBIT IIb - General Shell Floor Plan LOCATION OF TS CLOSET IS NOT SET EXISTING TOILET LOCATION EXISITNG TRUCK DOCKS TO BE REMOVED - INFILL WALL TO MATCH ADJACENT EXTERIOR WALL SURFACES EXTERIOR DESIGN EMPHASIS AROUND MAIN BUILDING ENTRY PREFERRED NOT TO SCALE DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH ([KLELW,,, (QJLQHHULQJDQG&RQVWUXFWLRQ5HTXLUHPHQWV *(1(5$/5(48,5(0(176 7KHUHTXLUHPHQWVLQGLFDWHGKHUHDUHFRQVLGHUHGDVPLQLPXPSHUIRUPDQFHUHTXLUHPHQWV0RUHVSHFLILF SURMHFW IXQFWLRQDO DQG SHUIRUPDQFH UHTXLUHPHQWV VFRSH LWHPV DQG H[SHFWHG TXDOLW\ OHYHOV RYHU DQG DERYHWKHVWDQGDUGVLQ3DUW9DUHDOVRLGHQWLILHGLQ5HTXHVWIRU3URSRVDORU%DVLF2UGHULQJ$JUHHPHQW 7KH &RQWUDFWRU LV HQFRXUDJHG WR H[FHHG WKH PLQLPXP UHTXLUHPHQWV 7KH &RQWUDFWRU V SHUIRUPDQFH HYDOXDWLRQZLOOEHEDVHGLQSDUWRQHQKDQFHPHQWVWRPDWHULDOVHQJLQHHULQJGHVLJQDQGFRQVWUXFWLRQ SURYLGHGIRUWKHFRQWUDFWWKDWH[FHHGPLQLPXPUHTXLUHPHQWV 3DUW9LVDJHQHUDOVHFWLRQ1RWDOOLWHPVLQWKLVSDUWPD\EHUHTXLUHGIRUWKLVSURMHFW6HHRWKHUSDUWVIRU RWKHUSURMHFWVSHFLILFUHTXLUHPHQWV ,QJHQHUDOXQOHVVRWKHUZLVHLQGLFDWHGSURYLGHDOOODERUHTXLSPHQWDQGPDWHULDOVQHFHVVDU\WRFRPSOHWH WKHZRUNUHTXLUHGIRUWKHFRQWUDFW$OOZRUNPXVWEHLQFRQIRUPDQFHZLWKDOODSSOLFDEOHUHIHUHQFHGFULWHULD FRQVWUXFWLRQVWDQGDUGVODZVDQGUHJXODWLRQVLQFOXGLQJDSSOLFDEOHEXLOGLQJILUHDQGOLIHVDIHW\FRGHV /LPLWHG HQKDQFHPHQWV WR WKH H[WHULRU RI WKLV EXLOGLQJ ZLOO EH FRQVLGHUHG 7KLV VKRXOG EH IRFXVHG SULPDULO\RQWKHIURQWHQWUDQFHDQGDGMDFHQWH[WHULRUZDOOVXUIDFHV $SSOLFDWLRQRI5HF\FOHG0DWHULDOV&RQVLGHUDWLRQV 7KHLQWHQWLVWRFRQVHUYHUHVRXUFHVDQGUHGXFHVROLGZDVWHE\GHYHORSLQJPDUNHWVIRUUHF\FOHGSURGXFWV DQGHQFRXUDJLQJPDQXIDFWXUHUVWRSURGXFHTXDOLW\UHF\FOHGFRQWHQWSURGXFWV8VHSURGXFWVWKDWPHHW RUH[FHHGWKH(3$JXLGHOLQHVWDQGDUGV$SDUWLDOOLVWRISURGXFWVFRQWDLQLQJUHF\FOHGPDWHULDOVIRU SRVVLEOHXVHLVDVIROORZV 5RFN:RRO,QVXODWLRQ )LEHUJODVV,QVXODWLRQ &HOOXORVH,QVXODWLRQ 6WUXFWXUDO)LEHUERDUGDQG/DPLQDWHG3DSHUERDUG &HPHQWDQG&RQFUHWH&RDO)O\$VK &DUSHWLQFOXGLQJEDFNLQJVDQGFXVKLRQV )ORRU7LOHV 5HSURFHVVHGDQG&RQVROLGDWHG/DWH[3DLQW &UXVKHG&RQFUHWH$JJUHJDWHIRUQHZDVSKDOWFRQFUHWHRUVXEJUDGH 5HF\FOHGJODVVIRUWHUUD]]RDJJUHJDWH $FRXVWLFDO&HLOLQJ7LOH *\SVXP:DOOERDUG 6WHHOZDOOVWXGV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH &HOOXORVHVSUD\DSSOLHGILUHSURRILQJ +'3(7RLOHW3DUWLWLRQV 0$7(5,$/6$1'0(7+2'62)&216758&7,21 2QO\ QHZ PDWHULDOV DQG HTXLSPHQW DUH WR EH LQVWDOOHG LQ WKH ZRUN $OO PDWHULDOV HTXLSPHQW DQG DSSOLDQFHV PXVW EH RI WKH FXUUHQW PDQXIDFWXUHUV SURGXFWV 'RQRW XVH REVROHWH RU GLVFRQWLQXHG PDWHULDOVHTXLSPHQWDQGDSSOLDQFHVH[FHSWWKDWFRQVWUXFWLRQPDWHULDOVFRQWDLQLQJUHF\FOHGFRQWHQWDV GHVFULEHG LQ 3DUDJUDSK RI WKLV 3DUW WKDW FRPSOHWHO\ FRPSO\ ZLWK DOO PDWHULDOV VSHFLILFDWLRQV IRXQG HOVHZKHUHLQWKLV3DUWPD\EHXVHG $33/,&$%/(&2'(6$1'67$1'$5'6 7KHDGYLVRU\SURYLVLRQVRIDOOFRGHVDQGVWDQGDUGVLVPDQGDWRU\DVWKRXJKWKHZRUGPXVWKDGEHHQ VXEVWLWXWHGIRUVKRXOGZKHUHYHULWDSSHDUV5HIHUHQFHWRWKHDXWKRULW\KDYLQJMXULVGLFWLRQLVWREH FRQVWUXHG WR PHDQ &LW\ RI 'HQWRQ &RQVWUXFWLRQ 3URMHFW 0DQDJHU &RPSO\ ZLWK WKH UHTXLUHG DQG DGYLVRU\SRUWLRQVRIWKHFXUUHQWHGLWLRQRIWKHVWDQGDUGDWWKHWLPHRIFRQWUDFWDZDUG$OOZRUNPXVW FRPSO\ZLWK8)&General Building RequirementsDQG,%&RUODWHUHGLWLRQDVPRGLILHGE\ DSSOLFDEOH1)3$6WDQGDUGDVZHOODVFRGHVDQGVWDQGDUGVOLVWHGEHORZ /2&$7,2163(&,),&&2'(6$1'67$1'$5'6 &XUUHQWOLVWRI&LW\RI'HQWRQDSSOLFDEOHFRGHVDQGUHIHUHQFHVDUHDVIROORZV ,QWHUQDWLRQDO%XLOGLQJ&RGH ,QWHUQDWLRQDO(OHFWULFDO&RGH ,QWHUQDWLRQDO(QHUJ\&RPSOLDQFH&RGH ,QWHUQDWLRQDO)LUH&RGH &XUUHQW&LW\RI'HQWRQ'HYHORSPHQW&RGH 1RWH$SSOLFDEOHUHIHUHQFHVFDQEHYLHZHGRQWKH&LW\RI'HQWRQZHEVLWHDW KWWSVZZZFLW\RIGHQWRQFRPHQXVEXVLQHVVSHUPLWVOLFHQVHVFRPPHUFLDOSHUPLWV ',6&5(3$1&,(6 :KHQGLVFUHSDQFLHVLQWKHUHIHUHQFHGVWDQGDUGVDQGWKHFRQWUDFWUHTXLUHPHQWVRFFXUWKHPRUHVWULQJHQW UHTXLUHPHQWVJRYHUQ7KHZRUGVKRXOGLQDOO1)3$SXEOLFDWLRQVLVWREHLQWHUSUHWHGDVDUHTXLUHPHQW 7KH$XWKRULW\+DYLQJ-XULVGLFWLRQLQWKHLQWHUSUHWDWLRQRIWKHFRGHVDQGVWDQGDUGVDQGDSSURYLQJWKH H[FHSWLRQVDOORZHGLQWKHUHIHUHQFHGVWDQGDUGVLVWKH&2'&RQVWUXFWLRQ3URMHFW0DQDJHUDQGWKH SDUWLHVGHVLJQDWHGE\WKH&2'&RQVWUXFWLRQ3URMHFW0DQDJHU 0$7(5,$/3(5)250$1&(7(&+1,&$/63(&,),&$7,216 1RWH 7KH SDUDJUDSK QXPEHUV XVHG FRUUHVSRQG ZLWK WKH QXPEHUV XVHG LQ 81,)250$7 ,,:RUN DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH %UHDNGRZQ6WUXFWXUHV:%6DVOLVWHGLQWKH:KROH%XLOGLQJ'HVLJQ*XLGH1DY\'HVLJQ%XLOG0DVWHU DFFHVVLEOHDWWKLVZHEVLWHZZZZEGJRUJQGEP 6+(// This section is not applicable unless modifications or new structure is contemplated for this particular project. 683(56758&785(6 6XSHUVWUXFWXUHZRUNLQFOXGHVVWUXFWXUDOIUDPHVEHDULQJZDOOVIORRUVURRIVURRIFDQRSLHVDQGEDOFRQ\ FRQVWUXFWLRQ8QOHVVRWKHUZLVHVSHFLILHGLQ3DUWVXSHUVWUXFWXUHVPD\EHGHVLJQHGDQGFRQVWUXFWHG XVLQJDQ\PDWHULDOVRUFRPELQDWLRQRIGLIIHUHQWPDWHULDOVDOORZHGE\DSSOLFDEOHFRGHVDQGVWDQGDUGV &RPSO\ ZLWK ,%& DQG DSSOLFDEOH 8)*6 6SHFLDO LQVSHFWLRQ WHVWLQJ DSSURYDOV FHUWLILFDWLRQV REVHUYDWLRQVDQGTXDOLW\DVVXUDQFHSODQVDVSUHVFULEHGLQ&KDSWHURIWKH,%&DUHUHTXLUHG &RQFUHWH$OOFRQFUHWHPXVWEHFRQVWUXFWHGLQDFFRUGDQFHZLWK$&,&RQFUHWHPXVWKDYHD GD\PLQLPXPFRPSUHVVLYHVWUHQJWKRISVL6OXPSPXVWEHEHWZHHQDQGLQFKHVLQ DFFRUGDQFHZLWK$670&3URYLGHMRLQWVDVUHTXLUHGWRPLQLPL]HFUDFNLQJ$OOFRQFUHWH PXVWEHUHLQIRUFHG3URYLGHMRLQWVDVUHTXLUHGE\DSSOLFDEOH$&,VWDQGDUGV8QOHVVRWKHUZLVH VSHFLILHGLQ3DUWRUDVLQGLFDWHGE\WKHFRQWUDFWLQJRIILFHUSURYLGHVWHHOWURZHOILQLVKIRUDOO H[SRVHGIORRUVXUIDFHV([WHULRUVXUIDFHVPXVWEHDEURRPILQLVK 0DVRQU\ D $OOFRQFUHWHPDVRQU\PXVWEHFRQVWUXFWHGLQDFFRUGDQFHZLWK$&,&RQFUHWH PDVRQU\PXVWKDYHDPLQLPXPGD\FRPSUHVVLYHVWUHQJWKRISVL&RQFUHWH PDVRQU\XQLWVPXVWFRQIRUPWR$670&JUDGH$%URNHQEORFNVDUHQRWDOORZHG 8VHRQO\VWDQGDUGVL]HDQGVKDSHEORFNV%ORFNPD\EHFXWZKHQQHFHVVDU\0RUWDU PXVWEH7\SH6 E :KHQXVHGEULFNPXVWFRQIRUPWR$670&,QH[SRVHGFRQVWUXFWLRQEURNHQEULFN LV QRW EH DOORZHG 6WDQGDUG VL]H EULFN PD\ EH FXW WR ILW MRE FRQGLWLRQ 8VH 7\SH 6 PRUWDU F 3URYLGHPHWDODQFKRUVIRUPDVRQU\DQGEULFNLQFOXGLQJYHQHHUFRQVWUXFWLRQDVUHTXLUHG E\,%& 6WUXFWXUDO 6WHHO 6WUXFWXUDO VWHHO H[SRVHG WR ZHDWKHULQJ PXVW EH DGHTXDWHO\ SURWHFWHG WR SUHYHQWFRUURVLRQ 6WHHOGHFN6WHHOIRUPGHFNPXVWKDYHD*JDOYDQL]HGILQLVKDQGPXVWKDYHDPLQLPXP JDJHWKLFNQHVV$OORWKHUVWHHOGHFNPXVWKDYHD*JDOYDQL]HGILQLVKDQGPXVWKDYHD PLQLPXPJDJHWKLFNQHVV &ROGIRUPHGPHWDOIUDPLQJ&ROGIRUPHGVWHHOVWXGVMRLVWVDQGWUDFNPXVWEHJDOYDQL]HGZLWK DPLQLPXPWKLFNQHVVRIJDJH :RRGIUDPLQJ:RRGIUDPLQJPHPEHUVPXVWEHQHZOXPEHUXQOHVVRWKHUZLVHDOORZHGE\3DUW 7LPEHUFDQEH'RXJODV)LU'RXJODV)LU/DUFK+HP)LU6RXWKHUQ3LQHRURWKHUVWUXFWXUDOO\ FRPSHWHQWVSHFLHVDOORZHGE\DSSOLFDEOHFRGHVDQGVWDQGDUGV:RRGIUDPLQJPXVWPHHWWKH IROORZLQJPLQLPXPJUDGLQJUHTXLUHPHQWV D 6WXGV E -RLVWVDQGUDIWHUV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH F %HDPV[DQGODUJHU G 3RVWV[DQGODUJHU H %ORFNLQJ I )DVFLDWULP J :RRG6WUXFWXUDO3DQHO6KHDWKLQJ([WHULRU*OXH K 5RRI$3$UDWHGZLWKVSDQLQGH[RIPLQLPXPWKLFNQHVVLQFK L :DOOV$3$UDWHGZLWKVSDQLQGH[RIPLQLPXPWKLFNQHVVLQFK M )ORRULQJ$3$UDWHGZLWKVSDQLQGH[RIPLQLPXPWKLFNQHVVLQFK (;7(5,25(1&/2685( )RUWKLVSURMHFWLWLVWKHLQWHQWWRPDWFKH[WHULRUPDWHULDOVZKHUHQHFHVVDU\6RPHPDWHULDOSURSHUWLHV QRWHGEHORZDUHIRUUHIHUHQFHRQO\LIWKH\VKRXOGEHLQFRUSRUDWHGLQWRWKHSURMHFW (;7(5,25:$//6 ([WHULRU:DOO3HUIRUPDQFH D9DSRU7UDQVPLVVLRQ$QDO\VLV3HUIRUPDMREVSHFLILFYDSRUWUDQVPLVVLRQDQDO\VLVLQ DFFRUGDQFHZLWK$6+5$(RU:8),7KHFRQFOXVLRQRIWKHDQDO\VLVPXVWLQGLFDWH WKHDSSURSULDWHORFDWLRQVRIQHHGHGYDSRUUHWDUGHUVDLUEDUULHUVDQGDQWLFLSDWHGGHZ SRLQWORFDWLRQVLQWKHH[WHULRUHQFORVXUHGXULQJGLIIHUHQWFULWLFDOWLPHVRIWKH\HDU E0D[LPXP$LU,QILOWUDWLRQ7KHDLUOHDNIORZUDWHPXVWQRWH[FHHG&)0DW3D SHUVTXDUHIRRWFP3DSHUVTXDUHPHWHURIEXLOGLQJHQYHORSHDUHDLQFOXGLQJ URRIRUFHLOLQJZDOOVDQGIORRUDVSURYLGHGE\WKH'25 :KHUHUHTXLUHGLQ5)33DUWSURYLGHDLUEDUULHUWHVWLQJ3HUIRUPWHVWLQJDVUHTXLUHG E\8)*6Building Air Barrier System Testing for Commissioning. '25 PXVWHGLWWKLVVHFWLRQDQGLQFRUSRUDWHLQWRWKHSURMHFWVSHFLILFDWLRQ5HSDLUOHDNVDQG UHSHDW WHVWLQJ XQWLO SUHVFULEHG PD[LPXP DLU OHDN IORZ UDWH LV DFKLHYHG 3URYLGH LQWHUPHGLDWHDQGILQDOUHSRUWV F:LQG/RDGV3URYLGHZLQGORDGFDOFXODWLRQVIRUH[WHULRUFODGGLQJLQDFFRUGDQFHZLWK $6&(ZLWKFRPSDUDWLYHDQDO\VLVRIWKHFODGGLQJV\VWHPWREHSURYLGHG G:DWHU3HQHWUDWLRQ1RZDWHUSHQHWUDWLRQLVDFFHSWDEOHDWDSUHVVXUHRI.JP SVIRIIL[HGDUHDZKHQWHVWHGLQDFFRUGDQFHZLWK$670( H,QVXODWLQJ 9DOXH 3URYLGH FRPSOHWH WKHUPDO HQYHORSH LQ DFFRUGDQFH ZLWK $6+5$( &KDSWHUZLWKLPSURYHPHQWVUHTXLUHGWRPHHWSURMHFWHQHUJ\JRDOV :KHUHUHTXLUHGLQ5)33DUWSURYLGHLQIUDUHGWKHUPDOHQYHORSHSHUIRUPDQFHWHVWLQJ 7HVW WKH EXLOGLQJ HQYHORSH XVLQJ ,QIUDUHG 7KHUPRJUDSK\ LQ DFFRUGDQFH ZLWK WKH UHTXLUHPHQWVRI$670&ODWHVWHGLWLRQDQG,627KH&RQWUDFWLQJ2IILFHUZLOO ZLWQHVVWKHWHVWLQJ3URYLGHWKHUPRJUDSK\WHVWUHSRUWLQFOXGLQJWKHUPRJUDSKVLQFRORU DQGDFRORUWHPSHUDWXUHVFDOHWRGHILQHWKHWHPSHUDWXUHLQGLFDWHGE\WKHYDULRXVFRORUV 7KHUHSRUWPXVWLGHQWLI\WKHKLJKWHPSHUDWXUHUHDGLQJWKHRXWGRRUDLUWHPSHUDWXUHWKH EXLOGLQJLQGRRUDLUWHPSHUDWXUHDQGWKHZLQGVSHHGDQGGLUHFWLRQ5HSRUWWRQRWHDQ\ DUHDVRIFRPSURPLVHLQWKHEXLOGLQJHQYHORSHDQGQRWHDOODFWLRQVUHTXLUHGDQGWDNHQ WRFRUUHFWWKRVHDUHDV5HSDLUDQGUHSHDWWHVWLQJXQWLOGLVFUHSDQFLHVDUHGHPRQVWUDWHG WREHUHVROYHG 0DVRQU\9HQHHU([WHULRU:DOO&ORVXUH&RPSRQHQWV0DVRQU\YHQHHULQFOXGHVORDGEHDULQJ DQGQRQORDGEHDULQJH[WHULRUZDOOVRIWKHVWUXFWXUHDQGPXVWLQFOXGHFRORUHGPRUWDUVSHFLDO DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH VKDSHV VXFK DV VLOOV KHDGHUV WULP XQLWV DQG FRSLQJV RI EULFNPDVRQU\ SUHFDVW FRQFUHWH FRQFUHWHPDVRQU\XQLWVRURWKHUDSSURYHGPDWHULDO8WLOL]H%,$7HFKQLFDO1RWHVWRGHVLJQ GHWDLODQGFRQVWUXFWEULFNPDVRQU\ZDOOV6XEVWLWXWHGLUHFWLYHODQJXDJHLQWKHSODFHRI%,$ VXJJHVWLYH ODQJXDJH 7KH UHVXOWV RI WKHVH ZRUGLQJ VXEVWLWXWLRQV FKDQJH WKLV GRFXPHQW WR UHTXLUHGSURFHGXUHV7LHWKHYHQHHUWRWKHEDFNXSZDOOV\VWHPZLWKDV\VWHPWKDWDOORZVWKH YHQHHUWRPRYHLQGHSHQGHQWO\RIWKHEDFNXSZDOOV\VWHPZKLOHEHLQJVWUXFWXUDOO\VXSSRUWHG 7KHPDVRQU\YHQHHUPXVWDOORZIRUH[SDQVLRQDQGFRQWUDFWLRQRIWKHYHQHHUZLWKRXWFUDFNLQJ WKHH[WHULRUPDWHULDO D0DVRQU\9HQHHU,QVWDOODWLRQ&RQIRUPWR$&,IRUPDVRQU\YHQHHULQVWDOODWLRQ LQFOXGLQJFROGZHDWKHUFRQVWUXFWLRQ$QWLIUHH]HDGPL[WXUHVDUHQRWWREHXVHG E0RUWDU3URYLGHIDFWRU\WLQWHGFRORUHGPRUWDUFRQIRUPLQJWR$670&XQOHVV'25 GLUHFWVRWKHUZLVH F([SDQVLRQ&RQWURO -RLQWV /RFDWH H[SDQVLRQFRQWURO MRLQWV DQG VHDO ZLWK SURSHU EDFNLQJ PDWHULDO DQG $670 & SRO\XUHWKDQH VHDODQW RU SUHIRUPHG IRDP RU UXEEHUL]HG H[SDQVLRQ MRLQW FORVXUH &RQIRUP WR 8)& ArchitectureDQG %,$ 7HFKQRWHV$ G%ULFN0HHW$670&*UDGH6:W\SH)%6RUW\SH)%;IRUGHWDLOZRUN$670 &WHVWUDWLQJVKDOOEH1RWHIIORUHVFHG8VH)%$EULFNRQO\IRUVSHFLDODUFKLWHFWXUDO HIIHFWVUHTXLULQJDQRQXQLIRUPVL]H H6SOLW)DFHGRU*URXQG)DFHG0DVRQU\$670& I&DVW6WRQH7ULP8QLWV&DVW6WRQHPXVWPHHWRUH[FHHGWKHUHTXLUHPHQWVRI$670& J:DOO&DYLW\VKDOO&RPSO\ZLWKWKHDQG%,$7HFKQLFDO1RWHV$%&% K7KURXJK:DOO)ODVKLQJ&RPSRQHQWV7KURXJKZDOOIODVKLQJZLWKZHHSKROHVPXVWEH LQFRUSRUDWHGLQFDYLW\ZDOOFRQVWUXFWLRQ)ODVKLQJPXVWEHRXQFHFRSSHUIODVKLQJZLWK DRXQFHELWXPLQRXVFRDWLQJRQHDFKVLGHRUDILEHUJODVVIDEULFERQGHGRQHDFKVLGH RIWKHFRSSHUVKHHWRXQFHXQFRDWHGFRSSHUJDXJH7\SHRUVWDLQOHVV VWHHOLVDOVRDFFHSWDEOH )OH[LEOHPHPEUDQHIODVKLQJSODVWLFRU39&EDVHGPHPEUDQH IODVKLQJLVSURKLELWHG L5HLQIRUFLQJLQ9HQHHU/D\HU5HLQIRUFLQJLQWKHYHQHHUOD\HUPXVWEHJDOYDQL]HGLQ DFFRUGDQFH ZLWK $670 $ $0 $670 $$0 RU $670 $$0 =*FRDWLQJDQGEHRIVXIILFLHQWVL]HWRHOLPLQDWHGDPDJHWRWKHYHQHHUOD\HU IURPZLQGDQGRWKHUOLYHDQGGHDGORDGVLPSRVHGRQWKHYHQHHUOD\HU M0DVRQU\&OHDQLQJ&OHDQWKHPDVRQU\LQDFFRUGDQFHZLWKPDQXIDFWXUHU VLQVWUXFWLRQV DQG%,$7HFKQRWH 0HWDO:DOO3DQHO([WHULRU&ORVXUH 3DQHOVPXVWKDYHIDFWRU\DSSOLHGEDNHGFRDWLQJWRWKHH[WHULRUDQGLQWHULRURIPHWDOZDOOSDQHOV DQGPHWDODFFHVVRULHV([WHULRUILQLVKWRSFRDWPXVWEHRISHUFHQWSRO\YLQ\OLGHQHIOXRULGH 39') UHVLQ ZLWK QRW OHVV WKDQ PLO GU\ ILOP WKLFNQHVV ')7 ([WHULRU SULPHU PXVW EH VWDQGDUGZLWKSDQHOPDQXIDFWXUHUZLWKQRWOHVVWKDQPLOGU\ILOPWKLFNQHVV')7 :DOOV\VWHPDQGDWWDFKPHQWVPXVWUHVLVWZLQGORDGVDVGHWHUPLQHGE\$6&(ZLWKDIDFWRURI VDIHW\DSSURSULDWHIRUWKHPDWHULDOKROGLQJWKHDQFKRU0D[LPXPGHIOHFWLRQGXHWRZLQGRQ DOXPLQXPZDOOSDQHOVPXVWEH0D[LPXPGHIOHFWLRQGXHWRZLQGRQVWHHOZDOOSDQHOVDQG JLUWVEHKLQGDOXPLQXPRUVWHHOZDOOSDQHOVPXVWEHOLPLWHGWRRIWKHLUUHVSHFWLYHVSDQV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH H[FHSWWKDWZKHQLQWHULRUILQLVKHVDUHXVHGWKHPD[LPXPDOORZDEOHGHIOHFWLRQPXVWEHOLPLWHGWR RIWKHLUUHVSHFWLYHVSDQV &RQIRUPDWLRQV 1RQLQVXODWHG VWHHO RU DOXPLQXP ZDOO SDQHOV PXVW KDYH FRQILJXUDWLRQV IRU RYHUODSSLQJ DGMDFHQW VKHHWV RU LQWHUORFNLQJ ULEV IRU VHFXULQJ DGMDFHQW VKHHWV DQG PXVW EH IDVWHQHGWRIUDPHZRUNXVLQJFRQFHDOHGIDVWHQHUVRUFKRRVHWKHRSWLRQIRUH[SRVHGIDVWHQHUV ZKHQH[SRVHGIDVWHQHUVDUHDFFHSWDEOHDWWKHLQVWDOODWLRQ/HQJWKRIVKHHWVPXVWEHVXIILFLHQW WRFRYHUWKHHQWLUHKHLJKWRIDQ\XQEURNHQZDOOVXUIDFH D6WHHO:DOO3DQHOV 0DWHULDODQG&RDWLQJ)RUPVKHHWVIURPVWHHOFRQIRUPLQJWR$670$$0 6WUXFWXUDO*UDGHJDOYDQL]HGFRDWLQJFRQIRUPLQJWR$670$$0&ODVV* DOXPLQXPFRDWHGVWHHOFRQIRUPLQJWR6$($06RUVWHHOFRDWHGZLWK DOXPLQXP]LQFDOOR\FRQIRUPLQJWR$670$$0H[FHSWWKDWFRDWLQJFKHPLFDO FRPSRVLWLRQPXVWEHDSSUR[LPDWHO\SHUFHQWDOXPLQXPSHUFHQWVLOLFRQDQG SHUFHQW]LQFZLWKPLQLPXPFRDWLQJZHLJKWRIRXQFHSHUVTXDUHIRRW *DJH0LQLPXP866WDQGDUG*DJHIRUZDOOSDQHOVEXWLQQRFDVHOLJKWHUWKDQ UHTXLUHGWRPHHWPD[LPXPGHIOHFWLRQUHTXLUHPHQWVVSHFLILHG E$OXPLQXP:DOO3DQHOV 0DWHULDODQG&RDWLQJ)RUPVKHHWVRI$OOR\RU$OFODGFRQIRUPLQJWR $670%KDYLQJSURSHUWHPSHUWRVXLWUHVSHFWLYHIRUPLQJRSHUDWLRQV 7KLFNQHVV0LQLPXPPPLQFKQRPLQDOEXWLQQRFDVHWKLQQHUWKDQWKDW UHTXLUHGWRPHHWPD[LPXPGHIOHFWLRQUHTXLUHPHQWVVSHFLILHG F,QVXODWHG$OXPLQXPRU6WHHO:DOO3DQHOV,QVXODWHGZDOOSDQHOVPXVWEHVWHHORU DOXPLQXP IDFWRU\IDEULFDWHG XQLWV ZLWK LQVXODWLQJ FRUH EHWZHHQPHWDO IDFH VKHHWV VHFXUHO\IDVWHQHGWRJHWKHUDQGXQLIRUPO\VHSDUDWHGZLWKULJLGVSDFHUV3DQHOVPXVW KDYHDIDFWRU\FRORUILQLVK:DOOSDQHOVPXVWKDYHHGJHFRQILJXUDWLRQVZLWKLQWHUORFNLQJ ULEVIRUVHFXULQJDGMDFHQWSDQHOV6\VWHPPXVWXWLOL]HIDFWRU\IDEULFDWHGFRUQHUVDQG WULPSLHFHVDWLQWHUVHFWLRQVZLWKRWKHUPDWHULDOV,QVXODWHGZDOOSDQHOVPXVWEHIDVWHQHG WRIUDPHZRUNXVLQJFRQFHDOHGIDVWHQHUV ,QVXODWHG6WHHO3DQHOV=LQFFRDWHGVWHHOFRQIRUPLQJWR$670$$0RU $OXPLQXP]LQFDOOR\FRDWHGVWHHOFRQIRUPLQJWR$670$$0$=FRDWLQJ 8QFRDWHGZDOOSDQHOVPXVWEHPPLQFKWKLFNPLQLPXP ,QVXODWHG$OXPLQXP3DQHOV$OOR\FRQIRUPLQJWR$670%WHPSHUDVUHTXLUHG IRUWKHIRUPLQJRSHUDWLRQPLQLPXPPPLQFKWKLFN 6WXFFR([WHULRU:DOO&ORVXUH D3RUWODQG&HPHQW3ODVWHU$670&JUD\3RUWODQGFHPHQW7\SH,,ZLWKPP LQFK PD[LPXP FKRSSHG DONDOL UHVLVWDQW ILEHUJODVV VWUDQGV PLQLPXP SHUFHQW E\ ZHLJKWWRFHPHQWNJSRXQGVSHUVDFNRIFHPHQW/LPHPXVWFRQIRUPWR $670&7\SH66\VWHPPXVWXWLOL]HVWDLQOHVVVWHHORU]LQFFRUQHUEHDGV-EHDGV DQGRWKHUDFFHVVRULHV8QOHVVVSHFLILFDOO\GHOHWHGWKHV\VWHPPXVWXWLOL]HDQDFU\OLF DGPL[WXUHRUFRDWLQJWRJLYHDGGLWLRQDOPRLVWXUHVXSSUHVVLRQWRFRQWUROIXQJXVJURZWK E([WHULRU ,QVXODWLRQ DQG )LQLVK 6\VWHP (,)6 (,0$ 70 DQG (,0$ 70 (,)6PXVWEHXVHGDVWKHQRQSULPDU\RUWKHSULPDU\H[WHULRUILQLVKPDWHULDO RQO\IRUSURMHFWVZKHUHLWLVQHFHVVDU\WRPDWFKH[LVWLQJ(,)6 3UHFDVW &RQFUHWH :DOO 3DQHOV $&, DQG $&, 3&, 01/ RU 3&, 01/ &RQFUHWHPXVWKDYHDPLQLPXPGD\FRPSUHVVLYHVWUHQJWKRI.JFPSVL-RLQWV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH PXVWLQFOXGHSURSHUO\VL]HGDQGSODFHGEDFNLQJPDWHULDODQGIXOO\ORDGHGDQGWRROHGVHDODQW MRLQWRIQROHVVWKDQLQFKVHDODQWPDWHULDOWKLFNQHVV 2WKHU:DOO)LQLVK6\VWHPVLIDSSOLFDEOH D+RUL]RQWDO:RRG6LGLQJ+RUL]RQWDO:RRG6LGLQJ'2&36H[WHULRUODSW\SH LQFKHVZLGHPD[LPXPSUDFWLFDEOHOHQJWKVPPLQFKWKLFNVPRRWKIDFH$OO VXUIDFHVRIZRRGVLGLQJDQGWULPPXVWEHVKRSFRDWHGZLWKDQDON\GSULPHU 6SHFLHVDQG*UDGHV*UDGH&RPPRQVSUXFHSLQHILU1(/0$1/*$:&/,%RU ::3$ *UDGH 3ULPH RU ' ILQLVK SUHVVXUHSUHVHUYDWLYHWUHDWHG KHPILU 1/*$ :&/,%RU::3$*UDGH'6HOHFW4XDOLW\HDVWHUQZKLWHSLQHHDVWHUQKHPORFN EDOVDP ILUWDPDUDFN HDVWHUQ VSUXFH RU ZKLWH ZRRGV 1(/0$ 1/*$ :&/,% RU ::3$*UDGH'6HOHFWQRUWKHUQZKLWHFHGDU1(/0$RU1/*$*UDGH% % SUHVVXUHSUHVHUYDWLYHWUHDWHGVRXWKHUQSLQH63,% E9LQ\O6LGLQJ6\VWHP,QWHJUDOO\FRORUHGYLQ\OVLGLQJFRPSO\LQJZLWK$670' F0DQXIDFWXUHG)DFHG3DQHOV6\VWHPV([WHULRU:DOO6LGLQJ*ODVV)LEHU5HLQIRUFHG &HPHQWLWLRXV 3DQHOV 6\VWHP 6LGLQJ PDGH IURP ILEHUFHPHQW ERDUG WKDW GRHV QRW FRQWDLQDVEHVWRVILEHUVFRPSOLHVZLWK$670&7\SH$*UDGH,,KRUL]RQWDORU YHUWLFDOSDWWHUQLQSODLQRUEHDGHGHGJHVW\OH7H[WXUH5RXJKVDZQRUVPRRWKIDFWRU\ SULPHG ([WHULRU:DOO%DFNXS&RQVWUXFWLRQ D&RQFUHWH8QLW0DVRQU\3URYLGHFRQFUHWHXQLWPDVRQU\WRFRPSO\ZLWK$&, /RDGEHDULQJ XQLWV $670 & 1RQORDG EHDULQJ XQLWV $670 & 7\SH , RU ,, 3URYLGHJURXQGIDFHXQLWVVSOLWIDFHGXQLWVJURXQGIDFHGXQLWVRUVSOLWULEEHGXQLWVIRU H[SRVHGH[WHULRUZDOOV3URYLGHZDWHUUHSHOOHQWDGPL[WXUHWRPDVRQU\XQLWVZKHUHWKH H[WHULRUIDFHRIWKHXQLWVZLOOQRWUHFHLYHDZDWHUSURRIFRDWLQJVXFKDVSDLQW E'DPSSURRILQJ 'DPSSURRI WKH FDYLW\IDFLQJ Z\WKH RI WKH EDFNXS PDVRQU\ XVLQJ DVSKDOWLFSULPHUDFFRUGLQJWR$670'LIGDPSSURRILQJLVQRWSURYLGHGE\DVSUD\HG RQIRDPRURWKHU'25DSSURYHGPHPEUDQHLQVXODWLRQV\VWHP /RDG%HDULQJ0HWDO)UDPLQJ6\VWHP ,I SHUPLWWHG SURYLGH ORDGEHDULQJ PHWDO IUDPLQJ LQFOXGLQJ WRSDQG ERWWRP WUDFNV EUDFLQJ IDVWHQLQJVDQGRWKHUDFFHVVRULHVQHFHVVDU\IRUFRPSOHWHLQVWDOODWLRQ)UDPLQJPHPEHUVPXVW KDYHWKHVWUXFWXUDOSURSHUWLHVLQGLFDWHG:KHUHSK\VLFDOVWUXFWXUDOSURSHUWLHVDUHQRWLQGLFDWHG WKH\PXVWEHDVQHFHVVDU\WRZLWKVWDQGDOOLPSRVHGORDGV'HVLJQIUDPLQJLQDFFRUGDQFHZLWK $,6, 6* ,QVWDOO LQ DFFRUGDQFH ZLWK '25DSSURYHG VKRS GUDZLQJV DQG PDQXIDFWXUHU V LQVWDOODWLRQLQVWUXFWLRQV ([WHULRU6WXGV 0D['HIOHFWLRQ&ULWHULD ([WHULRU)LQLVK / &HPHQW3ODVWHU:RRG9HQHHU 6\QWKHWLF3ODVWHU0HWDO3DQHOV / %ULFN9HQHHU6WRQH3DQHOV :DOO GHIOHFWLRQV PXVW EH FRPSXWHG RQ WKH EDVLV WKDW VWXGV ZLWKVWDQG DOO ODWHUDO IRUFHV LQGHSHQGHQW RI DQ\ FRPSRVLWH DFWLRQ IURP VKHDWKLQJ PDWHULDOV 6WXGV DEXWWLQJ ZLQGRZVRU DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH ORXYHUVPXVWDOVREHGHVLJQHGQRWWRH[FHHGLQFKPD[LPXPGHIOHFWLRQDQGDVUHTXLUHGLQ 8)&'R'0LQLPXP$QWLWHUURULVP6WDQGDUGVIRU%XLOGLQJV 6WXGV$670$$670$06WUXFWXUDO*UDGH7\SH+PLQLPXPSURYLGH= *JDOYDQL]HGFRDWLQJLQDFFRUGDQFHZLWK$670$$670$0'RQRWH[SRVHVWXGV WRGLUHFWPRLVWXUHFRQWDFW %UDFLQJ3URYLGHKRUL]RQWDOEUDFLQJLQDFFRUGDQFHZLWKGHVLJQFDOFXODWLRQVDQG$,6,6* FRQVLVWLQJRIDVDPLQLPXPUXQQHUFKDQQHOFXWWRILWEHWZHHQDQGZHOGHGWRWKHVWXGV 6KHDWKLQJ3URYLGHVKHDWKLQJWRZLWKVWDQGVWUXFWXUDOORDGVLPSRVHGRQWKHZDOOVWUXFWXUH &RYHUVKHDWKLQJZLWKHLWKHUDSRXQGDVSKDOWLPSUHJQDWHGEXLOGLQJSDSHURUDLUEDUULHUDV UHTXLUHGE\WKHZDOOPRLVWXUHDQDO\VLV6KHDWKLQJPXVWEHRQHRIWKHIROORZLQJ D3O\ZRRG&'*UDGH([SRVXUH E6WUXFWXUDO8VHDQG26%3DQHOV F*\SVXP$670&&0DQG$670&&0PPLQFKWKLFNILUH UHWDUGDQW 7\SH ; PP LQFK WKLFN PHWHUV IHHWZLGH ZLWK VTXDUH HGJH IRU VXSSRUWVPPLQFKHVRFZLWKRUZLWKRXWFRUQHUEUDFLQJRIIUDPLQJ*\SVXPVKHDWKLQJ PXVWEHIDFHGZLWKPDWHULDOVFDSDEOHRIUHVLVWLQJVL[PRQWKVRIZHDWKHULQJH[SRVXUHZLWKRXW GHJUDGDWLRQ RI WKH FRYHULQJ RU WKH J\SVXP 6HDO DOO MRLQWV DVUHFRPPHQGHG E\ WKH PDQXIDFWXUHU :RRG)UDPLQJ6\VWHP$OOPDWHULDOVVKDOOEHNLOQGULHGOXPEHUFRPSO\LQJZLWK'2&36 ,QVWDOODWLRQPXVWEHLQDFFRUGDQFHZLWK$) 3$78VHSUHVHUYDWLYHSUHVVXUHWUHDWHGOXPEHU DWVLOOSODWHVDQGRWKHUPHPEHUVLQFRQWDFWZLWKFRQFUHWHDQGPDVRQU\VXUIDFHV D6SHFLHVDQG*UDGHV3URYLGHVSHFLHVDQGJUDGHVOLVWHG*UDGH&RPPRQVSUXFH SLQHILU1(/0$1/*$:&/,%RU::3$*UDGH&RPPRQKHPILU'RXJODVILU 1/*$:&/,%RU::3$*UDGH&RPPRQVRXWKHUQSLQH63,% E6KHDWKLQJ6KHDWKLQJPXVWZLWKVWDQGVWUXFWXUDOORDGVLPSRVHGRQWKHZDOOVWUXFWXUH &RYHU VKHDWKLQJ ZLWK HLWKHU D SRXQG DVSKDOWLPSUHJQDWHG EXLOGLQJ SDSHU RU DLU EDUULHUDVUHTXLUHGE\WKHZDOOPRLVWXUHDQDO\VLV6KHDWKLQJPXVWEHDVIRU0HWDO6WXGV &DVWLQSODFH&RQFUHWH6\VWHP&RQFUHWHFRQVWUXFWLRQPXVWEHLQDFFRUGDQFHZLWK$&, ,QVXODWLRQDQG9DSRU5HWDUGHU,QVXODWLRQ9DSRU5HWDUGHUVDQG$LU%DUULHU6\VWHPVLQRURQ ([WHULRU(QFORVXUHPXVWLQFOXGHLQVXODWLRQOLTXLGVKHHWRUFRQWLQXRXVILOPPDWHULDOVLQVWDOOHG VHSDUDWHO\ LQ RU RQ ZDOO DVVHPEOLHV WR SURYLGH UHVLVWDQFH WR KHDW ORVVJDLQ DQG YDSRU SHQHWUDWLRQ D9DSRU UHWDUGHU &RPSO\ ZLWK $670 & ,QFRUSRUDWH LQ WKH H[WHULRU ZDOO V\VWHP ZKHUHUHTXLUHGE\YDSRUWUDQVPLVVLRQFDOFXODWLRQVRUGHZSRLQWDQDO\VLVLQGLFDWHVWKH QHHGRULQFRQGLWLRQVRIKLJKPRLVWXUHH[SRVXUH E%LWXPLQRXV'DPSSURRILQJ%LWXPLQRXV'DPSSURRILQJPXVWEH$670'7\SH,RU 7\SH ,, ELWXPLQRXV GDPSSURRILQJ RQ WKH H[WHULRU VXUIDFH RI WKHLQWHULRU Z\WKH RI PDVRQU\LQDFDYLW\ZDOOEDFNXSZDOOIRUPDVRQU\YHQHHU F%XLOGLQJ3DSHU)688%7\SH,*UDGH'6W\OH G$LU%DUULHU%XLOGLQJZUDSFRQVLVWLQJRIDLUEDUULHUVKHHWLQJFRPSO\LQJZLWK$670( 7\SHQRWOHVVWKDQPLOVWKLFNZLWKDSHUPHDQFHRIQRWOHVVWKDQQJ3D[ V[VTPSHUPV%XLOGLQJZUDSPXVWKDYHDIODPHVSUHDGLQGH[RIOHVVWKDQLQ DFFRUGDQFHZLWK$670(3URYLGHEXLOGLQJZUDSRYHUVKHDWKLQJRIZRRGRUPHWDO IUDPHGFRQVWUXFWLRQWRUHGXFHDLUSHQHWUDWLRQDQGDLUERUQHYDSRUSHQHWUDWLRQ3URYLGH EXLOGLQJZUDSWDSHDVUHFRPPHQGHGE\WKHPDQXIDFWXUHUIRUVHDOLQJDOOMRLQWVLQWKH EXLOGLQJ ZUDS ,QVWDOO LQ DFFRUGDQFH ZLWK PDQXIDFWXUHU V LQVWUXFWLRQV $LU EDUULHU DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH LQVWDOODWLRQDWZLQGRZVPXVWEHLQDFFRUGDQFHZLWK$670( H,QVXODWLRQ 6\VWHPV 9HUWLFDO DQG KRUL]RQWDO SRO\VW\UHQH LQVXODWLRQ FRQIRUPLQJ WR $670 & RU ULJLG SRO\LVRF\DQXUDWH ERDUG ZDOO LQVXODWLQJ SURGXFWV FRQIRUPLQJ WR $670&RUPLQHUDOILEHUEODQNHWLQVXODWLRQFRQIRUPLQJWR$670&PXVWEH SURYLGHG 3DUDSHWV$YRLGSDUDSHWVZKHQSRVVLEOHEXWZKHQQHFHVVDU\SURYLGHSDUDSHWVZLWKWKHVDPH PDWHULDOVDVWKHH[WHULRUZDOOFRQVWUXFWLRQ3URYLGHVFXSSHUVDQGZDOOHGJHDFFRUGLQJWR 60$&1$ ([WHULRU/RXYHUVDQG6FUHHQV,IUHTXLUHGSURYLGHORXYHUVIRU6FUHHQHG(TXLSPHQW(QFORVXUH RUDVORXYHUVIRUH[WHULRUGRRUV 6WRUPVKXWWHUVPXVWFRPSO\ZLWK$670( +DQGUDLOV%DOFRQ\ZDOOVWRPDWFKH[WHULRUFRQVWUXFWLRQ+DQGUDLOVWRFRPSO\ZLWKWKH,%&DQG 26+$ ([WHULRU6RIILWV([WHULRUVRIILWV\VWHP ([WHULRU3DLQWLQJDQG6SHFLDO)LQLVKHV$OOSDLQWLQJDQGFRDWLQJPDWHULDOVPXVWEHORZ92& 3DLQWLQJSUDFWLFHVPXVWFRPSO\ZLWKDSSOLFDEOHIHGHUDOVWDWHDQGORFDOODZVHQDFWHGWRLQVXUH FRPSOLDQFHZLWK)HGHUDO&OHDQ$LU6WDQGDUGV$SSO\FRDWLQJPDWHULDOVLQDFFRUGDQFHZLWK 663&3$663&3$PHWKRGVDUHDSSOLFDEOHWRDOOVXEVWUDWHV $OOSDLQWPXVWEHLQDFFRUGDQFHZLWKWKH0DVWHU3DLQWHUV,QVWLWXWH03,VWDQGDUGVIRUWKH H[WHULRUDUFKLWHFWXUDOVXUIDFHEHLQJILQLVKHG7KHFXUUHQW03,$SSURYHG3URGXFW/LVWZKLFK OLVWVSDLQWE\EUDQGODEHOSURGXFWQDPHDQGSURGXFWFRGHDVRIWKHGDWHRIFRQWUDFWDZDUGZLOO EHXVHGWRGHWHUPLQHFRPSOLDQFHZLWKWKHVXEPLWWDOUHTXLUHPHQWVRIWKLVVSHFLILFDWLRQ3URYLGH SDLQWV\VWHPVWHVWHGWR'HWDLOHG3HUIRUPDQFH/HYHOVWDQGDUGDVGHILQHGE\03, ([WHULRU-RLQW6HDODQW6HDODQWMRLQWGHVLJQSULPLQJWRROLQJPDVNLQJFOHDQLQJDQGDSSOLFDWLRQ PXVWEHLQDFFRUGDQFHZLWKWKHJHQHUDOUHTXLUHPHQWVRI6HDODQWV$3URIHVVLRQDOV *XLGHIURP WKH6HDODQW:DWHUSURRILQJ 5HVWRUDWLRQ,QVWLWXWH6:5,$OOVHDODQWPXVWFRQIRUPWR$670& 6XQ&RQWURO'HYLFHV6XQFRQWUROGHYLFHVPXVWEHPDQXIDFWXUHGGHYLFHVWRSURYLGHVXQ FRQWURORQH[WHULRUZLQGRZVDQGVWRUHIURQWV6XQFRQWUROGHYLFHVPXVWEHGHVLJQHGDQGLQVWDOOHG WRZLWKVWDQGWKHZLQGORDGVSUHYDLOLQJDWWKHSURMHFWVLWH (;7(5,25:,1'2:6 8QOHVVRWKHUZLVHDOORZHGE\3DUW9ZLQGRZIUDPHVIRUQHZIDFLOLWLHVPXVWEHDOXPLQXP,QEXLOGLQJ UHQRYDWLRQV ZLQGRZV PXVW PDWFK H[LVWLQJ ZLQGRZ PDWHULDOV H[FHSW ZKHQ DOO ZLQGRZV DUH WR EH UHSODFHG,IDOOZLQGRZVDUHWREHUHSODFHGWKH\VKDOOEHDOXPLQXP([WHULRUZLQGRZVPXVWPHHWRU H[FHHG (QHUJ\ 6WDU UHTXLUHPHQWV 7KH GHVLJQ DQG SODFHPHQW RI H[WHULRU ZLQGRZV PXVW WDNH LQWR FRQVLGHUDWLRQVYLHZQDWXUDOOLJKWSULYDF\DQGSURWHFWLRQIRUWKHRFFXSDQWVRIWKHIDFLOLWLHV3URYLGH RSHUDEOH KDUGZDUH DQG LQVHFW VFUHHQ IRU H[WHULRU ZLQGRZV :LQGRZV PXVW EH IDEULFDWHG E\ PDQXIDFWXUHUVQRUPDOO\LQYROYHGLQWKHPDQXIDFWXULQJRIZLQGRZVDQGEHRIWKHFXUUHQWPDNHDQGPRGHO 'R QRW XVH REVROHWH RU GLVFRQWLQXHG ZLQGRZV 3URYLGH ZHDWKHU VWULSSLQJ67&DQG,,&UDWLQJ FRPPHQVXUDWH ZLWK WKH LQWHQGHG XVH RI WKH IDFLOLW\ 6XEPLW FDWDORJ LQIRUPDWLRQ DQG PDQXIDFWXUHU V VSHFLILFDWLRQVIRUDSSURYDOE\&RQWUDFWLQJ2IILFHUSULRUWRSXUFKDVHRIZLQGRZV $OO ZLQGRZ DVVHPEOLHV PXVW PHHW SHUIRUPDQFH JUDGH &: PLQLPXP WHVWHG LQ DFFRUGDQFH ZLWK $$0$:'0$&6$,6$RUPRVWFXUUHQWHGLWLRQRIWKLVVWDQGDUG DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH :KHUHZLQGRZVVHSDUDWHFRQGLWLRQHGVSDFHVIURPQRQFRQGLWLRQHGVSDFHVSURYLGHZLQGRZVEHDULQJ 1)5&HQHUJ\ODEHOLQGLFDWLQJZLQGRZH[FHHGVFXUUHQW(QHUJ\6WDUFULWHULD)RUVWRUHIURQWRUFXUWDLQZDOO V\VWHPVSURYLGHWKHUPDOO\EURNHQIUDPLQJDQGLQVXODWLQJJOD]LQJZLWKZKROHDVVHPEO\8YDOXHRIRU OHVV3URYLGHZLQGRZVH[FHHGLQJUHTXLUHPHQWVRI$6+5$(7DEOHIRUSURMHFWFOLPDWH]RQH :LQGRZVPXVWFRQVLVWRIIL[HGDQGRSHUDEOHVDVKXVHGVLQJO\DQGLQPXOWLSOHV3URYLGHRSHUDEOHVDVKLQ VSDFHVRFFXSLHGE\SHRSOHDVDPLQLPXP,QFOXGHRSHUDWLQJKDUGZDUHQRQFRUURGLQJIUDPHGPHWDO VFUHHQVIRURSHUDEOHVDVKLQWHJUDWHGEOLQGVVHWEHWZHHQJODVVSDQHOVDQGVHFXULW\JULOOHV3URYLGHMDPE VXSSRUWIRUODUJHUZLQGRZVZKHUHUHFRPPHQGHGE\PDQXIDFWXUHU 0HWDO:LQGRZV$OOZLQGRZVPXVWFRQIRUPWR$16,$$0$:'0$0HWDOZLQGRZVZLWK LQVXODWLQJJODVVPXVWKDYHWKHUPDOO\EURNHQIUDPHVDQGVDVK)DFWRU\ILQLVKDOXPLQXPZLQGRZV DQGSURYLGHZLWKDOXPLQXPIUDPHVFUHHQVZLWKDOXPLQXPPHVKDWRSHUDEOHVDVKKDUGZDUHDQG ORFNVDQGWLQWHGJOD]LQJ$OXPLQXPVFUHHQVPXVWFRPSO\ZLWK$16,60$ :RRG:LQGRZV&ODGZRRGDQGZRRGZLQGRZVPXVWFRQVLVWRIFRPSOHWHXQLWVLQFOXGLQJVDVK JODVV IUDPH ZHDWKHUVWULSSLQJ LQVHFW VFUHHQ DQG KDUGZDUH :LQGRZ XQLWV PXVW PHHW WKH UHTXLUHPHQWVRI$$0$H[FHSWPD[LPXPDLULQILOWUDWLRQVKDOOQRWH[FHHG&)0SHU OLQHDUIRRWRIVDVKFUDFNZKHQWHVWHGXQGHUXQLIRUPVWDWLFDLUSUHVVXUHGLIIHUHQFHRI.JP SVI 6WRUHIURQWV 3URYLGH RQHVWRU\ VWRUHIURQW V\VWHP IDEULFDWHG IURP IRUPHG DQG H[WUXGHG DOXPLQXPDQGJODVVFRPSRQHQWVIRUH[WHULRUXVH8WLOL]HWKHVSHFLILFVHFWLRQRIWKH6WDQGDUG 'HVLJQ%XLOG3HUIRUPDQFH7HFKQLFDO6SHFLILFDWLRQV6HFWLRQ%IRUWKHVWRUHIURQWWREH SURYLGHG6WRUHIURQWIUDPLQJPXVWPHHWRUH[FHHGWKHVWUXFWXUDOUHTXLUHPHQWVDVPHDVXUHGLQ DFFRUGDQFHZLWK$16,$670('HVLJQV\VWHPWRZLWKVWDQGWKLVDVDPLQLPXPDQGFRPSO\ ZLWK GHVLJQ SUHVVXUH HVWDEOLVKHG ZLWKLQ WKH UHTXLUHG $6&( :LQG 6SHHG &DOFXODWLRQV GHWHUPLQHGE\WKHRYHUDOODYHUDJHRSHQLQJZLWKLQWKHSURMHFW *OD]LQJ$OOH[WHULRUJOD]LQJPXVWEHLQVXODWLQJJODVV D &OHDU*ODVV7\SH,&ODVVFOHDU4XDOLW\T$ E +HDW$EVRUELQJ*ODVV$6707\SH,&ODVV4XDOLW\TVHOHFWUD\IUDPHV F :LUH*ODVV7\SH,,&ODVV)RUP4XDOLW\T0HVKPRU)RUP4XDOLW\T G /DPLQDWHG*ODVV$670WRWDOWKLFNQHVVVKDOOEHQRPLQDOO\PPLQFK H ,QVXODWLQJ*ODVV8QLWV7\SLFDOO\$670&7\SH,&ODVV4XDOLW\TPLQLPXP PP I 7HPSHUHG*ODVV$670&.LQG)7IXOO\WHPSHUHG J 3DWWHUQHG *ODVV $670 7\SH ,, &ODVV WUDQVOXFHQW )RUP SDWWHUQHG 4XDOLW\TGHFRUDWLYH)LQLVKISDWWHUQHGRQHVLGH3DWWHUQSJHRPHWULFPP LQFKWKLFN (;7(5,25'2256 ([WHULRUGRRUVPXVWEHKHDY\GXW\LQVXODWHGVWHHOGRRUVDQGIUDPHVIRUVHUYLFHDFFHVV3URYLGHGRRU IUDPHVZLWKZHOGHGFRUQHUV8VHKHDY\GXW\RYHUKHDGKROGHUDQGFORVHUWRSURWHFWGRRUVIURPZLQG GDPDJH6WHHOPXVWKDYH*JDOYDQL]HGFRDWLQJLQDFFRUGDQFHZLWK$670$$0DQG$670 $$0ZKHQWKHMREVLWHLVORFDWHGZLWKLQIHHWIURPDERG\RIVDOWZDWHU3URYLGHFRPPHUFLDO DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH TXDOLW\FRDWLQJ&ODVV$]LQFFRDWLQJLQDFFRUGDQFHZLWK$670$IRURWKHUVWHHORUVWHHOVNLQKROORZ PHWDOGRRUVDWRWKHUORFDWLRQV3URYLGHNLFNSODWHVRQWKHLQVLGHIDFHRIDOOH[WHULRUGRRUV:HDWKHU SURWHFW DOO H[WHULRU GRRUV DQG UHODWHG FRQVWUXFWLRQ ZLWK ORZ LQILOWUDWLRQ ZHDWKHUVWULSSLQJ DQG VHDODQWV 3URYLGH WKUHVKROG ZLWK RIIVHW WR VWRS ZDWHU SHQHWUDWLRQ ZKLOH PDLQWDLQLQJ DFFHVVLELOLW\ FRPSOLDQFH &RQIRUPWRWKHGHVLJQFULWHULDRI$6&(6HHWKHKDUGZDUHVFKHGXOHIRUGRRUKDUGZDUHUHTXLUHPHQWV :KHUH GRRUV VHSDUDWH FRQGLWLRQHG VSDFHV IURP QRQFRQGLWLRQHG VSDFHV SURYLGH GRRUV H[FHHGLQJ FXUUHQW (QHUJ\6WDU FULWHULD )RU VWRUHIURQW HQWUDQFHV SURYLGH WKHUPDOO\ EURNHQ GRRU IUDPLQJ DQG LQVXODWLQJJOD]LQJZLWKZKROHDVVHPEO\8YDOXHRIRUOHVV3URYLGHGRRUVH[FHHGLQJUHTXLUHPHQWV RI$6+5$(7DEOHIRUSURMHFWFOLPDWH]RQH 6WHHO 'RRUV ([WHULRU GRRUV PXVW FRPSO\ ZLWK $16, $ 6', +DUGZDUH SUHSDUDWLRQPXVWEHLQDFFRUGDQFHZLWK$16,$'RRUVPXVWEHKXQJLQDFFRUGDQFHZLWK $16,$ D 'RRUV5HTXLUHG 6WDQGDUG 'XW\ 'RRUV /HYHO 06* ,3 PP SK\VLFDO SHUIRUPDQFH/HYHO&0RGHORU +HDY\'XW\'RRUV06*,3PPSK\VLFDOSHUIRUPDQFH/HYHO% 0RGHORU ([WUD+HDY\'XW\'RRUV/HYHO06*PPSK\VLFDOSHUIRUPDQFH /HYHO$0RGHORU 0D[LPXP'XW\'RRUV/HYHO,3PPSK\VLFDOSHUIRUPDQFH/HYHO$ 0RGHORU E ,QVXODWHGVWHHOGRRUVDQGIUDPHVDUHUHTXLUHGIRUHQWUDQFHVWRGZHOOLQJXQLWVDQGPD\ DOVREHVSHFLILHGDVD&RQWUDFWRU VRSWLRQWR/HYHOVWDQGDUGKROORZPHWDOGRRUV'R QRW XVH ZRRG GRRUV IRU H[WHULRU GRRUV XQOHVV WKH\ DUH IXOO\ SURWHFWHG IURP WKH HOHPHQWVDQH[WHULRUJUDGHVSHFLHVDQGVSHFLDOO\ILQLVKHG,IZRRGGRRUVDUHXVHG SURYLGHLQDFFRUGDQFHZLWK6WDQGDUG'HVLJQ%XLOG3HUIRUPDQFH7HFKQLFDO6SHFLILFDWLRQ 3DUDJUDSK% 6WDQGDUG6WHHO)UDPHV$16,$)RUPIUDPHVZLWKZHOGHGFRUQHUVIRULQVWDOODWLRQLQ H[WHULRUZDOOV)RUPVWRSVDQGEHDGVRIJDJHVWHHO)UDPHVPXVWEHVHWLQDFFRUGDQFHZLWK $670 $ $QFKRU DOO IUDPHV ZLWK D PLQLPXP RI WKUHH MDPE DQFKRUV DQG EDVH VWHHO DQFKRUVSHUIUDPH]LQFFRDWHGRUSDLQWHGZLWKUXVWLQKLELWLYHSDLQWQRWOLJKWHUWKDQJDJH 0RUWDULQILOOIUDPHVLQPDVRQU\ZDOOVDQGLQILOOZLWKJ\SVXPERDUGFRPSRXQGDWHDFKMDPE DQFKRULQPHWDOIUDPHZDOOV2QO\XVHVXUIDFHH[SRVHGEROWHGDQFKRUVLQFRQFUHWHZDOOV 'RRUDQG)UDPH)LQLVKHVD([WHULRU'RRUV)DFWRU\3ULPHGDQG)LHOG3DLQWHG)LQLVK'RRUV DQGIUDPHVPXVWEHIDFWRU\SULPHGZLWKDUXVWLQKLELWLYHFRDWLQJDVVSHFLILHGLQ$16,$ )DFWRU\SULPHGRRUVRQVL[VLGHVRIWKHGRRUE([WHULRU'RRUV*DOYDQL]HG)LQLVK0XVWEH &RPPHUFLDO 4XDOLW\ &RDWLQJ &ODVV $ ]LQF FRDWLQJ LQ DFFRUGDQFH ZLWK $670 $ ZKHQ IDFLOLW\LVORFDWHGIXUWKHUWKDQPHWHUVIHHWIURPWKHRFHDQ:KHQIDFLOLW\LVORFDWHG ZLWKLQPHWHUVIHHWRIWKHRFHDQSURYLGH*JDOYDQL]HGFRDWLQJLQDFFRUGDQFHZLWK $670$$0DQG$670$$0 +DUGZDUH3URYLGHWKHVHUYLFHVRID&HUWLILHG'RRU+DUGZDUH&RQVXOWDQWWRSUHSDUHWKHGRRU KDUGZDUHVFKHGXOH +,1*(6 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $$FFHSWDEOH0DQXIDFWXUHUV +DJHU+LQJH&R6W/RXLV02 0F.LQQH\6FUDQWRQ3$ 6WDQOH\+DUGZDUH'LYLVLRQRI7KH6WDQOH\:RUNV1HZ%ULWDLQ&7 %%XWW+LQJHV &RPSO\ZLWK$16,$DQG$ )LYHNQXFNOHGHVLJQVZLWKVTXDUHFRUQHUV )XOOPRUWLVHW\SH )ODWEXWWRQWLSDQGPDWFKLQJSOXJ 1RQUHPRYDEOHSLQVIRURXWVZLQJLQJH[WHULRUGRRUVDQGIRULQWHULRUUHYHUVHEHYHOGRRUV HTXLSSHGZLWKORFNLQJGHYLFHVDIHW\VWXGDOVRDFFHSWDEOH1RQULVLQJSLQIRURWKHU GRRUV 1RQIHUURXVFRQVWUXFWLRQDWORFDWLRQVH[SRVHGWRH[WHULRUDWPRVSKHUH +HDY\ZHLJKWIRUGRRUV¶ZLGWKDQGRYHUDQGIRUILUHUDWHGGRRUVRYHU¶KHLJKW 6WDQGDUGZHLJKWDWRWKHUGRRUV $QWLIULFWLRQRUEDOOEHDULQJW\SHIRUGRRUVHTXLSSHGZLWKFORVHUV $QWLIULFWLRQRUEDOOEHDULQJW\SHIRUGRRUV¶ZLGWKDQGRYHUZKLFKDUHQRWHTXLSSHGZLWK FORVHUV 3ODLQEHDULQJW\SHIRUGRRUVOHVVWKDQ¶ZLGWKZKLFKDUHQRWHTXLSSHGZLWKFORVHUV '0LQLPXP1XPEHU+LQJHV%XWWVW\OH 'RRUV¶RUOHVVLQKHLJKW2QHSDLU 'RRUVRYHU¶DQGQRWRYHU¶SDLU 'RRUVRYHU¶2QHIRUHDFKDGGLWLRQDO¶KHLJKWRUIUDFWLRQWKHUHRI 'XWFKGRRUVSDLU (0LQLPXP6L]HDQG*DJH 'RRUV¶ZLGWKRUOHVVE\LQFKHVJDJH 'RRUVRYHU¶XSWR¶E\LQFKHVJDJH 'RRUVRYHU¶E\LQFKHVJDJH )LUHUDWHGGRRUVRYHU¶KHLJKW6L]HGDVLQGLFDWHGDERYHH[FHSWQRWOHVVWKDQ JDJH 'RRUVVFKHGXOHGIRUVSULQJKLQJHVE\LQFKHVJDJH &</,1'(56DQG3(50$1(17&25(6 $3URYLGHF\OLQGHUVIRUORFNVHWVGHDGORFNVH[LWGHYLFHVDQGRWKHUFRQWURODQGORFNLQJGHYLFHV LQGLFDWHGLQ+DUGZDUH6HWV %)XUQLVKSHUPDQHQWFRUHVNH\HGWRIDFWRU\UHJLVWHUHGH[WHQVLRQRI2ZQHUVH[LVWLQJ%HVWVHULHV LQWHUFKDQJHDEOHFRUHF\OLQGHUV\VWHP &&RUHVVKDOOEH6ROLGEUDVVFRQVWUXFWLRQWRSURYLGHKLJKTXDOLW\DQGORQJF\OLQGHUOLIH '5HPRYDEOH&RUHSLQWXPEOHULQWHUFKDQJHDEOHFRUHGHVLJQUHPRYDEOHE\DFRQWURONH\ %UDVVF\OLQGHUERG\KDYLQJDKHDGFDSRIEUDVVEURQ]HRUVWDLQOHVVVWHHO ILQLVKHGWRPDWFKORFNLQJWULP (TXLSF\OLQGHUVZLWKDSSURSULDWHULQJV (TXLSZLWKSURSHUWDLOSLHFHIRUPRUWLVHDQGRUULPF\OLQGHUV ($FFHSWDEOH0DQXIDFWXUHUV %HVW$FFHVV6\VWHPV )0RUWLVH7\SH7KUHDGHGF\OLQGHUVZLWKULQJVDQGFDPVWRVXLWKDUGZDUHDSSOLFDWLRQ *5LP7\SH&\OLQGHUVZLWKEDFNSODWHIODWW\SHYHUWLFDORUKRUL]RQWDOWDLOSLHFHDQGUDLVHGWULPULQJ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH +%RUHG/RFN7\SH&\OLQGHUVZLWKWDLOSLHFHVWRVXLWORFNV ,0RUWLVHDQGULPF\OLQGHUFROODUVWREHVROLGDQGUHFHVVHGWRDOORZWKHF\OLQGHUIDFHWREHIOXVK DQGEHIUHHVSLQQLQJZLWKPDWFKLQJILQLVKHV -.H\ZD\0DWFK)DFLOLW\6WDQGDUG .(TXLSF\OLQGHUVZLWKDSSURSULDWHULQJV /)LQLVKF\OLQGHUVDQGULQJVWRPDWFKWULP .(<6$1'.(<,1* $&RQVXOWZLWK2ZQHU¶VDXWKRUL]HGUHSUHVHQWDWLYHDQGSUHSDUHGHWDLOHGNH\LQJVFKHGXOH DFFRUGLQJO\ %.H\LQJ 3URYLGH%HVWLQWHUFKDQJHDEOHFRUHF\OLQGHUVGHVLJQHGVRWKDWFRUHVFDQ TXLFNO\DQGHDVLO\EHFKDQJHGE\QRQWHFKQLFDOSHUVRQQHOE\XVLQJDVSHFLDOFRQWURO NH\ &&RQVWUXFWLRQ.H\LQJ )XUQLVKH[WHULRUGRRUORFNVHWVZLWKNH\HGDOLNHUHPRYDEOHFRQVWUXFWLRQFRUHF\OLQGHUVIRUXVH GXULQJFRQVWUXFWLRQ 5HVWULFWGLVWULEXWLRQRIFRQVWUXFWLRQNH\V0DLQWDLQUHFRUGRISHUVRQVZKRKDYHUHFHLYHGNH\V DQGGHOLYHUFRSLHVRIUHFRUGWR&RQWUDFWLQJ2IILFHUXSRQUHTXHVW 3URYLGHSHUPDQHQWFRUHVWRRZQHUSULRUWRVXEVWDQWLDOFRPSOHWLRQ 2ZQHUVKDOOVWRUHWKHPVHFXUHO\XQWLOQHHGHG$WVXEVWDQWLDOFRPSOHWLRQDQGDW&RQWUDFWLQJ 2IILFHUGLUHFWLRQUHPRYHFRQVWUXFWLRQFRUHVDQGUHSODFHZLWKSHUPDQHQWFRUHVLQ SUHVHQFHRI2ZQHU 3URYLGHNH\VWR2ZQHUDQGUHWXUQFRQVWUXFWLRQFRUHVWRPDQXIDFWXUHU '3HUPDQHQW.H\LQJ0DVWHUORFNVDQGF\OLQGHUVDUHWRPDWFKWKH%HVW.H\6\VWHPDVLQVWUXFWHGE\ RZQHU (3URYLGHNH\VRI1LFNHO6LOYHU0DWHULDOLQ)ROORZLQJ4XDQWLWLHV *UDQGPDVWHUNH\V0*.6L[ 0DVWHUNH\V0.HDFKVHW6L[ &KDQJHNH\VSHUORFN7ZR 5HPRYDEOH&RUH&RQWURO.H\V6L[ &RQVWUXFWLRQ0DVWHUNH\V7HQ &RQVWUXFWLRQ&RQWURO.H\V7ZR ),GHQWLILFDWLRQDQG&RQWURO 6WDPSDOONH\VZLWKGRQRWGXSOLFDWHRUDVRWKHUZLVHLQVWUXFWHGE\RZQHU *)XUQLVKYLVXDOFRQWUROV\VWHPFRRUGLQDWHSURYLVLRQVZLWK2ZQHU6WDPSRUHPERVVNH\VZLWK LGHQWLILFDWLRQFRGH +'HOLYHUFRQVWUXFWLRQPDVWHUNH\VWR3URMHFWVLWH)RUZDUGRWKHUNH\VGLUHFWO\IURPPDQXIDFWXUHUWR 2ZQHU6KLSPDVWHUNH\VDQGJUDQGPDVWHUNH\VYLDSUHSDLGUHJLVWHUHGPDLO6KLSFKDQJHNH\V YLDSUHSDLGIUHLJKW /2&.,1*$1'/$7&+,1*'(9,&(6 $$FFHSWDEOH0DQXIDFWXUHUV %DVLVRI'HVLJQSURGXFWVVSHFLILHGDUHPDQXIDFWXUHGE\%HVW&RUSRUDWLRQ <DOH6HFXULW\$66$$%/2</HQRLU&LW\71 &RUELQ5XVVZLQ$66$$%/2<%HUOLQ&7 6DUJHQW$66$$%/2<1HZ+DYHQ&7 6FKODJH,QJHUVRO5DQG,QGLDQDSROLV,1 %HVW$FFHVV6\VWHPV,QGLDQDSROLV,1 %0RUWLVH/RFNVHWV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH %HVW+6HULHVZLWKOHYHUDQGURVHSLQ $16,$*UDGH )XQFWLRQV D(QWUDQFH $FFHSWDEOH3URGXFWVIRUFDVWRUIRUJHG/HYHUZLWK5RVH7ULP D<DOH)/6HULHV[3%5/HYHU E&RUELQ5XVVZLQ0/6HULHV[36$/HYHU F6DUJHQW6HULHV[/13/HYHU G6FKODJH/6HULHV[$/HYHU H%HVW+6HULHV[+/HYHU )HDWXUHV D%DFNVHWLQFKHV E)DFHSODWHE\LQFKHVDGMXVWDEOHIURPIODWWREHYHORILQFKLQLQFKHV ILQLVKHGWRPDWFKWULPRQKLQJHVLGHRIGRRU F/DWFK%ROW7ZRSLHFHDQWLIULFWLRQLQFKWKURZ G6WULNH$16,VWDQGDUGLQFKKHLJKWLQFKFXUYHGOLS H3URYLGHVWULNHVZLWKSURSHUOLSOHQJWKWRSURWHFWWULPRIWKHIUDPHEXWQRWWR SURMHFWPRUHWKDQLQFKEH\RQGIUDPHWULPRUWKHLQDFWLYHOHDIRID SDLURIGRRUV I)LQLVKWRPDWFKWULPRQKLQJHVLGHRIGRRU &&\OLQGULFDO/RFNVHWVDQG/DWFKVHWV $16,$*UDGH SLQF\OLQGHUFRUHWRPDWFK2ZQHUVVWDQGDUG )XQFWLRQV D(QWUDQFH E&ODVVURRP F3ULYDF\ G3DVVDJH $FFHSWDEOH3URGXFWV D%HVW.VHULHVZLWK'OHYHUDQGURVH E<DOH/16HULHV*UDGH0RQURHWULPOHYHUV F6FKODJH1'6HULHVZLWK$WKHQVOHYHUDQGURVH G&RUELQ5XVVZLQ&/VHULHVZLWK$UPVWURQJOHYHU H6DUJHQW/LQHVHULHVZLWK%OHYHUWULP ''HDGEROWV %HVW76HULHV'HDGEROWV±RUHTXDO %DFNVHWLQFKHV &\OLQGHUV$16,$$X[LOLDU\/RFNV*UDGH 'HDGEROW´WKURZ´[´VROLGVWDLQOHVVVWHHOEROW (6WDQGDUG&RPSO\ZLWK$16,$6HULHV*UDGH %DFNVHWLQFKHV )DFHSODWHE\LQFKHVDGMXVWDEOHIURPIODWWREHYHORILQFKLQLQFKHVILQLVKHGWR PDWFKWULPRQKLQJHVLGHRIGRRU /DWFKEROW7ZRSLHFHDQWLIULFWLRQLQFKWKURZ 'HDGEROWLQFKWKURZ 6WULNH D$16,VWDQGDUGLQFKKHLJKWLQFKFXUYHGOLS E(TXLSZLWKZURXJKWRUSODVWLFER[ F)LQLVKWRPDWFKWULPRQKLQJHVLGHRIGRRU (/(&75,&675,.(6&RRUGLQDWHLQVWDOODWLRQZLWK+0IUDPHDQGHOHFWULFDOURXJKLQ $$WULPW\SHH[LWGHYLFHV+(6 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH %$WQRQILUHUDWHGF\OLQGULFDODQGPRUWLVHORFNVHWV+(6 &$WILUHUDWHGF\OLQGULFDODQGPRUWLVHORFNVHWV+(6 685)$&(02817('&/26(56 $$FFHSWDEOH0DQXIDFWXUHUV /&1&ORVHUV3ULQFHWRQ,/ 1RUWRQ'RRU&RQWUROV&KDUORWWH1& 6DUJHQW1HZ+DYHQ&7 1RRWKHUVXEVWLWXWLRQVDOORZHG %$FFHSWDEOH3URGXFWV /&16HULHV 6DUJHQW 1RUWRQ &6WDQGDUG&RPSO\ZLWK$16,$*UDGH '5HTXLUHG)HDWXUHV 0DQXIDFWXUHU¶VVWDQGDUGFDVWLURQRUFDVWDOXPLQXPFRQVWUXFWLRQ +HDY\GXW\GRXEOHOHYHUDUPW\SH 5HJXODURUSDUDOOHODUPPRXQWLQJ 5DFNDQGSLQLRQFRQVWUXFWLRQZLWKFRPSUHVVLRQVSULQJIXOO\K\GUDXOLF &ORVLQJVSHHGDQGODWFKLQJVSHHGFRQWUROOHGE\LQGHSHQGHQWO\RSHUDWHGYDOYHV $GMXVWDEOHVSULQJSRZHUDOORZLQJDGMXVWPHQWXSWRLQILHOGWRVXLWLQGLYLGXDOGRRU FRQGLWLRQV $GMXVWDEOHEDFNFKHFNIRULQWHULRUDQGH[WHULRUXQLWV 0D[LPXPRSHUDWLQJIRUFHRISRXQGVIRUH[WHULRUGRRUVSRXQGVIRULQWHULRUGRRUVDQG SRXQGVIRUODEHOGRRUV 6L]HDVUHFRPPHQGHGE\PDQXIDFWXUHUIRUGRRUVL]HDQGZHLJKW +ROGRSHQDQGGHDGVWRSIHDWXUHVZKHUHLQGLFDWHGLQ+DUGZDUH6HWV ($FFHVVRULHV 0DQXIDFWXUHU¶VVWDQGDUGIXOOVL]HPHWDORUQRQPHWDOOLFFRYHU )XUQLVKZLWKQHFHVVDU\DUPVWUDFNVEUDFNHWVSODWHVVKRHVDQGRWKHUDFFHVVRULHVWRVXLW GRRUDQGIUDPHFRQGLWLRQV )LQLVKDFFHVVRULHVWRPDWFKFRYHU )0RXQWLQJ5RRPVLGHRIGRRU$OVRUHIHUWRKDUGZDUHORFDWLRQV (;,7'(9,&(6 $$FFHSWDEOH0DQXIDFWXUHUV 9RQ'XSULQ,QF,QGLDQDSROLV,1 %$FFHSWDEOH3URGXFWV 9RQ'XSULQ6HULHVULPGHYLFHDWVLQJOHGRRUVDQGVXUIDFHPRXQWHGYHUWLFDOURGDWSDLURI GRRUVWRXFKEDUGHVLJQZLWK/NH\ORFNVDQGOHYHUVDVLQGLFDWHGLQ+DUGZDUH 6HWV 6WDQOH\6HULHV+HDY\'XW\ULPW\SH $SSURYHGHTXDO &6WDQGDUGV &RPSO\ZLWK$16,$*UDGH 8QGHUZULWHUV¶/DERUDWRULHV,QFOLVWHGIRU$FFLGHQW(TXLSPHQW/LVW3DQLF+DUGZDUH DWH[LWDVVHPEOLHV 8QGHUZULWHUV¶/DERUDWRULHV,QFOLVWHGIRU)LUH([LW+DUGZDUHDWODEHOHGDVVHPEOLHV '0XOOLRQ)LQLVK)DFWRU\SDLQW&RORUDVVHOHFWHGE\$UFKLWHFW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH '22567236 $$FFHSWDEOH0DQXIDFWXUHUV %DOGZLQ+DUGZDUH&RUS5HDGLQJ3$ %URRNOLQH,QGXVWULHV,QF&KLFDJR,/ %XLOGHU¶V%UDVV:RUNV&RUS/RV$QJHOHV&$ *O\QQ-RKQVRQ&KLFDJR,/ +LDZDWKD,QF%ORRPLQJWRQ01 +%,YHV:DOOLQJIRUG&7 4XDOLW\+DUGZDUH0DQXIDFWXULQJ&R+DZWKRUQH&$ 5RFNZRRG0DQXIDFWXULQJ&R5RFNZRRG3$ 7ULDQJOH%UDVV0DQXIDFWXULQJ&R,QF7ULPFR/RV$QJHOHV&$ %3URYLGHGRRUVWRSVDWHDFKGRRUOHDIH[FHSWQRWUHTXLUHGDWGRRUVHTXLSSHGZLWKRYHUKHDG VWRSVKROGHUVRUGRRUVHTXLSSHGZLWKFORVHUVKDYLQJGHDGVWRSIHDWXUHVZKHWKHUVFKHGXOHGRU QRW &'RRUVWRSVFRQVLVWRIVWRSVWRSUHYHQWGRRUVIURPVWULNLQJEXLOGLQJFRPSRQHQWVRUHTXLSPHQW ')ORRU6WRSV 'RPHW\SH D8VHRQO\DWVWRUDJHMDQLWRUPHFKDQLFDOHTXLSPHQWDQGHOHFWULFDOURRPVDQG RWKHUORFDWLRQVLQGLFDWHGLQ+DUGZDUH6HWV E(TXLSZLWKDSSURSULDWHULVHUZKHUHVFKHGXOHGIRUDUHDVLQGLFDWHGWRUHFHLYHFDUSHW RUWKUHVKROGV F$FFHSWDEOH3URGXFW7ULPFR +HDY\'XW\W\SH D8VHDW+0GRRUVDQGRWKHUORFDWLRQVLQGLFDWHGLQ+DUGZDUH6HWV E+HDY\GXW\KLJKLPSDFW F$FFHSWDEOH3URGXFW5RFNZRRG (2YHUKHDG'RRU6WRSVDQG+ROGHUV$16,%+0$$*UDGHFHUWLILHGRYHUKHDGVWRSVDQG KROGHUVWREHVXUIDFHRUFRQFHDOHGW\SHVDVLQGLFDWHGLQ+DUGZDUH6HWV7UDFNVOLGHDUPDQG MDPEEUDFNHWWREHFRQVWUXFWHGRIH[WUXGHGEURQ]HDQGVKRFNDEVRUEHUVSULQJRIKHDY\ WHPSHUHGVWHHO3URYLGHQRQKDQGHGGHVLJQZLWKPRXQWLQJEUDFNHWVDVUHTXLUHGIRUSURSHU RSHUDWLRQDQGIXQFWLRQ $FFHSWDEOH0DQXIDFWXUHUV D5L[VRQ'RRU&RQWUROV5) E6DUJHQW0DQXIDFWXULQJ6$ (/(&7521,&'225&21752/6 $(OHFWURPDJQHWLF+ROG2SHQ'HYLFHV $FFHSWDEOHPDQXIDFWXUHUV D'RUPD'RRU&RQWUROV,QF5HDPVWRZQ3$ E5L[VRQ)LUHPDUN)UDQNOLQ3DUN,/ F<DOH6HFXULW\,QF&KDUORWWH1& 2SHUDWLRQ)DLOVDIH 9ROWDJHYROWV'& $FFHSWDEOHSURGXFWV D6LQJOH'RRUKHDGPRXQWHG'RUPD(0/ 0,6&(//$1(286+$5':$5( $$FFHSWDEOH0DQXIDFWXUHUV %DOGZLQ+DUGZDUH0DQXIDFWXULQJ&RUS5HDGLQJ3$ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH %URRNOLQH,QGXVWULHV,QF&KLFDJR,/ %XLOGHU¶V%UDVV:RUNV&RUS/RV$QJHOHV&$ 'RRU&RQWUROV,QWHUQDWLRQDO$QQ$UERU0, *O\QQ-RKQVRQ&KLFDJR,/ +LDZDWKD,QF%ORRPLQJWRQ01 +%,YHV:DOOLQJIRUG&7 4XDOLW\+DUGZDUH0DQXIDFWXULQJ&R+DZWKRUQH&$ 5L[VRQ)LUHPDUN)UDQNOLQ3DUN,/ 5RFNZRRG0DQXIDFWXULQJ&R5RFNZRRG3$ 6WDQOH\+DUGZDUH'LYLVLRQRI7KH6WDQOH\:RUNV1HZ%ULWDLQ&7 7UHJR,QGXVWULHV,QF5HG2DN7; 7ULDQJOH%UDVV0DQXIDFWXULQJ&R7ULPFR/RV$QJHOHV&$ %)OXVK%ROWV 0DQXDOGHVLJQHTXLYDOHQWWR,YHVDWQRQODEHOHGPHWDORUZRRGGRRUV 0DQXDOGHVLJQHTXLYDOHQWWR,YHVDWODEHOHGZRRGGRRUV 0DQXDOGHVLJQHTXLYDOHQWWR,YHVDWODEHOHGPHWDOGRRUV (TXLSZLWKH[WHQVLRQEROWVRIOHQJWKVWRORFDWHRSHUDWLQJPHFKDQLVPDWLQFKHVDERYHIORRU IRUERWWRPXQLWDQGQRWRYHULQFKHVDERYHIORRUIRUWRSXQLW (TXLSERWWRPEROWVZLWKGXVWSURRIVWULNHHTXLYDOHQWWR,YHV3URYLGH,YHVSODWHZKHUH IORRUPRXQWHGSODWHQRWUHTXLUHGDWWKUHVKROGV &3XVK3ODWHV 5RFNZRRG50+³386+´´;´86' '3XOO3ODWHV 5RFNZRRG50'RRU3XOO´GLDPHWHU´RYHUDOOOHQJWK´FHQWHUWRFHQWHU86' ILQLVK (&RRUGLQDWRUV 3URYLGHDOXPLQXPILOOHUEDUSULPHSDLQWHGILHOGSDLQWWRPDWFKGRRUIUDPH $FFHSWDEOH3URGXFW*O\QQ-RKQVRQ&256HULHV0RGHO1R&25)%%;ZLWK)%6HULHV ILOOHU )6LOHQFHUV 7\SH3UHIRUPHGQHRSUHQHRUUXEEHU /RFDWLRQDQGTXDQWLWLHV D3DLUVRIGRRUV7ZRDWKHDGHU E6LQJOHGRRUV7KUHHDWVWULNHMDPE F:HDWKHUVWULSSHGGRRUV G6PRNHVHDOHGGRRUV :($7+(5675,33,1*6($/6$1'7+5(6+2/'6 $$FFHSWDEOH0DQXIDFWXUHUV $-0D\&RUS+RXVWRQ7; 1DWLRQDO*XDUG3URGXFWV,QF0HPSKLV71 3HPNR,QF9HQWXUD&$ 5HHVH(QWHUSULVHV,QF5RVHPRXQW01 8OWUD,QGXVWULHV&RPPHUFH&$ =HUR,QWHUQDWLRQDO,QF%URQ[1< %6PRNH6HDOV 7\SH8/UDWHGVXUIDFHDSSOLHGVHOIDGKHVLYHSRO\SURS\OHQHRUVLOLFRQHUXEEHUVWULSV &RORU%ODFN $FFHSWDEOHSURGXFW3HPNR66LOLFRQVHDO &$VWUDJDOV 7\SH6WHHODGMXVWDEOHVXUIDFHPRXQWHGSXVKVLGH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $FFHSWDEOH3URGXFW3HPNR6HULHV '7KUHVKROGV 7\SH([WUXGHGDOXPLQXP $FFHSWDEOH3URGXFW1*3ZLWKYLQ\OEXPSHU (:HDWKHUVWULSSLQJ 7\SH([WUXGHGDOXPLQXPZLWKQHRSUHQHEXOE $FFHSWDEOHSURGXFW1*316$ )6ZHHS6WULSV 7\SH([WUXGHGDOXPLQXPZLWKQHRSUHQHVHDO $FFHSWDEOH3URGXFW1*39$ ),1,6+(6 $([FHSWZKHUHLQGLFDWHGRWKHUZLVHLQ+DUGZDUH6HWVFRPSO\ZLWKIROORZLQJ %7\SLFDOO\%UXVKHG&KURPHVWDLQOHVVVWHHO &6XUIDFH0RXQWHG&ORVHUV6SUD\SDLQWHGWRPDWFKRWKHUKDUGZDUH '6SHFLDOFDUHLVWREHWDNHQWRPDNHXQLIRUPWKHILQLVKRIDOOYDULRXVPDQXIDFWXUHGLWHPV (([WUXGHGDOXPLQXPSURGXFWVH[FHSWIRUWKUHVKROGVDQGVSHFLILHGJDVNHWLQJDUHQRWDFFHSWDEOH .(<&21752/6<67(0 $$FFHSWDEOH0DQXIDFWXUHUV .H\&RQWURO6\VWHPV,QF%HFKWHOVYLOOH3$ /XQG(TXLSPHQW&R,QF%DWK2+ 7HONHH,QF*OHQ5LGGOH3$ %&DELQHW6XUIDFHPRXQWHGKLQJHGSDQHOW\SHFDELQHWPDQXIDFWXUHGIURPFROGUROOHGIXUQLWXUH VWHHOHOHFWURZHOGHGFRQVWUXFWLRQZLWKPDQXIDFWXUHU¶VVWDQGDUGEDNHGHQDPHOILQLVK(TXLS ZLWKSLQWXPEOHUORFNLQJPHFKDQLVP6L]HGWRFRQWDLQLQGH[HGNH\VIRU3URMHFWSOXV SHUFHQWH[SDQVLRQ &.H\&RQWURO6\VWHP'XDOWDJLQGH[HGV\VWHPFRPSOHWHZLWKQXPEHUHGODEHOVDQGQXPEHUHG WDJVSHUPDQHQWNH\WDJVZRUNLQJNH\WDJVNH\ORDQDQGUHFHLSWV\VWHPWKUHHZD\FURVV LQGH[V\VWHPNH\JDWKHULQJHQYHORSHVDQGLQVWUXFWLRQPDQXDO 522),1* )RUUHSDLURIH[LVWLQJURRILQJWKHFXWWLQJRIWKHH[LVWLQJURRIVKDOOEHNHSWWRDPLQLPXPDQGZKHUH QHFHVVDU\PXVWEHPDGHLQDFOHDQDQGRUGHUO\PDQQHUWRSUHYHQWWKHDSSHDUDQFHRIDSDWFK 5HSDLUDOOGDPDJHWRH[LVWLQJDQGQHZURRILQJFDXVHGE\WKHZRUNRIWKLV&RQWUDFWDWQRDGGLWLRQDOFRVWWR WKH*RYHUQPHQW7KHZRUNPXVWEHH[HFXWHGLQVXFKDPDQQHUDVWRPDLQWDLQWKHLQWHJULW\RIWKH H[LVWLQJURRILQJPDQXIDFWXUHU VZDUUDQW\ 3UH5RRILQJ&RQIHUHQFH3ULRUWREHJLQQLQJURRILQJZRUNKROGD3UH5RRILQJ&RQIHUHQFHZLWK WKH SHUVRQQHO GLUHFWO\ UHVSRQVLEOH IRU WKH URRILQJ V\VWHPV ZRUN DV ZHOO DV WKH URRILQJ PDQXIDFWXUHU VWHFKQLFDOUHSUHVHQWDWLYH 5RRI'HVLJQ$VVXUDQFH,IWKHURRILQJSURMHFWLVVLJQLILFDQW6LJQLILFDQW5RRI$VLQJOHRUJURXS RIEXLOGLQJVJUHDWHUWKDQPVIRUZKHUHH[WHQXDWLQJFLUFXPVWDQFHVRIWKHURRI SURMHFWVXFKDVEXLOGLQJXVHFRQWHQWVDIHW\RUYLVLELOLW\UHTXLUHDURRILQJFRQVXOWDQWSURYLGHWKH VHUYLFHVRID5HJLVWHUHG5RRI&RQVXOWDQW55&FHUWLILHGE\WKH5RRI&RQVXOWDQW,QVWLWXWHRUD 5HJLVWHUHG3URIHVVLRQDODUFKLWHFWRU(QJLQHHUZKRVSHFLDOL]HVLQURRILQJWRDSSURYHWKHURRI DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH GHVLJQ7KHURRIFRQVXOWDQWPXVWEHHQJDJHGLQURRILQJGHVLJQDQGURRILQJFRQVWUXFWLRQDVKLV SULPDU\HQGHDYRU7KHURRIFRQVXOWDQWPXVWYHULI\LQZULWLQJWKDWWKHGHVLJQIRUWKHSURMHFWLVLQ DFFRUGDQFHZLWKWKHFXUUHQWHGLWLRQRINRCA Roofing and Waterproofing Manual8)& VDQG 5)3DQGVWDQGDUGLQGXVWU\SUDFWLFHVDQGEXLOGLQJFRGHV ,ID5RRI'HVLJQ$VVXUDQFH&RQVXOWDQWLVQHHGHGFRQVLGHUXVLQJD5HJLVWHUHG5RRI2EVHUYHU DVD4&VSHFLDOLVW 522)&29(5,1*6 5RRI FRYHULQJV DQG SURFHGXUHV PXVW FRPSO\ ZLWK WKH UHTXLUHPHQWV RI 8)& Roofing DQG 15&$Roofing and Waterproofing ManualIRXQGDWKWWSZZZQUFDQHWUSWHFKQLFDOPDQXDOPDQXDODVS[ DVWKHSULPDU\1$9)$&URRILQJFULWHULD5RRIVHOHFWLRQPXVWFRPSO\ZLWK8)&Roofing 522)&20321(176 D,QVXODWLRQ )RU H[LVWLQJ VWUXFWXUHV SURYLGH LQVXODWLRQ LQ DFFRUGDQFH ZLWK $6+5$( )RUQHZFRQVWUXFWLRQSURYLGH5LQVXODWLRQLQWKHFHLOLQJVDWWLFVSDFHVDQG VRIILWDUHDVIRULQWHULRUVSDFHV,QMHFWHGSRO\XUHWKDQHDQG8UHD)RUPDOGHK\GH)RDP ILHOG DSSOLHG LV QRW SHUPLWWHG 3URYLGH DFRXVWLFDO LQVXODWLRQ DERYH ZDOOV VHSDUDWLQJ EDWKURRPUHVWURRPVDQGFRUULGRUDQGDGMDFHQWRFFXSLHGVSDFHVDQGEHWZHHQRIILFHV DQGFRUULGRUV,QVXODWLRQPXVWKDYHDPLQLPXPVRXQGDWWHQXDWLRQUDWLQJRI67& ,QVXODWLRQ PXVW EH 3RO\LVRF\DQXUDWH 5LJLG %RDUG ,QVXODWLRQ 0LQHUDO )LEHU %ODQNHW ,QVXODWLRQWRFRQIRUPWR$670&ZLWK*ODVV0DW*\SVXP5RRI%RDUGIRUXVH DERYHWKHGHFNRULQVXODWLRQFRQIRUPLQJWR$670&&0ZKHUHQHFHVVDU\ E9DSRU5HWDUGHU'HWHUPLQHWKHQHHGDQGORFDWLRQLQWKHURRIDVVHPEO\IRUDYDSRU UHWDUGHU:KHUHWKHPHDQ-DQXDU\WHPSHUDWXUHLVGHJUHHV)DKUHQKHLWRUOHVVDQG WKH H[SHFWHG LQWHULRU UHODWLYH KXPLGLW\ LV RU JUHDWHU XVHD YDSRU UHWDUGHU 2WKHUZLVHXVH$6+5$(IRUWKHGHWHUPLQDWLRQ 9DSRU5HWDUGHUVDV,QWHJUDO)DFLQJ$OOR\FRQIRUPLQJWR$670%RU9DSRU 5HWDUGHUV 6HSDUDWH IURP ,QVXODWLRQ 9DSRU UHWDUGHU PDWHULDO PXVW EH PLO SRO\HWK\OHQHVKHHWLQJFRQIRUPLQJWR$670' $VOLSVKHHWLVUHTXLUHGWRVHSDUDWHWKHURRILQJSDQHOVIURPWKHLQVXODWLRQIDFLQJ ZKHUHWKHIDFLQJZRXOGEHLQGLUHFWFRQWDFWZLWKWKHURRILQJSDQHOV,IDVOLSVKHHWLV QHFHVVDU\IRUXVHZLWKDYDSRUUHWDUGHUXVHDOESHUVTXDUHIHHWURVLQVL]HG XQVDWXUDWHGEXLOGLQJSDSHU F3UHIDEULFDWHG &XUEV DQG (TXLSPHQW 6XSSRUW 3URYLGH 3UHIDEULFDWHG FXUEV DQG HTXLSPHQW VXSSRUWV RI VWUXFWXUDO TXDOLW\ KRWGLSSHG JDOYDQL]HG RU JDOYDQL]HG VKHHW VWHHOIDFWRU\SULPHGDQGSUHSDUHGIRUSDLQWLQJZLWKPLWHUHGDQGZHOGHGMRLQWV3URYLGH LQWHJUDOEDVHSODWHVDQGZDWHUGLYHUWHUFULFNHWV0LQLPXPKHLJKWRIFXUEPXVWEH LQFKHVDERYHILQLVKURRI G)DVWHQHUV 3URYLGH IDVWHQHUV WKDW PHHW DOO UHTXLUHPHQWV RI WKH 15&$ DQG )DFWRU\ 0XWXDO H:RRG1DLOHUV:RRGQDLOHUVVKDOOEHSUHVVXUHSUHVHUYDWLYHWUHDWHGLQDFFRUGDQFHZLWK $:3$06WDQGDUGVSHUPDQHQWO\PDUNHGRUEUDQGHGDQGLQVWDOOHGIOXVKZLWKWKHWRS RIWKHDGMDFHQWLQVXODWLRQERDUG I)ODVKLQJDQG6KHHW0HWDO3URYLGHIODVKLQJDQGVKHHWPHWDOZRUNLQFOXGLQJVFXSSHUV VSODVKSDQVDQGVKHHWPHWDOURRILQJ)ODVKLQJDQGVKHHWPHWDOPXVWEHSURYLGHGLQ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH DFFRUGDQFHZLWKURRIPDQXIDFWXUHU VSULQWHGLQVWDOODWLRQLQVWUXFWLRQVDQGLQFRPSOLDQFH ZLWK 15&$ DQG 60$&1$ UHFRPPHQGDWLRQV )DEULFDWH )ODVKLQJ DQG VKHHW PHWDO FRPSRQHQWV IURP &RSSHU /HDG&RDWHG &RSSHU VKHHW 6WHHO 6KHHW=LQF&RDWHG *DOYDQL]HG$670$$06WDLQOHVV6WHHO$670$7\SHRU 'ILQLVKRU3UH)LQLVKHG$OXPLQXP J*XWWHUVDQG'RZQVSRXWV3URYLGHJXWWHUVDQGGRZQVSRXWVFRPSDWLEOHZLWKURRILQJ PDWHULDODQGILQLVK&RQFHDOHGLQWHULRUJXWWHUVDQGGRZQVSRXWVDUHSURKLELWHG3URYLGH VSODVKJXDUGVDWSRLQWVRIGLVFKDUJH K5RRI2SHQLQJVDQG6XSSRUWV3URYLGHIODVKLQJVIRUURRIRSHQLQJVDQGVXSSRUWVDV UHFRPPHQGHGE\WKH15&$$VVXUHDOOSHQHWUDWLRQIODVKLQJVH[WHQGPLQLPXPPP LQFKHVDERYHWKHILQLVKHGURRIVXUIDFH L5RRI+DWFKHV O*XDUGV3URYLGHUDLOVRUJXDUGVLIUHTXLUHGVKRXOGEHDVUHTXLUHGE\WKH26+$WKH ,QWHUQDWLRQDO%XLOGLQJ&RGHRURWKHUDSSOLFDEOHVDIHW\VWDQGDUGV P7UDIILF3DGV3URYLGHRQURRIV\VWHPWRSURWHFWURRIIURPIRRWWUDIILF3URYLGHWUDIILF SDGV DURXQG URRI PRXQWHG PHFKDQLFDO HTXLSPHQW DQG XQGHUQHDWK UHPRYDEOH PHFKDQLFDOHTXLSPHQWDFFHVVSDQHOV7UDIILFSDGVPXVWEHRIFRPSDWLEOHPDWHULDOWR URRI 27+(5522),1* D/LJKWQLQJ3URWHFWLRQ/LJKWQLQJSURWHFWLRQFRPSRQHQWSHQHWUDWLRQVDQGDWWDFKPHQWV PXVWEHVHDOHGDQGIODVKHGDQGDQFKRUHGLQDSHUPDQHQWPDQQHUDQGLQDPDQQHUWR DYRLGWKHGHJUDGDWLRQRIWKHZDWHUWLJKWLQWHJULW\RIWKHURRIV\VWHP E5RRI 'UDLQV ([LVWLQJ :KHUH H[LVWLQJ URRI GUDLQV DUH WR EH UHXVHG LQ URRI UHSODFHPHQW FRQVWUXFWLRQ WKH FRQWUDFWRU PXVW SURYLGH QHZ FRPSDWLEOH IODVKLQJ PDWHULDOVDQHZGUDLQFODPSLQJULQJDQGQHZEROWVIRUDQFKRUDJH5HXVHRIH[LVWLQJ FODPSLQJULQJDQGEROWVLVXQDFFHSWDEOH ,17(5,25&216758&7,21 3$57,7,216 )L[HG3DUWLWLRQVZRRGIUDPHOLJKWJDJHVWHHOIUDPHFRQFUHWHPDVRQU\FRPSO\LQJZLWK$&, $6&(706DQGDVVRFLDWHG$6706WDQGDUGVRUFDVWLQSODFHFRQFUHWHFRPSO\LQJ ZLWK8)&General Building Requirements$&,DQG$&,0,QDGGLWLRQ LQWHULRUSDUWLWLRQVPXVWFRPSO\ZLWKWDEOHVIRUVRXQGLVRODWLRQDQGQRLVHUHGXFWLRQLQ&KDSWHU $UFKLWHFWXUDO*UDSKLF6WDQGDUGV,QFOXGHDVWDWHPHQWRIDGKHUHQFHWRWKHDSSOLFDEOHFULWHULD *\SVXPERDUGVWXGSDUWLWLRQVPD\EHVWDQGDUGJ\SVXPERDUGPRLVWXUHUHVLVWDQWRULPSDFW UHVLVWDQW 8VH FHPHQW ERDUG LQ VKRZHUV DQG RWKHU ZHW DUHDV 5HLQIRUFH SRLQWV ZKHUH GRRUNQREVFDQVWULNHDZDOODQGDQFKRUDJHSRLQWVIRUZDOOPRXQWHGHTXLSPHQW 'HPRXQWDEOHRU5HPRYDEOH3DUWLWLRQV0XVWEHRIPDWHULDOVDOORZHGE\FRGHDQGVKDOOEH DQFKRUHGILUPO\WRWKHVWUXFWXUHWRFDUU\WKHLURZQZHLJKWDVZHOODVLPSDFWIRUFHVDQGVHLVPLF ODWHUDOIRUFHV6RXQG7UDQVPLVVLRQ&ODVV67&UDWLQJDQG,PSDFW,VRODWLRQ&ODVV,,&UDWLQJ VKDOOEHLQDFFRUGDQFHZLWK$670(RU$670(IRUIUHTXHQF\GDWDDQGVKDOOPHHWWKH UHTXLUHPHQWVRIWKHLQWHQGHGXVHLQ3DUW7KHPDMRULW\RIWKHFRPSRQHQWVDQGKDUGZDUHPXVW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH EHSURYLGHGE\DVLQJOHPDQXIDFWXUHUDQGRQWKHPDQXIDFWXUHU VFXUUHQW*6$SULFHOLVW7KH SURGXFWPXVWEHLQFOXGHGRQWKH1$9)$&6HOHFWLRQ7RROIRU0RYDEOH:DOOV *OD]HG3DUWLWLRQVDQG,QWHULRU:LQGRZV0XVWEHRIWKHPDWHULDOVDOORZHGE\,%&DQGPXVW FRPSO\ZLWKILUHDQGVPRNHVHSDUDWLRQUHTXLUHPHQWV3URYLGHVDIHW\JOD]LQJDQGILUHUHVLVWDQW UDWLQJZKHUHWKH\DUHUHTXLUHG ,17(5,25'2256 :RRG'RRUV6WLOHDQGUDLOZRRGGRRUVPXVWEH:'0$,6$SUHPLXPRUFXVWRPJUDGH KHDY\ GXW\ RU H[WUD KHDY\ GXW\ )OXVK ZRRG GRRUV PXVW EH :'0$ ,6$ SUHPLXP RU FXVWRPJUDGHKHDY\GXW\RUH[WUDKHDY\GXW\RU:'0$,63&SO\SDUWLFOHERDUGFRUH RU6&/&SO\VWUXFWXUDOFRPSRVLWHOXPEHUFRUH'RRUVDGMDFHQWWRSDQHOLQJRUPLOOZRUN PXVWFRPSO\ZLWKFRUUHVSRQGLQJ$:,PLOOZRUNJUDGH3URYLGHLQWHULRUILUHGRRUVLQUDWHGZDOOV 6WHHOGRRUV0XVWEH$16,$/HYHORFFDVLRQDOXVHORZDEXVHW\SHVVXFKDVFORVHW GRRUVZLWKRXWORFNV/HYHOORZXVHPRGHUDWHDEXVHW\SHVVXFKDVRIILFHVWRUHURRPGRRUV /HYHOPRGHUDWHXVHKLJKDEXVHW\SHVVXFKDV%(4VOHHSLQJURRPGRRUV/HYHOKLJK XVHKLJKDEXVHW\SHVVXFKDVFRUULGRUVVWDLUZD\VDVVHPEO\VSDFHVDQGPDLQHQWU\GRRUV ZLWKDSK\VLFDOSHUIRUPDQFHOHYHORI $ 0D[LPXPGRRUXQGHUFXWPXVWQRWH[FHHGPP LQFK 6RXQG,QVXODWHG'RRUVDQG)UDPHV8WLOL]H6RXQG,QVXODWHG'RRUVDQG)UDPHVZLWKVRXQG FRQWUROZHDWKHUVWULSSLQJLQURRPVUHTXLULQJZDOODVVHPEOLHVWREHVRXQGLQVXODWHGZLWKD6RXQG 7UDQVPLVVLRQ&ODVV67&UDWLQJDVUHTXLUHG7KH67&UDWLQJIRUWKHGRRUDQGIUDPHDVVHPEO\ PXVWEHQRWOHVVWKDQWKHZDOODVVHPEO\67&UDWLQJ $OXPLQXP'RRUVDQG)UDPHV3URYLGHVZLQJW\SHDOXPLQXPGRRUVDQGIUDPHVFRPSOHWHZLWK IUDPLQJPHPEHUVWUDQVRPVVLGHOLWHVDQGDFFHVVRULHV)DEULFDWHRI$670%$OOR\ 76IRUH[WUXVLRQV 6WHHO'RRU)UDPHV$16,$)RUPIUDPHVZLWKZHOGHGFRUQHUVIRULQVWDOODWLRQLQPDVRQU\ SDUWLWLRQV DQG NQRFNGRZQ ILHOG DVVHPEOHG FRUQHUV IRU LQVWDOODWLRQ LQ PHWDO VWXG DQG *:% SDUWLWLRQV,QVWDOOIUDPHVLQDFFRUGDQFHZLWK6',)RUPVWRSVDQGEHDGVZLWKJDXJH VWHHO 3URYLGHDPLQLPXPRIWKUHHMDPEDQFKRUVDQGEDVHVWHHODQFKRUVSHUIUDPH]LQFFRDWHGRU SDLQWHGZLWKUXVWLQKLELWLYHSDLQWQRWOLJKWHUWKHJDXJH6HFXUHIUDPHVWRSUHYLRXVO\LQVWDOOHG FRQFUHWHRUPDVRQU\ZLWKH[SDQVLRQEROWVLQDFFRUGDQFHZLWK6',)3URYLGHPRUWDULQILOORI IUDPHVLQPDVRQU\ZDOOVDQGJ\SVXPERDUGFRPSRXQGLQILOODWHDFKMDPEDQFKRULQPHWDOIUDPH ZDOOV )LUHGRRUV3URYLGHLQFRQIRUPDQFHZLWK1)3$DQ1)3$)LUHGRRUVDQGIUDPHVPXVW EHDUWKHODEHORI8/)0RU:+,DWWHVWLQJWRWKHUDWLQJUHTXLUHG'RRUDQGIUDPHDVVHPEOLHV PXVWEHWHVWHGIRUFRQIRUPDQFHSHU1)3$RU8/%IRUQHXWUDOSUHVVXUHRU8/&IRU SRVLWLYHSUHVVXUH:RRGILUHGRRUVPXVWDOVRFRPSO\ZLWK$670( 3URYLGHVWDLQOHVVVWHHODVWUDJDOVFRPSO\LQJZLWK1)3$IRUILUHUDWHGDVVHPEOLHVDQG1)3$ IRUVPRNHFRQWURODVVHPEOLHV ,QWHULRU'RRU+DUGZDUH 3URYLGH WKH VHUYLFHV RI D FHUWLILHG GRRU KDUGZDUH FRQVXOWDQWWR SUHSDUH WKH GRRU KDUGZDUH VFKHGXOH 8QOHVV RWKHUZLVH QRWHG LQWHULRU GRRUV LQFOXGH ODWFK DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH KLQJHVGRRUVWRSVDQGGRRUVLOHQFHUV3URYLGHFORVHUVDQGNLFNSODWHVIRUILUHUDWHGFRUULGRU VWDLUZD\DQGKLJKXVHQRQUHVLGHQWLDOGRRUV D+LQJHV%+0$$*UDGH[PP[LQFKHVZLWKQRQ UHPRYDEOHSLQRUDQWLIULFWLRQEHDULQJKLQJHV E/RFNVDQG/DWFKHV)RUQRQUHVLGHQWLDOEXLOGLQJVXVH6HULHV2SHUDWLRQDO*UDGH 6HFXULW\*UDGHIRUVWDLUZD\VEXLOGLQJHQWUDQFHVFRUULGRUVDVVHPEO\VSDFHVDQG RWKHUKLJKXVHLQWHULRUGRRUV8VH6HULHV*UDGHIRUQRQUHVLGHQWLDOORFDWLRQV QRWXVLQJ6HULHVKDUGZDUH)RUUHVLGHQWLDOEXLOGLQJVXVH6HULHV*UDGHIRU LQWHULRUGRRUVD0RUWLVH/RFNVDQG/DWFKHV%+0$$6HULHV2SHUDWLRQ *UDGH6HFXULW\*UDGHE%RUHG/RFNVDQG/DWFKHV%+0$$6HULHV *UDGHRU*UDGH F([LW'HYLFHV%+0$$*UDGH3URYLGHWRXFKEDUVLQOLHXRIFRQYHQWLRQDO FURVVEDUVDQGDUPV8VHPDQXIDFWXUHU VLQWHJUDOWRXFKEDUVLQDOXPLQXPVWRUHIURQW GRRUV G&DUG.H\$FFHVV3URYLGHFDUGNH\W\SHDFFHVVXQLWVIRUVSHFLDOL]HGHQWULHV3URYLGH OLWKLXP EDWWHU\ SRZHUHG PDJQHWLF VWULSH NH\FDUG ORFNVHWV WKDWDUH $16,%+0$ $6HULHV*UDGHPRUWLVHRU$16,%+0$$6HULHV*UDGH F\OLQGULFDOORFNVWDPSHUUHVLVWDQW8/OLVWHGZLWKPPLQFKWKURZGHDGEROWPP LQFK WKURZ ODWFK EROW DX[LOLDU\ GHDGORFNLQJ ODWFK DQG PP LQFK EDFNVHW 3URYLGH KDUGZDUH NH\LQJ FRPSDWLEOH ZLWK WKH H[LVWLQJ EDVHZLGHNH\LQJ V\VWHP 5HSODFHPHQWLQWHUFKDQJHDEOHFRUHVPXVWEHFRPSDWLEOHZLWKWKH%HVW/RFNV\VWHP H.H\&DELQHW3URYLGHD.H\&DELQHWZLWKRYHUFDSDFLW\ 63(&,$/7,(6 &RPSDUWPHQWV&XELFOHV 7RLOHW3DUWLWLRQV)6$$3URYLGHWRLOHWFRPSDUWPHQWVDW PXOWLIL[WXUHWRLOHWURRPVRI7\SH,6W\OH%&HLOLQJ+XQJ&2YHUKHDG%UDFHGRU)2YHUKHDG EUDFHGDOFRYH5HLQIRUFHSDQHOVWRUHFHLYHSDUWLWLRQPRXQWHGDFFHVVRULHV8ULQDOVFUHHQVPXVW EH)6$$7\SH,,,6W\OH$IORRUVXSSRUWHGDQGZDOOKXQJRU6W\OH'ZDOOKXQJ:DOO KXQJXULQDOVFUHHQVPXVWEHVHFXUHGZLWKFRQWLQXRXVIODQJHVWRXULQDOVFUHHQDQGZDOO6WHHO DQG 3ODVWLF WRLOHW SDUWLWLRQV PXVW KDYH D UHFRYHUHG PDWHULDOV FRQWHQW RI WR SHUFHQW &KURPHSODWHG RU VWDLQOHVV VWHHO GRRU ODWFKHV DQG FRDW KRRNV 3URYLGH RQH FRDW KRRN SHU FRPSDUWPHQWGRRU/DWFKHVDQGKLQJHVIRUKDQGLFDSSHGFRPSDUWPHQWVPXVWFRPSO\ZLWK$%$ $FFHVVLELOLW\6WDQGDUGV 7RLOHW DQG %DWK $FFHVVRULHV 3URYLGH WRLOHW DQG EDWK DFFHVVRULHV DQG LQVWDOO SHU $%$ $FFHVVLELOLW\6WDQGDUGVDQGPDQXIDFWXUHUV UHTXLUHPHQWV $OOWRLOHWDFFHVVRULHVVKDOOEHRIPDWFKLQJGHVLJQDQGDOOIURPDVLQJOHPDQXIDFWXUHU%REULFN &RPSDQ\FDWDORJQXPEHUVDUHUHIHUUHGWRIRUSXUSRVHVRIHVWDEOLVKLQJDTXDOLW\3URGXFWVRI VLPLODU GHVLJQ IXQFWLRQ DQG TXDOLW\ IURP RWKHU PDQXIDFWXUHUV PD\ EH VXEPLWWHG IRU FRQVLGHUDWLRQ *UDE%DUV´DQG´6XUIDFHPRXQWHGVWUDLJKWJUDEEDUV%´DQG´OHQJWKV GLDPHWHUVDWLQILQLVK*UDEEDUVKDOOEHW\SHVWDLQOHVVVWHHOZLWKVDWLQILQLVK*UDE EDU VKDOO KDYH JDXJH PP ZDOO WKLFNQHVV DQG RXWVLGH GLDPHWHU &OHDUDQFH EHWZHHQWKHJUDEEDUDQGZDOOVKDOOEH&RQFHDOHGPRXQWLQJIODQJHVVKDOOEHWKLFN VWDLQOHVVVWHHOSODWH[DQGHTXLSSHGZLWKWZRVFUHZKROHVIRUDWWDFKPHQWWRZDOO )ODQJHFRYHUVVKDOOEHJDXJHGLDPHWHU[GHHSDQGVKDOOVQDSRYHUPRXQWLQJ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH IODQJHWRFRQFHDOPRXQWLQJVFUHZV(QGVRIJUDEEDUVKDOOSDVVWKURXJKFRQFHDOHGPRXQWLQJ IODQJHVDQGEHKHOLDUFZHOGHGWRIRUPRQHVWUXFWXUDOXQLW*UDEEDUVKDOOFRPSO\ZLWKEDUULHUIUHH DFFHVVLELOLW\JXLGHOLQHVLQFOXGLQJ$'$$*LQ86$IRUVWUXFWXUDOVWUHQJWK 6DQLWDU\1DSNLQ'LVSRVDO%6XUIDFHPRXQWHGVDQLWDU\QDSNLQGLVSRVDOVKDOOEHW\SH 6WDLQOHVVVWHHOZLWKDOOZHOGHGFRQVWUXFWLRQH[SRVHGVXUIDFHVVKDOOKDYHVDWLQILQLVK)URQWRI VDQLWDU\QDSNLQGLVSRVDOVKDOOKDYHVDPHGHJUHHRIDUFDQGPDWFKRWKHU%REULFN&RQWXUD6HULHV DFFHVVRULHV&RYHUVKDOOEHGUDZQRQHSLHFHVHDPOHVVFRQVWUXFWLRQDQGVHFXUHGWRFRQWDLQHU ZLWKDIXOOOHQJWKVWDLQOHVVVWHHOSLDQRKLQJH&RQWDLQHUVKDOOKDYHLQWHJUDOILQJHUGHSUHVVLRQIRU RSHQLQJFRYHU 6XUIDFH0RXQWHG0XOWL5ROO7RLOHW7LVVXH+ROGHU%'RXEOHUROOWRLOHWWLVVXHGLVSHQVHU VKDOOKDYHDKHDY\GXW\FDVWDOXPLQXPEUDFNHWZLWKVDWLQILQLVK7KHIWUHVLVWDQWVSLQGOHVVKDOO EHPROGHGKLJKLPSDFW$%6ZLWKUHWUDFWDEOHSLQVDQGFRQFHDOHGORFNLQJPHFKDQLVPV8QLWVKDOO DFFRPPRGDWHWZRVWDQGDUGFRUHWRLOHWWLVVXHUROOVXSWRPPGLDPHWHUVKHHWV 0LUURUVSHFLILHGLQ6HFWLRQ*ODVVDQG*OD]LQJ 7RXFKIUHHIRDPVRDSGLVSHQVHU*RMR6XUIDFHPRXQWHGVRDSGLVSHQVHUZLWKKDQGV IUHHEDWWHU\RSHUDWHGSXPSGLVSHQVHUP/FDSDFLW\$%63ODVWLFZLWKSRO\FDUERQDWHYLHZ ZLQGRZ\HDUZDUUDQW\ $XWRPDWLF3DSHU7RZHO'LVSHQVHU*HRUJLD3DFLILF0RGHO$HQ0RWLRQ,PSXOVH´ $XWRPDWHG7RXFKOHVV7RZHO'LVSHQVHU%ODFNZLWKWUDQVOXFHQWJUD\YLHZZLQGRZV+ROGVDQG GLVSHQVHVSURSULHWDU\KDUGZRXQGUROOWRZHOV'LPHQVLRQV´+[³:[´' 0RSDQG%URRP+ROGHU%ORQJ7\SHVWDLQOHVVVWHHOVDWLQILQLVK$QWLVOLSPRS KROGHUVKDYHVSULQJORDGHGUXEEHUFDP+ROGVPRSV»PPIURPZDOO 6XUIDFH0RXQWHG0LUURU%REULFN6XUIDFHPRXQWHGVWDLQOHVVVWHHOIUDPHGPLUURU%[ 1RTXDOLW\IORDWJODVVPLUURUHOHFWURO\WLFDOO\FRSSHUSODWHG\HDUJXDUDQWHHDJDLQVW VLOYHUVSRLODJHJDJDOYVWHHOEDFNZLWKFRQFHDOHGPRXQWLQJEUDFNHWDQGVHWVFUHZV WKLFNSRO\HWK\OHQHEDFNSDGGLQJ 8WLOLW\+RRN%%ULJKWSROLVKHGVWDLQOHVVVWHHO)ODQJHLV[[PP +RRN»PPZLGHSURMHFWVPPIURPZDOO ´6XUIDFHPRXQWHGVWUDLJKWJUDEEDUV%´OHQJWKGLDPHWHUVDWLQILQLVK*UDE EDUVKDOOEHW\SHVWDLQOHVVVWHHOZLWKVDWLQILQLVK*UDEEDUVKDOOKDYHJDXJHPP ZDOOWKLFNQHVVDQGRXWVLGHGLDPHWHU&OHDUDQFHEHWZHHQWKHJUDEEDUDQGZDOOVKDOOEH &RQFHDOHGPRXQWLQJIODQJHVVKDOOEHWKLFNVWDLQOHVVVWHHOSODWH[DQG HTXLSSHGZLWKWZRVFUHZKROHVIRUDWWDFKPHQWWRZDOO)ODQJHFRYHUVVKDOOEHJDXJH GLDPHWHU[GHHSDQGVKDOOVQDSRYHUPRXQWLQJIODQJHWRFRQFHDOPRXQWLQJVFUHZV(QGVRI JUDEEDUVKDOOSDVVWKURXJKFRQFHDOHGPRXQWLQJIODQJHVDQGEHKHOLDUFZHOGHGWRIRUPRQH VWUXFWXUDOXQLW*UDEEDUVKDOOFRPSO\ZLWKEDUULHUIUHHDFFHVVLELOLW\JXLGHOLQHVLQFOXGLQJ$'$$* LQ86$IRUVWUXFWXUDOVWUHQJWK 5HFHVVHG $XWRPDWLF 3DSHU 7RZHO 'LVSHQVHU *HRUJLD 3DFLILF 0RGHO $ HQ0RWLRQ ,PSXOVH ´ $XWRPDWHG 7RXFKOHVV 7RZHO 'LVSHQVHU 5HFHVVHV ´ LQWR ZDOO J%ODFN ZLWK WUDQVOXFHQW JUD\ YLHZ ZLQGRZV +ROGV DQG GLVSHQVHV SURSULHWDU\KDUGZRXQG UROO WRZHOV 'LPHQVLRQV´+[´:[´' 0DUNHU%RDUGVDQG7DFN%RDUGV3URYLGHSRUFHODLQHQDPHOPDUNHUERDUGVIXVHGWRDQRPLQDO JDXJHVWHHOVKHHWDQGWDFNERDUGVRIFRUNZLWKDWHQVLOHVWUHQJWKRIDWOHDVWSVLZKHQ WHVWHGDFFRUGLQJWR$670)ZLWKZRYHQRUYLQ\OFRYHULQJ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH 6LJQDJH $OO GRRUV PXVW KDYH DQ LGHQWLI\LQJ GHYLFH $OO KDQGLFDS DFFHVVLEOH IDFLOLWLHV PXVW XWLOL]HVLJQDJHZKLFKPHHWVFXUUHQW$%$$FFHVVXELOLW\6WDQGDUGVUHTXLUHPHQWVZLWKUHJDUGWR %UDLOOH UDLVHG FKDUDFWHUV ILQLVKHV FRQWUDVW VL]H DQG PRXQWLQJ KHLJKW ,I URRP QDPHV DUH VXEMHFWWRIUHTXHQWFKDQJHSURYLGHDQLQWHUFKDQJHDEOHVWULSWREHXWLOL]HGWRIDFLOLWDWHUHPRYDO DQGUHSODFHPHQW /RFNHUV3URYLGHORFNHUVWRPHHW)6$$/5HY-HQDPHOHGVWHHOZLWKVSHFLDOEDVHV 6KHOYLQJ3URYLGHVWHHOVKHOYLQJ &RXQWHUV 3URYLGH VROLG SODVWLF RU SODVWLF ODPLQDWH FRXQWHU WRSV DQG EDFN VSODVKHV $:, &XVWRPJUDGH &DELQHWV 3URYLGH FDELQHWU\ DQG PLOOZRUN LWHPV ZLWK DVVRFLDWHG DFFHVVRULHV DQG KDUGZDUH &DELQHWU\PXVWEH$:,SUHPLXPRUFXVWRPJUDGHDQGKDYHFRQFHDOHGKLQJHVZLWKDGMXVWDEOH VWDQGDUGVIRUVKHOYHV &DVHZRUN3URYLGHDOOEXLOWLQSUHPDQXIDFWXUHGPHWDOFDELQHWU\IRUVSHFLDOL]HGIXQFWLRQVVXFK DVODERUDWRULHVOLEUDULHVPHGLFDODQGGHQWDOIDFLOLWLHV&DVHZRUNPXVWFRPSO\ZLWK0LO6WG &ORVHWV3URYLGHSUHPDQXIDFWXUHGRUPLOOZRUNFORVHWVRUSUHIDEULFDWHGFRDWFORVHWV )LUH([WLQJXLVKHU&DELQHWV $)LUH([WLQJXLVKHU&DELQHWV)XUQLVKDWRWDORIVHYHQVHPLUHFHVVHGILUHH[WLQJXLVKHU FDELQHWVHTXDOWR/DUVHQ)LUH([WLQJXLVKHU&DELQHW,QVWDOODVLQGLFDWHGRQWKHGUDZLQJVDV)(& 0RGHO D6HPLUHFHVVHG5 6L]H[[GHHSFOHDULQVLGH 0DWHULDO6WHHOZLWKIDFWRU\EDNHGSULPHFRDWRISDLQW 7ULP)ODW7ULP 'RRU)XOO'6$JODVVSDQHO %)LUH([WLQJXLVKHU)XUQLVKDWRWDORIVHYHQILUHH[WLQJXLVKHUV,QVWDOODVLQGLFDWHGRQWKH GUDZLQJVDV)(%¶VDQGLQ)(&¶V ([WLQJXLVKHU0XOWLSXUSRVHGU\FKHPLFDOW\SHOEQRPLQDOFDSDFLW\ )LUHVWRSSLQJ 3HQHWUDWLRQV 3URYLGH DOO VOHHYHV FDXONLQJ DQG IODVKLQJ IRU ILUHVWRSSLQJ SHQHWUDWLRQV (QWUDQFH)ORRU*ULOOHVDQG0DWV3URYLGHUHFHVVHGSDQRUVXUIDFHIORRUPDWVDWPDLQHQWUDQFH RQO\RUDOOEXLOGLQJHQWUDQFHV 2UQDPHQWDO0HWDO:RUN3URYLGHRUQDPHQWDOPHWDOZRUN 2WKHU,QWHULRU6SHFLDOWLHV0RWRUL]HGSURMHFWLRQVFUHHQPXVWEHZDOORUFHLOLQJRUDERYHFHLOLQJ PRXQWLQJ3XOOGRZQSURMHFWLRQVFUHHQVPXVWEHSURYLGHGLQOLHXRIPRWRUL]HGSURMHFWLRQVFUHHQV DVDSSURYHGE\WKH$FWLYLW\ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH ,17(5,25),1,6+(6 :$//),1,6+(6 8QOHVV RWKHUZLVH QRWHG LQ WKH 5)3 SULPDU\ ZDOO ILQLVK LV SDLQWHG J\SVXP ZDOO ERDUG 3URYLGH ILUH UHVLVWLYHFRQVWUXFWLRQDQGILQLVKHVIRUILUHVHSDUDWLRQEHWZHHQDUHDVRIWKHEXLOGLQJLQDFFRUGDQFHZLWK WKHODWHVWDGRSWHGYHUVLRQRIWKH,%&DQG1)3$3URYLGHZDWHUUHVLVWDQWFHPHQWLWLRXVERDUGDW IORRUVDQGZDOOVRIWXEVDQGVKRZHUV &HUDPLF7LOH3URYLGHFHUDPLFWLOHZDOOV\VWHPVDVGHILQHGLQWKH7LOH&RXQFLORI$PHULFD7&$ KDQGERRNIRUFHUDPLFWLOHLQVWDOODWLRQDQGPDWHULDOVIRUWKHVHUYLFHUHTXLUHPHQWVOLVWHG3URYLGH LQVWDOODWLRQDQGPDWHULDOVLQDFFRUGDQFHZLWK$16,$$VHULHVVWDQGDUGVH[FHSWGRQRW XVHRUJDQLFDGKHVLYHV3URYLGHPDQXIDFWXUHU VIXOOUDQJHRIFRORUVDQGVW\OHV7LOHPXVWEHD PLQLPXP RI RQH JUDGH DERYH EDVH JUDGH &RRUGLQDWH ZLWK FHUDPLFEDWK DFFHVVRULHV IRU PRGXODULW\,QFOXGHDOOWULPSLHFHVFDSVVWRSVDQGUHWXUQVWRFRPSOHWHLQVWDOODWLRQ )/225),1,6+(6 3URYLGHQHZIORRULQJPDWHULDOVDVUHTXLUHG$OOIORRULQJPDWHULDOVDGKHVLYHVILQLVKFRDWVVHDOHUVDQG PRUWDUPDWHULDOVPXVWPHHWRUH[FHHG(3$UHTXLUHPHQWVIRUWR[LFVXEVWDQFHFRQWHQWUHVWULFWLRQVDQGDLU TXDOLW\UHTXLUHPHQWVDQGPHHWRUH[FHHGILUHSURWHFWLRQUHTXLUHPHQWVVXFKDVVPRNHDQGIODPHVSUHDG UHTXLUHPHQWV :KHQ OD\LQJ EURDGORRP FDUSHWV DQG UHVLOLHQW IORRULQJ XVH WKH ZLGHVW VKHHW PDWHULDOV DYDLODEOHWRDYRLGRUPLQLPL]HWKHQXPEHUDQGH[WHQWRIVHDPV:KHQVHDPVDUHUHTXLUHGORFDWHVHDPV DW LQIUHTXHQW WUDIILF DUHDV &RQWUDFWRU LV UHTXLUHG WR VXEPLW VHDP OD\RXW WR &RQWUDFWLQJ 2IILFHU IRU DSSURYDOSULRUWRLQVWDOODWLRQ &HUDPLF 7LOH 3URYLGH FHUDPLF WLOH IORRU V\VWHPV DV GHILQHG LQ WKH 7LOH &RXQFLO RI $PHULFD 7&$KDQGERRNIRUFHUDPLFWLOHLQVWDOODWLRQDQGPDWHULDOVIRUWKHVHUYLFHUHTXLUHPHQWVOLVWHG 3URYLGHLQVWDOODWLRQDQGPDWHULDOVLQDFFRUGDQFHZLWK$16,$$VHULHVVWDQGDUGVH[FHSW GRQRWXVHRUJDQLFDGKHVLYHV3URYLGHPDQXIDFWXUHU VIXOOUDQJHRIFRORUVDQGVW\OHV7LOHPXVW EHDPLQLPXPRIRQHJUDGHDERYHEDVHJUDGH3URYLGHFHUDPLFRUSRUFHODLQWLOHZLWKDPLQLPXP EUHDNLQJ VWUHQJWK RI NJ SRXQGV $670 & DQG D PD[LPXP DEVRUSWLRQ UDWH RI $670&7LOHPXVWKDYHDPLQLPXPFRHIILFLHQWRIIULFWLRQZHWDQGGU\RI$670 & 5HVLOLHQW )ORRULQJ 0HHW RU H[FHHG DSSOLFDEOH $%$ $FFHVVLELOLW\ 6WDQGDUGV KRUL]RQWDO UHTXLUHPHQWV ,QVWDOO IORRULQJ SHU PDQXIDFWXUHU V UHFRPPHQGHG PHWKRGV DQG DGKHVLYHV 3URYLGHPDQXIDFWXUHUVIXOOOLQHRIFRORUDQGSDWWHUQVHOHFWLRQVLQFOXGLQJPXOWLFRORUSDWWHUQV /LQROHXP6KHHWRU7LOH)ORRULQJPXVWEHPPLQFKJDJHPLQLPXPSVLVWDWLFORDG OLPLW$670)DQGZLWKPXOWLFRORUSDWWHUQDQGFRORUH[WHQGLQJWKURXJKRXWWKLFNQHVV$670 )7\SH,5HVLOLHQWKRPRJHQHRXVYLQ\OVKHHWIORRULQJPXVWEHFRPPHUFLDOTXDOLW\PP LQFK RYHUDOO JDJH ZLWK PLQLPXP PP LQFK WKLFN ZHDU OD\HU SURWHFWLYH XUHWKDQHILQLVK$670)7\SH,,*UDGH&ODVV$5HVLOLHQWYLQ\OFRPSRVLWLRQWLOHPXVWEH FRPPHUFLDOJUDGHPPLQFKJDJH$670)&RPS&ODVVWKURXJKSDWWHUQ &DUSHW &DUSHW PDQXIDFWXUHU DQG LQVWDOOHU PXVW EH H[SHULHQFHG HVWDEOLVKHG DQG LQ JRRG VWDQGLQJZLWKWKHLQGXVWU\&DUSHWEURDGORRPRUWLOHPXVWEHLQVWDOOHGSHUWKH&DUSHW 5XJ ,QVWLWXWH VUHFRPPHQGDWLRQV&DUSHWPXVWEHWXIWHGWH[WXUHGORRSFXWORRSRUWLSVKHDUHGD PLQLPXPRIR]IDFHZHLJKWPLQLPXPGHQVLW\RISUHPLXPEUDQGHG\DUQRU VROXWLRQG\HG7\SHRUFRQWLQXRXVKROORZILODPHQWQ\ORQ&DUSHWPXVWEHPXOWLFRORUDQG SDWWHUQHG IRU VRLO DQG ZHDU KLGLQJ SURSHUWLHV &DUSHW PXVW KDYH KLJK SHUIRUPDQFH EDFNLQJ ZDUUDQWHGDJDLQVW]LSSHULQJHGJHUDYHOLQJDQGGHODPLQDWLRQEHDQWLVWDWLFDQGDQWLPLFURELDO &DUSHWPXVWPHHW)ODPPDELOLW\UDWLQJVJHQHUDWHOHVVWKDQDUDWLQJ$670(PHHWWKH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH &ULWLFDO 5DGLDQW )OX[ &ODVVLILFDWLRQ RI QRW OHVV WKDQ :VT FP $670 ( :KHUH LQGLFDWHG LQ WKH URRP UHTXLUHPHQWV SURYLGH DWWDFKHG SRO\XUHWKDQH FXVKLRQ RU VHSDUDWH SRO\XUHWKDQHFXVKLRQIRUGRXEOHVWLFNSDGLQVWDOODWLRQV$670DQG$670 :DOO%DVH3URYLGHSRUFHODLQRUFHUDPLFWLOHEDVHIRUSRUFHODLQRUFHUDPLFWLOHIORRU3URYLGH VROLGWKURXJKFRORUSUHIRUPHGUXEEHURUYLQ\OEDVHIRUFDUSHWHGUHVLOLHQWIORRULQJDUHDV3URYLGH DVHDODQWEHWZHHQEDVHDQGIORRUILQLVKLQDOOZHWDUHDV &(,/,1*),1,6+(6 8QOHVVRWKHUZLVHQRWHGLQWKHURRPUHTXLUHPHQWVDFRXVWLFDOFHLOLQJSDQHOVPXVWEHLQFKE\LQFK ZLWKDPLQLPXPOLJKWUHIOHFWDQFHRI&ODVV$IODPHVSUHDGRUOHVVDQGVPRNHGHYHORSPHQWRI RUOHVV$670($FRXVWLFDOFHLOLQJSDQHOVPXVWKDYHPLQLPXPUHF\FOHGFRQWHQWDQGFRQIRUPWR $670(3DQHOVPXVWKDYHDIDFWRU\DSSOLHGVWDQGDUGZDVKDEOHSDLQWHGILQLVKRU7\SH,9ZLWK IDFWRU\DSSOLHGSODVWLFPHPEUDQHIDFHGYLQ\O)RUPRU3URYLGHVTXDUHHGJHH[FHSWDVQRWHG 8QOHVVRWKHUZLVHQRWHGLQWKHURRPUHTXLUHPHQWVIRUHQWUDQFHOREE\UHVWURRPVDQGVKRZHUVSURYLGHD SDLQWHGVXVSHQGHGJ\SVXPERDUGFHLOLQJ([SRVHGVWUXFWXUDOV\VWHPVVKDOOEHSDLQWHG 3$,17,1* $OO SDLQWLQJ DQG FRDWLQJ PDWHULDOV PXVW EH ORZ 92& FRPSO\ ZLWK ORFDO DLU TXDOLW\ FRQWURO ODZV DQG UHJXODWLRQV DQG FRQIRUP WR WKH 0DVWHU V 3DLQWHUV ,QVWLWXWH V 03,Architectural, Interior Systems ManualDQGWKH03, VMaintenance and Repainting ManualUHFRPPHQGDWLRQVIRUSDLQWV\VWHPVVXUIDFH SUHSDUDWLRQDQGDSSOLFDWLRQV 3URYLGHPLQLPXPRIRQHSULPHFRDWDQGWZRILQLVKFRDWV7KHSULPHFRDWPXVWQRWEHFRPELQHGZLWK WH[WXUHRURWKHUFRDWLQJV6HDODQGSULPHDOOVXUIDFHVWRFRYHUXQGHUO\LQJVWDLQVRUGLVFRORUDWLRQWKDWPD\ DIIHFWILQLVKSDLQW)LQLVKFRDWVPXVWSURYLGHIXOOFRYHUDJHRIXQGHUFRDWVDQGVXEVWUDWHV$OOZDOOVDQG FHLOLQJVLQZHWDUHDPXVWKDYHVHPLJORVVSDLQW$OOZRRGRUPHWDOFDVHGRSHQLQJVGRRUWULPVDQG FDVLQJVZLQGRZWULPVDQGFDVLQJDQGRWKHUILQLVKWULPPXVWKDYHVHPLJORVVSDLQW$OOLQWHULRUZDOOVDQG FHLOLQJVPXVWKDYHVDWLQRUHJJVKHOOILQLVK)RUSUHYLRXVO\SDLQWHGVXUIDFHVSULPHDOOVXUIDFHVWRHQVXUH FRPSDWLELOLW\RIILQLVKFRDWV'RQRWSDLQWSUHILQLVKHGVXUIDFHVH[FHSWDVQRWHG 3URYLGH,QVWLWXWLRQDO/RZ2GRU/RZ92&/DWH[SDLQWRU+LJK3HUIRUPDQFH$UFKLWHFWXUDO/DWH[V\VWHPVDV GHILQHGDQGDSSURYHGE\WKH03,6\VWHPV0DQXDOIRUWKHYDULRXVVXEVWUDWHVUHTXLUHGWREHSDLQWHG 3DLQW&RORU 6HOHFWLRQ 3URYLGH SDLQW V\VWHPV WHVWHG WR 'HWDLOHG 3HUIRUPDQFH /HYHOVWDQGDUGDV GHILQHGE\03,3DLQWVPXVWEHUHDGLO\DYDLODEOHIRUSXUFKDVHLQVWDQGDUGFRORUV 6(59,&(6 3/80%,1* 3URYLGHSOXPELQJIL[WXUHVDSSOLDQFHVDQGHTXLSPHQWFRPSOHWHDQGXVDEOHDVUHTXLUHGE\3DUW$OO SOXPELQJ IL[WXUHV DSSOLDQFHV DQG HTXLSPHQW SLSLQJ YDOYHV DFFHVVRULHV DQG DSSXUWHQDQFHV PXVW FRPSO\ZLWK,QWHUQDWLRQDO3OXPELQJ&RGH,3&DQGDOORWKHUDSSOLFDEOHFRGHVDQGVWDQGDUGVLQFOXGLQJ HQHUJ\ZDWHUFRQVHUYDWLRQDQGORFDODFWLYLW\UHJXODWLRQVDQGVWDQGDUGV3URYLGHDOOSOXPELQJIL[WXUHVWR PHHWFXUUHQWFULWHULDRI(3$:DWHUVHQVHSURJUDPKWWSZZZHSDJRYZDWHUVHQVH 'RPHVWLF:DWHU3URYLGH$670%7\SH.RU/FRSSHUWXELQJDQGILWWLQJVIRUSLSHVL]HV LQFKHVRUVPDOOHU3URYLGH7\SH/WXELQJDERYHJURXQGZLWKVROGHUILWWLQJV)RUEXULHGSLSLQJ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH XVH7\SH.WXELQJZLWKVROGHUILWWLQJVRU&KORULQDWHGSRO\YLQ\OFKORULGH&39&3ODVWLFSLSH ILWWLQJVDQGVROYHQWFHPHQWSHU$670''0IRUVL]HVLQFKHVDQGVPDOOHU 3URYLGHPLQHUDOILEHULQVXODWLRQZLWKYDSRUEDUULHURQGRPHVWLFZDWHUKRWDQGFROGVXSSO\DQG UHFLUFXODWLRQSLSLQJ3URYLGHUHFLUFXODWLQJSXPSVRULQVWDQWDQHRXVZDWHUKHDWHUVIRUKRWZDWHU V\VWHPV ZLWK IL[WXUHV JUHDWHU WKDQ IW IURP KRW ZDWHU VRXUFH 3URYLGH ZDWHU KDPPHU DUUHVWRUVSHU3',67':+DVUHTXLUHGIRUUDSLGZDWHUVKXWRIIVFHQDULRV$OOZDWHUYDOYHV H[FHSWIRUIL[WXUHVKXWRIIYDOYHVPXVWEH$16,%EUDVVIXOOSRUWEDOOW\SH$OOSOXPELQJ IL[WXUHVPXVWKDYHVHSDUDWHVKXWRIIYDOYHV$OOSLSLQJPXVWEHFRQFHDOHGLQZDOOVDWWLFVSDFHV RULQFUDZOVSDFHVXQGHUIORRUV3URYLGHDFFHVVSDQHOVIRUYDOYHVEHKLQGZDOOV1RXQGHUVODE ZDWHUSLSLQJLVDOORZHG)LWWLQJVIRUDQQHDOHGFRSSHUWXELQJPXVWFRQIRUPWR$16,%O 6ROGHUDQGIOX[PXVWEHOHDGIUHH([SRVHGH[WHULRUSLSLQJLVSURKLELWHGXQOHVVRWKHUZLVHQRW SUDFWLFDO3URYLGHLGHQWLILFDWLRQIRUSLSLQJDQGHTXLSPHQW :DOO 3HQHWUDWLRQV 3LSLQJ ZKLFK SHQHWUDWHV ILUH UDWHG ZDOOV PXVW EH FRPSOHWHO\VHDOHG WR PDLQWDLQILUHUHVLVWDQFHLQWHJULW\DVUHTXLUHGE\&RGH3HQHWUDWLRQVWKURXJKZDOOVWKDWDUHQRW ILUHUDWHGPXVWEHDGHTXDWHO\VXSSRUWHGDQGVHDOHG3LSHSHQHWUDWLRQVWKURXJKH[WHULRUZDOOV PXVWEHVOHHYHGFDXONHGZLWKZHDWKHUSURRIVHDODQWDQGSURYLGHGZLWKILQLVKWULP 3/80%,1*),;785(6 3URYLGHIL[WXUHVFRPSOHWHZLWKILWWLQJVDQGFKURPLXPSODWHGRUQLFNHOSODWHGEUDVVSROLVKHGEULJKWRU VDWLQVXUIDFHWULP$OOIL[WXUHVILWWLQJVDQGWULPPXVWEHIURPWKHVDPHPDQXIDFWXUHUDQGPXVWKDYHWKH VDPHILQLVK$FFHVVSDQHOVPXVWEHSURYLGHGIRUDOOEDWKWXEVDQGVKRZHUVH[FHSWDWH[WHULRUDQGSDUW\ ZDOOVDQGZKHUHWXERUVKRZHUVDUHEDFNWREDFN3URYLGHFOHDQRXWVLQDFFRUGDQFHZLWKWKHSOXPELQJ FRGH5RWDWHRUH[WHQGFOHDQRXWVUHTXLUHGWRIDFLOLWDWHPDLQWHQDQFHDQGFOHDULQJRIEORFNDJHLQZDVWH SLSLQJ )DXFHWV $OO IDXFHWV PXVW EH EUDVV FRQVWUXFWLRQ ZDVKHUOHVV W\SH ZLWK VHDOV DQG VHDWV FRPELQHGLQRQHUHSODFHDEOHFHUDPLFGLVNYDOYHFDUWULGJHGHVLJQHGWREHLQWHUFKDQJHDEOHZLWK DOOODYDWRULHVEDWKWXEVDQGNLWFKHQVLQNVRUKDYLQJUHSODFHDEOHVHDOVDQGVHDWVUHPRYDEOH HLWKHUDVDVHDWLQVHUWRUDVDSDUWRIDUHSODFHDEOHYDOYHXQLW)DXFHWVSURYLGHGPXVWEHRIWKH VDPHW\SHDQGPDQXIDFWXUHUWKURXJKRXWWKHIDFLOLW\XQOHVVRWKHUZLVHQRWHG/DYDWRU\IDXFHWV PXVW EH 86 (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ (3$ :DWHUVHQVHÆ FHUWLILHG DQG ODEHOHG EDWKURRPVLQNIDXFHWV :DWHU &ORVHWV :DWHU FORVHWV PXVW EH LQ DFFRUGDQFH ZLWK $16, $ ZLWK WULP FRQIRUPLQJWR$:DWHUFORVHWVPXVWEHYLWUHRXVFKLQDDQGKDYHDQHORQJDWHGERZO ZLWKWULSOHYHUXQOLQHGWDQNFORVHFRXSOHGVLSKRQMHWIORRURXWOHWZLWKZD[JDVNHWIODQJHDQGDQ DQWLVLSKRQIORDWYDOYH3URYLGHZKLWHFORVHGIURQWVHDWDQGFRYHUIRUSULYDWHWRLOHWVDQGRSHQ IURQWVHDWFRYHUIRUSXEOLFIDFLOLWLHV:DWHUFRQVXPSWLRQPXVWEHQRJUHDWHUWKDQJDOORQ PD[LPXPSHUFRPSOHWHIOXVKLQJF\FOH3URYLGHVHOIFORVLQJPHWHULQJW\SHIOXVKYDOYHRQIOXVK YDOYHW\SHZDWHUFORVHWVXQOHVVHOHFWURQLFFRQWUROLVVSHFLILHGLQ3DUW0D[LPXPIOXVKYROXPH PXVWQRWH[FHHGJDOORQSHUIOXVK*3)/LWHUSHUIOXVK/3)IRUVLQJOHIXQFWLRQIOXVK YDOYHV'XDOIXQFWLRQIOXVKYDOYHVPXVWSURYLGHDIOXVKRIWR*3)WR/3)RU *3)/3)DYHUDJHIRUORZYROXPHIOXVKHVDQGRQHKLJKYROXPHIOXVK7DQNW\SH ZDWHUFORVHWVPXVWEH86(QYLURQPHQWDO3URWHFWLRQ$JHQF\(3$:DWHUVHQVHÆFHUWLILHG DQGODEHOHGWRLOHWV 8ULQDOV3URYLGH86(QYLURQPHQWDO3URWHFWLRQ$JHQF\(3$:DWHUVHQVHÆFHUWLILHGDQG ODEHOHGFHUDPLFW\SHXULQDOV /DYDWRULHV8QOHVVRWKHUZLVHVSHFLILHGE\3DUWODYDWRULHVPXVWEHLQWHJUDOWRWKHYDQLW\ FRXQWHUWRSV(DFKODYDWRU\PXVWEHSURYLGHGZLWKKRWDQGFROGZDWHUWHPSHUHGE\PHDQVRID PL[LQJYDOYHRUFRPELQDWLRQIDXFHW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH 6LQNV $60($16, $0 VLQN JDJH VWDLQOHVV VWHHO ZLWK LQWHJUDO PRXQWLQJ ULP PLQLPXPGLPHQVLRQVRIPPLQFKHVZLGHIRUWZRFRPSDUWPHQWRUPPLQFKHV ZLGHIRURQHFRPSDUWPHQWE\PPLQFKHVIURQWWRUHDUZLWKOHGJHEDFNDQGXQGHUVLGHV FRDWHGZLWKVRXQGGDPSHQLQJPDWHULDO :DWHU&RROHUV$5,ZDOOPRXQWHGEXEEOHUVW\OHDLUFRROHGFRQGHQVLQJXQLWP/ SHU VHFRQG JSK PLQLPXP FDSDFLW\ VWDLQOHVV VWHHO VSODVK UHFHSWRU GRXEOH ZDOO KHDW H[FKDQJHU DQG DOO VWDLQOHVV VWHHO FDELQHW ,QVWDOO LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHUV LQVWUXFWLRQV 6HUYLFH VLQNV $60( $0 ZKLWH HQDPHOHG FDVWLURQ RU $60( $0ZKLWH YLWUHRXV FKLQD ZDOO PRXQWHG DQG IORRU VXSSRUWHG E\ ZDOO RXWOHW FDVWLURQ 3WUDS PLQLPXP GLPHQVLRQVRIPPLQFKHVZLGHE\PPLQFKHVIURQWWRUHDUZLWKPP LQFKVSODVKEDFNDQGVWDLQOHVVVWHHOULPJXDUG3URYLGH$60($0FRSSHUDOOR\EDFN PRXQWHG FRPELQDWLRQ IDXFHWV ZLWK YDFXXP EUHDNHU DQG PP LQFK H[WHUQDO KRVH WKUHDGV 0RS6LQNV3UHFDVWWHUUD]]RRU$60($0ZKLWHYLWUHRXVFKLQDIORRUPRXQWHGPRS VLQNPP[PP[PPLQFKHV[LQFKHV[LQFKHV7HUUD]]RPXVWEHPDGH RIPDUEOHFKLSVFDVWLQZKLWH3RUWODQGFHPHQWWRDFRPSUHVVLYHVWUHQJWKRIQRWOHVVWKDQ P3D36,GD\VDIWHUFDVWLQJ3URYLGHEUDVVERG\GUDLQVZLWKQLFNHOEURQ]HVWUDLQHUV FDVWLQWHJUDOZLWKPRSVLQN3URYLGHVWDLQOHVVVWHHOULPJXDUGIRUPRSVLQN3URYLGHFKURPH SODWHGH[SRVHGKRWDQGFROGZDWHUIDXFHWV$60($0ZDOOPRXQWHGFRSSHUDOOR\IDXFHWV VZLQJVSRXWZLWKPPLQFKKRVHFRQQHFWLRQYDFXXPEUHDNHUDQGSDLOKRRN3URYLGH PRSKDQJHURQZDOODERYHVLQNVXLWDEOHIRUIRXUPRSV '20(67,&:$7(5',675,%87,21 1DWXUDO*DVRU3URSDQH)LUHG6WRUDJH:DWHU+HDWHUV3URYLGHKLJKHIILFLHQF\VWRUDJHW\SH QDWXUDOJDVRUSURSDQHILUHGZDWHUKHDWHUVSHU$16,=RU$16,=PHHWLQJ$*$ UHTXLUHPHQWV )RU &DOLIRUQLD XQLW HIILFLHQF\ PXVW PHHW RU H[FHHG WKDW OLVWHG LQ WKH 7LWOH 6WDQGDUGV (TXLSPHQW HIILFLHQF\ PXVW EH LQ DFFRUGDQFH ZLWK (QHUJ\ 6WDU RU )(03 GHVLJQDWHGSURGXFWVOLVW)RUJDVZDWHUKHDWHUVXVH(QHUJ\6WDUODEHOHGSURGXFWV)RUSURGXFWV QRWOLVWHGE\(QHUJ\6WDURU)(03SURYLGHSURGXFWVZLWKHIILFLHQF\UDWHGLQWKHWRSRI DYDLODEOHSURGXFWV:DWHUKHDWHUVPXVWEHHTXLSSHGZLWKJODVVOLQHGVWHHOWDQNVPLQLPXP5 SRO\XUHWKDQHIRDPLQVXODWLRQUHSODFHDEOHDQRGHVDQGDGMXVWDEOHUDQJHWKHUPRVWDWWRDOORZKRW ZDWHUVHWWLQJVEHWZHHQDQGGHJUHHV&DQGGHJUHHV):DWHUKHDWHUZDUUDQW\ PXVWEHDPLQLPXPRI\HDUV3URYLGHYHQWLQDFFRUGDQFHZLWK1)3$3URYLGHORZ12[ EXUQHUV WKDW PHHW 6&$40' UHTXLUHPHQWV ,QVWDOO LQ DFFRUGDQFH ZLWK PDQXIDFWXUHU V LQVWUXFWLRQVDQGWKHFRGH:KHUHHDUWKTXDNHORDGVDUHDSSOLFDEOHZDWHUKHDWHUVXSSRUWVPXVW EHGHVLJQHGDQGLQVWDOOHGIRUVHLVPLFIRUFHVLQDFFRUGDQFHZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH (OHFWULF:DWHU+HDWHUV3URYLGHHOHFWULFZDWHUKHDWHUVZLWKGRXEOHKHDWLQJHOHPHQWSHU8/ 8QLWHIILFLHQF\PXVWPHHWRUH[FHHGWKDWOLVWHGIRU)(03RU(1(5*<67$5RUDVOLVWHGLQ $6+5$(ZKLFKHYHULVJUHDWHVW:DWHUKHDWHUVPXVWEHHTXLSSHGZLWKJODVVOLQHGVWHHO WDQNVKLJKHIILFLHQF\W\SHLQVXODWHGZLWKSRO\XUHWKDQHIRDPLQVXODWLRQUHSODFHDEOHDQRGHV DQGDGMXVWDEOHUDQJHWKHUPRVWDWWRDOORZKRWZDWHUVHWWLQJVEHWZHHQDQGGHJUHHV& 6$1,7$5<:$67( 9(17 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $OOQHZVHZHUVEHORZFRQFUHWHVODEPXVWEHVROLGFRUHPLQLPXPVFKHGXOH':97\SH$%6LQ DFFRUGDQFHZLWK$6701HZZDVWHDQGYHQWSLSLQJDERYHIORRUPXVWEH6FKHGXOH39&':9 7\SH$670RU$%6$6708VHRI$%6SODVWLFSLSHPXVWFRQIRUPWRWKH,%&DQG,3& 3URYLGHSLSHVL]LQJFRQILJXUDWLRQVDQGFOHDQRXWVDVUHTXLUHGE\WKH,3&&HOOXODUFRUHSODVWLFSLSHLVQRW DOORZHG629(17V\VWHPVDUHQRWDOORZHG 5$,1:$7(5'5$,1$*( %HORZFRQFUHWHVODEPXVWEHVROLGFRUHPLQLPXPVFKHGXOH':97\SH$%6LQDFFRUGDQFHZLWK $670$ERYHIORRUPXVWEHFDVWLURQKXEOHVVRUKXEDQGVSLJRWRU6FKHGXOH39&':9 7\SH$670RU$%6$670DVLQGLFDWHGLQ3DUW3LSHPDWHULDOVPXVWFRQIRUPWRWKH,%& DQG ,3& 3URYLGH SLSH VL]LQJ FRQILJXUDWLRQV DQG FOHDQRXWV DV UHTXLUHG E\ DSSOLFDEOH FRGHV DQG VWDQGDUGV 27+(53/80%,1*6<67(06 1DWXUDO*DV3LSLQJ6\VWHPV([WHULRUDERYHJUDGHQDWXUDOJDVSLSLQJPXVWEHVFKHGXOHJDOYDQL]HG VWHHOSLSHZLWKWKUHDGHGILWWLQJVDQGMRLQWV8QGHUJURXQGH[WHULRUJDVSLSLQJPXVWEHSRO\HWK\OHQHSLSH WKDWVDWLVILHVWKHUHTXLUHPHQWVRI1)3$$670'DQG$60(%3URYLGHZDUQLQJWDSHDW LQFKHVEHORZJUDGHGLUHFWO\DERYHEXULHGJDVSLSHV%HORZJUDGHPHWDOJDVSLSLQJLVSURKLELWHG ,QWHULRUJDVSLSLQJPXVWEH$670$VFKHGXOHEODFNVWHHOZLWK$60(%WKUHDGHGILWWLQJVDQG MRLQWV 7KH XVH RI VHPLULJLG WXELQJ DQG IOH[LEOH FRQQHFWRUV IRU JDV HTXLSPHQW DQG DSSOLDQFHV LV SURKLELWHGH[FHSWIRUILQDOFRQQHFWLRQVWRWKHHTXLSPHQWDQGDSSOLDQFHVZKHUHWKH\PXVWEHSURYLGHG 3URYLGHIOH[LEOHJDVFRQQHFWLRQVLQDFFRUGDQFHZLWK$16,=DQGQRWPRUHWKDQLQFKHVORQJ 3URYLGHDFFHVVLEOHJDVVHUYLFHZLWKVKXWRIIYDOYHIRUDOOHTXLSPHQW*DVSLSLQJPXVWFRQIRUPWR1)3$ DQGPXVWEHSUHVVXUHWHVWHGLQDFFRUGDQFHWKHUHZLWK*DVSLSLQJLVFRQVLGHUHGDIUDJLOHXWLOLW\LQWKH FRQWHQWRI8)&DOD Minimum Antiterrorism Standards for Buildings +($7,1*9(17,/$7,21$1'$,5&21',7,21,1*+9$&6<67(06 7KH +9$& V\VWHPV PXVW FRPSO\ ZLWK WKH ODWHVW HGLWLRQ RI WKH ,QWHUQDWLRQDO 0HFKDQLFDO &RGH ,QWHUQDWLRQDO 3OXPELQJ &RGH $6+5$( 6WDQGDUGV 1DWLRQDO (OHFWULFDO &RGH 1DWLRQDO )LUH 3URWHFWLRQ $VVRFLDWLRQ3XEOLFDWLRQV,QWHUQDWLRQDO%XLOGLQJ&RGHRU$6+5$(HQHUJ\HIILFLHQF\VWDQGDUGVWKH PRUHVWULQJHQWRIWKHWZRXQOHVVRWKHUZLVHVSHFLILHGLQ3DUW$OOHTXLSPHQWDSSOLDQFHVGXFWZRUNDQG DFFHVVRULHVPXVWFRPSO\ZLWKDSSOLFDEOHFRGHVDQGVWDQGDUGV7KH&RQWUDFWRUPXVWFHUWLI\WKDWWKH LQVWDOODWLRQLVLQFRQIRUPDQFHZLWKWKHDSSOLFDEOHFRGHVDQGVWDQGDUGVDWWKHFRPSOHWLRQRIWKHFRQWUDFW SULRUWRILQDOLQYRLFHEHLQJSURFHVVHGDQGILQDODFFHSWDQFH3URYLGH(QHUJ\6WDUUDWHGHTXLSPHQWZKHUH DYDLODEOH3URYLGHHTXLSPHQWZLWKSHUIRUPDQFHLQH[FHVVRI(QHUJ\6WDUUHTXLUHPHQWVZKHUHVSHFLILHG (TXLSPHQW&OHDUDQFH3URYLGHZRUNLQJVSDFHDURXQGDOOHTXLSPHQW3URYLGHDOOUHTXLUHG ILWWLQJVFRQQHFWLRQVDQGDFFHVVRULHVUHTXLUHGIRUDFRPSOHWHDQGXVDEOHV\VWHP$OOHTXLSPHQW VKDOOEHLQVWDOOHGSHUWKHPDQXIDFWXUHU VUHFRPPHQGDWLRQV:KHUHWKHZRUGVKRXOGLVXVHGLQ PDQXIDFWXUHU VLQVWUXFWLRQVVXEVWLWXWHWKHZRUGVKDOO 0DWHULDO DQG (TXLSPHQW 4XDOLILFDWLRQV $OO PDWHULDOV DQG HTXLSPHQW PXVW KDYH EHHQ LQ VDWLVIDFWRU\FRPPHUFLDORULQGXVWULDOXVHIRU\HDUVSULRUWRWKHELGRSHQLQJ7KH\HDUXVH PXVWLQFOXGHDSSOLFDWLRQVRIHTXLSPHQWDQGPDWHULDOVXQGHUVLPLODUFLUFXPVWDQFHVDQGRIVLPLODU VL]H7KHSURGXFWPXVWKDYHEHHQIRUVDOHRQWKHFRPPHUFLDOPDUNHWWKURXJKDGYHUWLVHPHQWV PDQXIDFWXUHU VFDWDORJVRUEURFKXUHVGXULQJWKH\HDUSHULRG 0RWRUV6LQJOHSKDVHIUDFWLRQDOKRUVHSRZHUDOWHUQDWLQJFXUUHQWPRWRUVPXVWEHKLJKHIILFLHQF\ W\SHVFRUUHVSRQGLQJWRWKHDSSOLFDWLRQVOLVWHGLQ1(0$0*6HOHFWSRO\SKDVHPRWRUVEDVHG RQ KLJK HIILFLHQF\ FKDUDFWHULVWLFV UHODWLYH WR WKH DSSOLFDWLRQV DV OLVWHG LQ 1(0$ 0* DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $GGLWLRQDOO\DOOSRO\SKDVHVTXLUUHOFDJHPHGLXPLQGXFWLRQPRWRUVZLWKFRQWLQXRXVUDWLQJVPXVW PHHWRUH[FHHGHQHUJ\HIILFLHQWUDWLQJVSHU7DEOHRI1(0$0* 3URYLGHFRQWUROOHUV IRUSKDVHPRWRUVUDWHGN:KSDQGDERYHZLWKSKDVHYROWDJHPRQLWRUVGHVLJQHGWR SURWHFWPRWRUVIURPSKDVHORVVDQGRYHUXQGHUYROWDJH3URYLGHPHDQVWRSUHYHQWDXWRPDWLF UHVWDUWE\DWLPHDGMXVWDEOHUHVWDUWUHOD\)RUSDFNDJHGHTXLSPHQWWKHPDQXIDFWXUHUPXVW SURYLGHFRQWUROOHUVLQFOXGLQJWKHUHTXLUHGPRQLWRUVDQGWLPHGUHVWDUW3URYLGHUHGXFHGYROWDJH VWDUWHUVIRUDOOPRWRUVKSDQGODUJHU (TXLSPHQW 6XSSRUW 3URYLGH KRXVHNHHSLQJ SDGV DQG YLEUDWLRQ LVRODWRUV XQGHU DOO IORRU PRXQWHGHTXLSPHQW &RDWLQJV :KHQ UHTXLUHG LQ 3DUW SURYLGH FKLOOHU DQG DLU KDQGOHU FRLOV ZLWK FRSSHU WXEHFRSSHU ILQ FRLO FRQVWUXFWLRQ RU LPPHUVLRQ DSSOLHG EDNHG SKHQROLF RU RWKHU DSSURYHG FRDWLQJ )LHOGDSSOLHGFRDWLQJVDUHQRWDFFHSWDEOH0HFKDQLFDOHTXLSPHQWFDVLQJVPXVWKDYH SDLQWHGILQLVKHVWKDWSDVVDVDOWVSUD\WHVWFRQGXFWHGSHU$670%IRUGXUDWLRQRIDWOHDVW KRXUV (TXLSPHQW,QVXODWLRQ3URYLGHLQVXODWLRQRQDOOFKLOOHGZDWHUHTXLSPHQW,QVXODWHKRWDQG FKLOOHGZDWHUSXPSVDQGHTXLSPHQWDVVXLWDEOHIRUWKHWHPSHUDWXUHDQGVHUYLFHLQULJLGEORFN VHPLULJLG ERDUG RU IOH[LEOH XQLFHOOXODU LQVXODWLRQ WR ILW DVFORVHO\ DV SRVVLEOH WR HTXLSPHQW 3URYLGHYDSRUUHWDUGHUIRUFKLOOHGZDWHUDSSOLFDWLRQV $FRXVWLFDOFRQVLGHUDWLRQV1RLVHOHYHOVLQDOODUHDVVHUYHGVXSSO\UHWXUQDQGH[KDXVWE\D PHFKDQLFDO V\VWHP PXVW FRPSO\ ZLWK $6+5$( 'HVLJQ *XLGHOLQHV IRU +9$& UHODWHG EDFNJURXQGVRXQGLQURRPVDVLQGLFDWHGLQWKHODVWHG$6+5$()XQGDPHQWDOV+DQGERRN7KH 5&UDWLQJPHWKRGPXVWEHXWLOL]HG &22/,1**(1(5$7,1*6<67(06 &KLOOHUV$LUFRROHGFKLOOHUVPXVWEHW\SHLQGLFDWHGLQ3DUWDQGPHHWWKHUHTXLUHPHQWVRI$5, 3URYLGHFRQWUROSDQHOZLWKWKHPDQXIDFWXUHUV VWDQGDUGFRQWUROVDQGSURWHFWLRQ FLUFXLWV,I''&V\VWHPLVUHTXLUHGLQSURMHFWSURYLGHDFRQWUROLQWHUIDFHIRUUHPRWHPRQLWRULQJRI WKHFKLOOHU VRSHUDWLQJSDUDPHWHUVIXQFWLRQVDQGDODUPVIURPWKH''&FRQWUROV\VWHPFHQWUDO ZRUNVWDWLRQ3URYLGHFRPSOHWHVWDUWXSDQGRSHUDWLRQDOWHVWLQJRIFKLOOHUHTXLSPHQW 'LUHFWH[SDQVLRQV\VWHPV3URYLGHXQLWVIDFWRU\DVVHPEOHGGHVLJQHGWHVWHGZLWKGXFWHGDLU GLVWULEXWLRQDQGUDWHGLQDFFRUGDQFHZLWK$5,RU$5,5HIULJHUDQWSLSLQJVL]H PXVWEHSHUWKHPDQXIDFWXUHU VUHFRPPHQGDWLRQV,QVXODWHUHIULJHUDQWSLSLQJVXFWLRQOLQHVDQG FRQGHQVDWHGUDLQ 5HIULJHUDQWV7KHXVHRI2]RQH'HSOHWLQJ6XEVWDQFHV2'6DVZHOODVWKHTXDOLILFDWLRQVDQG FUHGHQWLDOVRISHUVRQQHOVHUYLFLQJHTXLSPHQWWKDWFRQWDLQV2'6LVUHVWULFWHG5HIULJHUDQWVPXVW KDYHDQ2]RQH'HSOHWLRQ3RWHQWLDO2'3RIZLWKH[FHSWLRQWR57KH2'3PXVWEHLQ DFFRUGDQFH ZLWK WKH 0RQWUHDO 3URWRFRO RQ 6XEVWDQFHV 7KDW 'HSOHWH WKH 2]RQH /D\HU 6HSWHPEHUDVDPHQGHGWKURXJKVSRQVRUHGE\WKH8QLWHG1DWLRQV(QYLURQPHQW 3URJUDPPH &RLOV,IFRDWLQJVDUHLQGLFDWHGLQ3DUWSURYLGHZLWKFRSSHUWXEHFRSSHUILQFRQVWUXFWLRQRU LPPHUVLRQDSSOLHGEDNHGSKHQROLFRURWKHUDSSURYHGFRDWLQJWKDWSDVVHVWKHKRXUVDOW VSUD\UHVLVWDQFHWHVWXVLQJ$670%SURFHGXUH)LHOGDSSOLHGFRDWLQJVDUHQRWDFFHSWDEOH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH ',675,%87,216<67(06 'XFWZRUN$OOGXFWZRUNPXVWEHSURYLGHGLQDFFRUGDQFHZLWKWKHODWHVW60$&1$JXLGHOLQHV )OH[LEOHGXFWOHQJWKVPXVWQRWH[FHHGIHHW3URYLGHJDOYDQL]HGVKHHWPHWDOGXFWVH[FHSWIRU VSHFLDOH[KDXVWV\VWHPVDQGWKHIROORZLQJ D )RU IXPH KRRG H[KDXVW NLWFKHQ KRRG H[KDXVW DQG GLVKZDVKHUH[KDXVW SURYLGH VWDLQOHVVVWHHOGXFWZRUN E )RUVKRZHUDUHDH[KDXVWVSURYLGHDOXPLQXPRUVWDLQOHVVVWHHOGXFWZRUNDQGVORSHGWR GUDLQSURYLVLRQV$IWHUWKHVKRZHUH[KDXVWLVPL[HGZLWKDYROXPHRIJHQHUDOH[KDXVWDLU HTXDOWRRIWKHVKRZHUH[KDXVWUDWHVWDQGDUGJDOYDQL]HGFRQVWUXFWLRQPD\EH XVHG F ,QWHUQDO LQVXODWLRQOLQHG GXFWZRUN LV SURKLELWHG LQ DOO DUHDV )RU GXFWZRUN ORFDWHG H[WHULRUWRWKHEXLOGLQJSURYLGHH[WHUQDOO\LQVXODWHGV\VWHPVZLWKVKHHWPHWDOFODGGLQJ 3URYLGHH[WHUQDOWKHUPDOLQVXODWLRQIRUDOOGXFWZRUN,QVXODWHGXFWZRUNLQFRQFHDOHG VSDFHVZLWKEODQNHWIOH[LEOHPLQHUDOILEHU,QVXODWHGXFWZRUNLQ0HFKDQLFDO5RRPVDQG H[SRVHG ORFDWLRQV ZLWK ULJLG PLQHUDO ILEHU LQVXODWLRQ 3URYLGH LQVXODWLRQ ZLWK IDFWRU\ DSSOLHGDOOSXUSRVHMDFNHWZLWKLQWHJUDOYDSRUUHWDUGHU,QH[SRVHGORFDWLRQVSURYLGHD MDFNHWZLWKZKLWHVXUIDFHVXLWDEOHIRUSDLQWLQJ)ODPHVSUHDGVPRNHGHYHORSHGUDWLQJ IRUDOOLQVXODWLRQVKDOOQRWH[FHHG0LQLPXPLQVXODWLRQWKLFNQHVVPXVWEHWKH PLQLPXP WKLFNQHVV UHTXLUHG E\$6+5$( ,QVXODWH WKHEDFNVRI DOO VXSSO\ DLU GLIIXVHUVZLWKEODQNHWIOH[LEOHPLQHUDOILEHULQVXODWLRQ G 7KHGXFWZRUNPXVWEHVHDOHGZLWKDQDSSURYHGGXFWVHDOHUDQGLQDFFRUGDQFHZLWK 60$&1$VWDQGDUGV,IOHDNDJHWHVWLQJLVLQGLFDWHGLQSDUWWKHGXFWOHDNDJHPXVWQRW H[FHHG H 3URYLGHPDQXDOYROXPHGDPSHUVLQHDFKEUDQFKWDNHRIIIURPWKHPDLQGXFWWRFRQWURO DLUTXDQWLW\'DPSHUVPXVWFRQIRUPWR60$&1$'&6'DPSHUVPXVWEHLQVWDOOHGLQ DFFHVVLEOHORFDWLRQV )LUH'DPSHUV)LUHGDPSHUVPXVWEHUDWHGSHU8/)LUHGDPSHUVPXVWEHG\QDPLFW\SH UDWHGIRUFORVXUHDJDLQVWDPRYLQJDLUVWUHDP3URYLGHILUHGDPSHUVWKDWGRQRWLQWUXGHLQWRWKH DLUVWUHDPZKHQLQWKHRSHQSRVLWLRQ 3LSLQJ D 3URYLGHLQVXODWHGVWHHOSLSLQJIRUVL]HVLQFKHVDQGODUJHUDQGLQVXODWHGFRSSHUSLSLQJ IRU VL]HV OHVV WKDQ LQFKHV IRU ZDWHU VXSSO\ DQG UHWXUQ SLSLQJ WR VHUYH WKH +9$& HTXLSPHQWWKURXJKRXWWKHIDFLOLW\ E 3URYLGHV\VWHPIOXVKLQJDQGVWDUWXSIRUZDWHUV\VWHPV E 2LOSLSLQJ$16,$670$RU$SLSLQJZLWKDVVRFLDWHG$60(ILWWLQJVRU$670% W\SH/RU0FRSSHUWXELQJZLWK$60(%IODUHGILWWLQJVRUFRPSUHVVLRQW\SHILWWLQJV F ([KDXVW)DQV$QG'XFWV D*HQHUDO([KDXVWIDQVPXVWEHVL]HGWRPRYHWKHYROXPHRIDLUUHTXLUHGWRFRPSO\ ZLWK,QWHUQDWLRQDO0HFKDQLFDO&RGHIRUWKHDUHDVUHTXLULQJH[KDXVW E%DWKURRPUHVWURRPVDQG8WLOLW\5RRP([KDXVW)DQV([KDXVWIDQVPXVWEHVL]HG WRJLYHQRWOHVVWKDQDLUFKDQJHVSHUKRXULQWKHVSDFHWREHYHQWLODWHG)DQVPXVW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH KDYHDPD[LPXPVRXQGOHYHORIVRQHVDQGEHVHSDUDWHO\VZLWFKHGIURPOLJKW F)OXHV :KHQ UHTXLUHG SURYLGH QHZ 7\SH % 8/ OLVWHG GRXEOH ZDOO IOXHV )OXH LQVWDOODWLRQPXVWEHLQDFFRUGDQFHZLWKWKH,QWHUQDWLRQDO0HFKDQLFDO&RGH $LUKDQGOLQJXQLWV0RGXODUFRQVWUXFWLRQGRXEOHZDOODLUKDQGOLQJXQLWVZLWKPLQLPXPRI PPLQFKFDVLQJLQVXODWLRQ3URYLGH$5,FHUWLILHGIDQVDQG$5,FHUWLILHGFRLOV3URYLGH VWDLQOHVVVWHHOSRVLWLYHGUDLQLQJFRQGHQVDWHGUDLQSDQ)RURXWVLGHDLUXQLWVSURYLGH FDSDELOLW\IRUFRROLQJKHDWLQJGHKXPLGLILFDWLRQDQGUHKHDW 7(50,1$/$1'3$&.$*(81,76 8QLWYHQWLODWRUV8QLWPXVWEHIDFWRU\DVVHPEOHGXQLWYHQWLODWRUFDSDEOHRIXSWRRXWGRRU DLUYHQWLODWLRQDQG8/OLVWHG 8QLW KHDWHUV $16, = DQG $*$ ODEHO (TXLS HDFK KHDWHU ZLWK LQGLYLGXDOO\ DGMXVWDEOH SDFNDJHGLVFKDUJHORXYHU3URYLGHZLWKWKHUPRVWDW )DQFRLOXQLWV8//LVWHGIDFWRU\DVVHPEOHGDQGWHVWHGIDQFRLOV$5,DQG$5,FHUWLILHG 3DFNDJHGXQLWV )DFWRU\SDFNDJHGURRIWRSXQLWVLQDFFRUGDQFHZLWK$5,DQGVXLWDEOHIRURXWGRRULQVWDOODWLRQ 3URYLGHZLWKPDQXIDFWXUHU VURRIFXUE 3DFNDJHGWKURXJKZDOOXQLWVPXVWEHIDFWRU\DVVHPEOHGDLUFRQGLWLRQHURUKHDWSXPSDQGUDWHG LQDFFRUGDQFHZLWK$5,RU$5,DQG$5,FHUWLILHG8QLWPXVWLQFOXGHKHDWDQGRSHUDWH XQGHUWKHVWDQGDUGXQLWFRQWUROV8QLWVPXVWEHGHVLJQHGWRDOORZHDVHRIPDLQWHQDQFHE\XVH RI D ZDOO VOHHYH 8QLWV PXVW KDYH LQWHUQDO FRQGHQVDWH UHPRYDO FRQGHQVDWH PXVW QRW EH H[WHUQDOO\GUDLQHG &21752/6$1',167580(17$7,21 *HQHUDO3URYLGHVWDQGDORQHRUGLVWULEXWHGGLUHFWGLJLWDOFRQWUROVDVUHTXLUHGLQ3DUW 'LVWULEXWHG 'LUHFW 'LJLWDO &RQWUROV ''& ''& KDUGZDUH PXVW EH 8/ UDWHG 8VH FRQWUROOHUVLQDGLVWULEXWHGFRQWUROPDQQHU&RQWUROOHUVPXVWEHVWDQGDORQHZLWKDQLQWHUQDO FORFN DQG PRGHP 7KH WRWDO QXPEHU RI ,2 KDUGZDUH SRLQWV VKDOO QRW H[FHHG LQ DQ\ FRQWUROOHU 3URYLGH VXIILFLHQW PHPRU\ IRU HDFK FRQWUROOHU WR VXSSRUW UHTXLUHG FRQWURO FRPPXQLFDWLRQWUHQGVDODUPVDQGPHVVDJHV3URYLGHFRPPXQLFDWLRQVSRUWVIRUFRQWUROOHUWR FRQWUROOHULQWHUIDFHDQGRQVLWHLQWHUIDFH:KHQSURYLGLQJDSDUWLDO''&V\VWHPRUFRQQHFWLQJWR DQ H[LVWLQJ ''& V\VWHP SURYLGH D ODSWRS FRPSXWHU ZLWK DOO QHFHVVDU\ VRIWZDUH IRU XVHU LQWHUIDFH &XUUHQWO\WKH&LW\RI'HQWRQXVHVDQ(QYLURPDWLF6\VWHPVEXLOGLQJDXWRPDWLRQFRQWURO3OHDVH UHIHUWR0LFKDHO&HULWHOOLIRUDGGLWLRQDOLQIRUPDWLRQ 6<67(067(67,1*$1'%$/$1&,1* $OO+9$&ZDWHUDQGDLUV\VWHPVERWKQHZDQGUHWURILWPXVWEH7$%HGLQDFFRUGDQFHZLWK1(%%RU DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $$%&VWDQGDUGV$VSDUWRIDQ\7$%DLUEDODQFLQJHIIRUWDFFHSWDEOHDLUTXDQWLW\YDULDWLRQVPXVWEHWR IRUH[KDXVWV\VWHPVDQGWRIRUVXSSO\DLUV\VWHPV ),5(3527(&7,21 3URYLGHQHZRUH[WHQGH[LVWLQJ$XWRPDWLF)LUH6SULQNOHUV\VWHPV6PRNHDQG+HDWGHWHFWLRQV\VWHPV )LUH$ODUPDQG0DVV1RWLILFDWLRQV\VWHPVDVUHTXLUHG7KHZRUNIRUILUHVSULQNOHUVILUHDODUPVPRNH GHWHFWLRQDQGKHDWGHWHFWLRQPXVWEHSURYLGHGE\FRQWUDFWRUVOLFHQVHGWRSHUIRUPVXFKZRUN 3URMHFW 5HTXLUHPHQWV 3ULRU WR WKH VWDUW RI GHVLJQ WKH 'HVLJQHU RI 5HFRUG PXVW PHHW ZLWK WKH *RYHUQPHQW V)LUH3URWHFWLRQ(QJLQHHUWRGHWHUPLQHWKHH[WHQWDQGW\SHVRIILUHSURWHFWLRQUHTXLUHG ),5($/$50$1''(7(&7,21 )LUH DODUP V\VWHP LQFOXGHV PDQXDO VWDWLRQV V\VWHP VPRNH GHWHFWRUV GXFW VPRNH GHWHFWRUV KHDW GHWHFWRUVDXGLRYLVXDODODUPVFRQQHFWLRQWREDVHZLGHILUHDODUPPRQLWRULQJHOHFWULFDOVXSHUYLVLRQRIILUH SXPSFRQWUROOHUVDQGHOHFWULFDOVXSHUYLVLRQRIDOOVSULQNOHUV\VWHPDODUPDQGVXSHUYLVRU\GHYLFHVDV UHTXLUHG ),5(68335(66,21:$7(56833/<$1'(48,30(17 7KHGHVLJQSRLQWRIFRQQHFWLRQWRH[LVWLQJZDWHUVXSSO\ZLOOUHTXLUHWKHDSSURYDORIWKH&LW\7KH)3( '25PXVWFRQGXFWDGGLWLRQDOIORZWHVWVDIWHUFRQWUDFWDZDUGSULRUWRDQ\GHVLJQVXEPLVVLRQV7HVWV PXVWEHFRRUGLQDWHGWKURXJKWKH&RQWUDFWLQJ2IILFHU 635,1./(56 $UHDVVXEMHFWWRIUHH]LQJPXVWEHSURYLGHGZLWKDGU\SLSHV\VWHP (/(&75,&$/ (/(&75,&$/6(59,&( ',675,%87,21 3URYLGHLQWHULRUHOHFWULFDOZLULQJIL[WXUHVVZLWFKHVRXWOHWVDQGDSSDUDWXVLQDFFRUGDQFHZLWKDSSOLFDEOH FRGHVDQGVWDQGDUGV7KHHOHFWULFDOV\VWHPPXVWFRQIRUPWR1)3$3RZHUDQGOLJKWLQJFLUFXLWVPXVW EHVHSDUDWH :LULQJ$OOZLULQJPXVWEHLQHOHFWULFDOPHWDOFRQGXLWVDQGPXVWEHFRQFHDOHGH[FHSWLQWKH LQGXVWULDOVSDFHVDQGDWORFDWLRQVLQGLFDWHGLQ3DUW1RFRQGXFWRUVDUHSHUPLWWHGWREHVPDOOHU WKDQ1R$:*FRSSHUZLUHV:LULQJEHORZVODERUXQGHUJURXQGPXVWEHLQ6FKHGXOH 39&ZLWKJURXQGZLUH([SRVHGFRQGXLWVRQWKHH[WHULRURIWKHEXLOGLQJDUHSURKLELWHG3URYLGH DJURXQGFRQGXFWRUIRUHDFKFLUFXLWFRQGXLWVPXVWQRWEHXVHGDVWKHVROHPHDQVRIJURXQGLQJ &DEOHDVVHPEOLHV7\SHV$&0&RU0,DQGIODWFRQGXFWRUVPD\RQO\EHXVHGLQORFDWLRQV DOORZHGE\8)&&LUFXLWEUHDNHUVPXVWEHEROWRQW\SH6HULHVUDWHGFLUFXLWEUHDNHUV DQGIXVLEOHSDQHOERDUGVPXVWQRWEHXVHG 2XWOHW&LUFXLWV/LJKWLQJDQGFRQYHQLHQFHRXWOHWVPXVWEHRQVHSDUDWHFLUFXLWV,QVWDOO*), SURWHFWHGUHFHSWDFOHVDWDOOZHWRUGDPSDUHDV/RFDWLRQRIRXWOHWVPXVWEHDVUHTXLUHGE\ DSSOLFDEOHFRGHVDQGVWDQGDUGV3URYLGHH[WUDRXWOHWVIRUPDLQWHQDQFHDQGVHUYLFHVWDIIVLQ VSDFHVVXFKDVFRUULGRUVKDOOZD\VDQGRWKHUSXEOLFVSDFHVDVLGHQWLILHGEHORZ$OOH[WHULRU RXWOHWVPXVWEHRQVHSDUDWHFLUFXLWVEH*),SURWHFWHGDQGHTXLSSHGZLWKDFRYHUWRSUHYHQW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH DFFLGHQWDOZDWHULQILOWUDWLRQLQWRWKHGHYLFHV ,Q DGGLWLRQ WR WKH ORFDWLRQ UHTXLUHPHQWV VSHFLILHG E\ 1)3$ ORFDWH JHQHUDO SXUSRVH DQG GHGLFDWHGRXWOHWVLQDFFRUGDQFHZLWKWKHIROORZLQJ D 0HFKDQLFDOHTXLSPHQW3URYLGHUHFHSWDFOHZLWKLQPIWRIPHFKDQLFDOHTXLSPHQW RQWKHLQWHULRUDQGH[WHULRURIEXLOGLQJV E 2IILFHVWDIIVXSSRUWVSDFHVDQGRWKHUZRUNVWDWLRQORFDWLRQV2QHUHFHSWDFOHIRUHDFK ZRUNVWDWLRQZLWKDPLQLPXPRIRQHIRUHYHU\PPIWRIZDOOVSDFH:KHQOHVV WKDQPPIWRIZDOODWWKHIORRUOLQHSURYLGHDPLQLPXPRIWZRUHFHSWDFOHV VSDFHGDSSURSULDWHO\WRDQWLFLSDWHIXUQLWXUHUHORFDWLRQV/LPLWORDGVWRDPD[LPXPRI IRXUZRUNVWDWLRQVSHUDPSFLUFXLW6HH$SSHQGL[&7DEOH&IRUZRUNVWDWLRQORDG GDWD F &RQIHUHQFHURRPVDQGWUDLQLQJURRPV2QHIRUHYHU\PIWRIZDOOVSDFHDWWKH IORRUOLQH(QVXUHRQHUHFHSWDFOHLVORFDWHGQH[WWRHDFKYRLFHGDWDRXWOHW3URYLGHRQH UHFHSWDFOHDERYHWKHFHLOLQJWRVXSSRUWYLGHRSURMHFWLRQGHYLFH([WHQGFLUFXLWWRZDOO ORFDWLRQIRUFRQQHFWLRQWRPRWRUL]HGVFUHHQ:KHQLWLVH[SHFWHGWKDWDFRQIHUHQFH URRPWDEOHZLOOEHVSHFLILFDOO\GHGLFDWHGWRIORRUVSDFHLQDFRQIHUHQFHURRPORFDWHD IORRUPRXQWHGUHFHSWDFOHXQGHUWKHWDEOH7KLVUHFHSWDFOHPD\EHSDUWRIFRPELQDWLRQ SRZHUFRPPXQLFDWLRQVRXWOHW G 3URYLGH SRZHU RXWOHWV WKURXJKRXW WKH EXLOGLQJ WR VHUYH DOO SURSRVHG HTXLSPHQW LQFOXGLQJ JRYHUQPHQW IXUQLVKHG HTXLSPHQW DQG DOORZ IRU IXWXUHUHFRQILJXUDWLRQ RI HTXLSPHQWOD\RXW3URYLGHSRZHUFRQQHFWLRQVWRDOODQFLOODU\RIILFHHTXLSPHQWVXFKDV SULQWHUVID[HVSORWWHUVDQGVKUHGGHUV3URYLGHGHGLFDWHGFLUFXLWVZKHUHZDUUDQWHG H ,QHDFKWHOHFRPPXQLFDWLRQVURRPSURYLGHDGHGLFDWHGDPSFLUFXLWZLWKDUHFHSWDFOH DGMDFHQWWRHDFKUDFNRUEDFNERDUGIRUHDFKRIWKHIROORZLQJ &&679IRUVHFXULW\V\VWHPV &$79 'DWDV\VWHPV H 3URYLGHGHGLFDWHGUHFHSWDFOHVDVUHTXLUHGWKURXJKRXWWKHIDFLOLW\IRUWHOHYLVLRQPRQLWRUV 7KHVHRXWOHWVZLOOW\SLFDOO\EHORFDWHGDWWKHFHLOLQJOHYHOIRUZDOOPRXQWHGWHOHYLVLRQ PRQLWRUV I 3URYLGHGHGLFDWHGUHFHSWDFOHVDVUHTXLUHGWKURXJKRXWWKHIDFLOLW\IRUWDSHSOD\HUVDQG GLVFSOD\HUV J &RUULGRUV2QHHYHU\PIWPD[LPXPZLWKDPLQLPXPRIRQHSHUFRUULGRU K -DQLWRU V FORVHW DQG WRLOHW URRPV 2QH *), UHFHSWDFOH SHU FORVHW 3URYLGH *), UHFHSWDFOHVDWFRXQWHUKHLJKWIRUHDFKFRXQWHULQWRLOHWVVXFKWKDWWKHUHLVDPLQLPXPRI RQHRXWOHWIRUHDFKWZRVLQNV L 6SDFHZLWKFRXQWHUWRSV2QHIRUHYHU\PIWRIFRXQWHUWRSZLWKDPLQLPXPRI RQH RXWOHW 3URYLGH *), SURWHFWLRQ RI RXWOHWV ZKHQ ORFDWHG ZLWKLQ P IW RI SOXPELQJIL[WXUHV M .LWFKHQQRQUHVLGHQWLDO2QHIRUHDFKPIWRIZDOOVSDFHDWWKHIORRUOLQH 3URYLGH*),SURWHFWLRQZKHQORFDWHGZLWKLQPIWRISOXPELQJIL[WXUH Q $OORWKHUURRPV2QHIRUHYHU\PIWRIZDOOVSDFHDWWKHIORRUOLQH:KHQP DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH IW RU OHVV RI ZDOO DW WKH IORRU OLQH H[LVWV LQ D URRP SURYLGH D PLQLPXP RI WZR UHFHSWDFOHVVSDFHGDSSURSULDWHO\WRDQWLFLSDWHIXUQLWXUHUHORFDWLRQV R 6SHFLDO SXUSRVH UHFHSWDFOHV 'HVLJQHU RI 5HFRUG PXVW FRRUGLQDWH ZLWK WKH XVHU WR SURYLGHDQ\VSHFLDOSXUSRVHRXWOHWVUHTXLUHG3URYLGHRXWOHWVWRDOORZFRQQHFWLRQRI HTXLSPHQWLQVSHFLDOXVHURRPV 6HUYLFH(QWUDQFH(TXLSPHQW:KHQDVZLWFKERDUGRUVZLWFKJHDULVUHTXLUHGWKH'HVLJQHURI 5HFRUG PXVW XWLOL]H 8)*6 6HFWLRQ Low Voltage Switchgear or UFGS 26 24 13 SwitchboardsIRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQVHFWLRQDVD SDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW /,*+7,1* %5$1&+:,5,1* /LJKWLQJ )L[WXUHV $OO OLJKWLQJ IL[WXUHV PXVW EH HQHUJ\ FRQVHUYDWLRQ FRPSDFW IOXRUHVFHQW RU /LJKW(PLWWLQJ'LRGH/('H[FHSWZKHUHLQGLFDWHGE\3DUW D)L[WXUHVIRU$GPLQLVWUDWLYHDQG&RPPHUFLDO6SDFHV)RURIILFHVFRPPHUFLDODQG DGPLQLVWUDWLYHVSDFHVDQGIDFLOLWLHVSURYLGHKLJKHIILFLHQF\EDOODVWDQGLQVWDQWRUUDSLG VWDUWUHFHVVHGIOXRUHVFHQWIL[WXUHVRU/('IL[WXUHV E7KUHH:D\DQG)RXU:D\6ZLWFKHV3URYLGHWKUHHZD\RUIRXUZD\VZLWFKLQJRIOLJKW IL[WXUHVDVQHFHVVDU\WRIDFLOLWDWHPRYHPHQWEHWZHHQDGMDFHQWVSDFHVWRDOORZHIILFLHQW HQHUJ\PDQDJHPHQW ([WHULRU/LJKWLQJ)L[WXUHVIRU/DUJH2SHQ$UHDV([WHULRUOLJKWLQJIL[WXUHVIRUODUJHRSHQ DUHDVVXFKDVSDUNLQJORWVVWUHHWVDQGSOD\JURXQGVPXVWEHHQHUJ\HIILFLHQW+LJK,QWHQVLW\ 'LVFKDUJH +,' RU FRPSDFW IOXRUHVFHQW IL[WXUHV DQG PXVW FRPSO\ ZLWK ORFDO UHJXODWLRQV UHJDUGLQJORZOLJKWLQJOHYHOVWRDYRLGOLJKWSROOXWLRQ D 3KRWRFHOO 2YHUULGLQJ 6ZLWFK 3URYLGH SKRWRFHOORYHUULGLQJ VZLWFK IRU DOO RXWGRRU OLJKW IL[WXUHV &20081,&$7,216 6(&85,7< 7HOHFRPPXQLFDWLRQV 6\VWHPV 3URYLGH D KRUL]RQWDO GLVWULEXWLRQ V\VWHP LQFOXGLQJ EXW QRW QHFHVVDULO\OLPLWHGWRDOOZLULQJSDWKZD\V\VWHPVFRQQHFWRUEORFNVSURWHFWRUVIRUDOOFRSSHU VHUYLFHHQWUDQFHSDLUVWHUPLQDWRUVIRUDOOILEHURSWLFFDEOHVRXWOHWER[HVWHOHSKRQHMDFNVDQG GDWD MDFNV FRYHU SODWHV LQ DFFRUGDQFH ZLWK (,$7,$ VWDQGDUGV 3URYLGH &DWHJRU\ 873 WHOHSKRQHSUHPLVHZLULQJZKHUHWHOHSKRQHVDUHUHTXLUHG 7HOHYLVLRQ6\VWHPV3URYLGHWHOHYLVLRQLIUHTXLUHG&RRUGLQDWHZLWKWKHORFDO&DEOH&RPSDQ\ /RFDOXVHUVDQG/RFDO$XWKRULW\DWWKH$FWLYLW\IRURWKHUVSHFLILFUHTXLUHPHQWV7KHLQWHULRUFDEOH RXWOHWVDQGZLULQJPXVWEHFRPSOHWHDQGUHDG\IRUXVH:LULQJPXVWQRWEHUXQH[SRVHGRQDQ\ VXUIDFHRIWKHEXLOGLQJ 6HFXULW\6\VWHPV3URYLGHDQ,QWUXVLRQ'HWHFWLRQ6\VWHP,'6WRVHQVHDOOSHULPHWHUGRRUV DQGZLQGRZVDQGWKHLQWHULRUYROXPHLQDWOHDVWWZRORFDWLRQV6\VWHPPXVWKDYHDPLQLPXP PLQXWHEDWWHU\EDFNXSDQGDQQXQFLDWHERWKORFDOO\DQGDWWKH%DVH6HFXULW\2IILFHYLDD WHOHSKRQHGLDOHU6\VWHPPXVWKDYHHQWU\H[LWWLPHU3URYLGHZDOOPRXQWHGNH\SDGFRQWURODW WZRORFDWLRQV 27+(5(/(&75,&$/6(59,&(6 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH 6XUJH3URWHFWLYH'HYLFH63'3URYLGH63'LQDFFRUGDQFHZLWK8)&Electrical Engineering 9DULDEOH)UHTXHQF\'ULYHV:KHQYDULDEOHIUHTXHQF\GULYHVDUHUHTXLUHGWKH'HVLJQHURI 5HFRUGPXVWXWLOL]H8)*66HFWLRQIRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKH HGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW (PHUJHQF\*HQHUDWRUV:KHQDQHPHUJHQF\JHQHUDWRULVUHTXLUHGWKH'HVLJQHURI5HFRUG PXVWXWLOL]H8)*66HFWLRQIRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKH HGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW $XWRPDWLF7UDQVIHUDQG%\SDVV,VRODWLRQ6ZLWFKHV:KHQDQ$XWRPDWLF7UDQVIHU6ZLWFKLV UHTXLUHGWKH'HVLJQHURI5HFRUGPXVWXWLOL]H8)*66HFWLRQIRUWKHSURMHFW VSHFLILFDWLRQDQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDO IRUWKHSURMHFW 8QLQWHUUXSWLEOH3RZHU6XSSO\8366\VWHP:KHQD836V\VWHPLVUHTXLUHGWKH'HVLJQHU RI5HFRUGPXVWXWLOL]H8)*66HFWLRQDQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQ VHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW +HUW]6\VWHPV7KH'HVLJQHURI5HFRUGPXVWXWLOL]H8)*66HFWLRQRU IRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKH GHVLJQVXEPLWWDOIRUWKHSURMHFW /LJKWQLQJ3URWHFWLRQ:KHQOLJKWQLQJSURWHFWLRQLVUHTXLUHGWKH'HVLJQHURI5HFRUGPXVW XWLOL]H8)*66HFWLRQIRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKHHGLWHG VSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW %XLOGLQJ3KRWRYROWDLF6\VWHP:KHQD39V\VWHPLVUHTXLUHGWKH'HVLJQHURI5HFRUGPXVW XWLOL]H 8)*6 6HFWLRQ IRU WKH SURMHFW VSHFLILFDWLRQ DQG PXVW VXEPLW WKH HGLWHG VSHFLILFDWLRQVHFWLRQDVSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW (48,30(17$1')851,6+,1*6 (48,30(17 (TXLSPHQWDQG$SSOLDQFHV3URYLGHDSSOLDQFHVDQGHTXLSPHQWWRIXOILOOWKHZRUNIRU3DUW:KHQHYHU SRVVLEOHDOODSSOLDQFHVDQGHTXLSPHQWSURYLGHGIRUWKHIDFLOLWLHVLQWKHFRQWUDFWPXVWEHE\WKHVDPH PDQXIDFWXUHUDQGPXVWEHWKHFXUUHQWPRGHODYDLODEOHDWWKHWLPHRISURSRVDOV'LVFRQWLQXHGPDNHVDQG PRGHOVDUHSURKLELWHG$OODSSOLDQFHVDQGHTXLSPHQWPXVWFRPSO\ZLWKDSSOLFDEOH(QHUJ\6WDUHIILFLHQF\ UDWLQJ UHTXLUHPHQWV DQG PXVW EH UDWHG DV KLJK HIILFLHQF\ PRGHOV $SSOLDQFHV DQG HTXLSPHQW RQ &DOLIRUQLDSURMHFWVPXVWFRPSO\ZLWK&DOLIRUQLD7LWOHDQGEHUDWHGDVKLJKHIILFLHQF\$OODSSOLDQFHV PXVWEHRIWKHVDPHPDQXIDFWXUHUDQGVKDOOEHWKHVDPHRUVLPLODULQFRORU6XEPLWFDWDORJLQIRUPDWLRQ IRUDSSURYDOE\WKH&RQWUDFWLQJ2IILFHUSULRUWRSXUFKDVLQJGHOLYHU\DQGLQVWDOODWLRQRIWKHDSSOLDQFHVDW WKH MRE VLWH (TXLSPHQW DQG DSSOLDQFHV VXFK DV GLVKZDVKHUV LFH PDFKLQHV ZLWK GUDLQV JDUEDJH GLVSRVHUVDQGRYHQVUDQJHVDUHQRWFRQVLGHUHG)) ( )851,6+,1*6 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH 7KH &RQWUDFWRU PXVW KDYH DQ ,QWHULRU 'HVLJQHU FHUWLILHG E\ WKH 1DWLRQDO &RXQFLO IRU ,QWHULRU 'HVLJQ 4XDOLILFDWLRQ1&,'4RUDVWDWHDQGRUMXULVGLFWLRQ&HUWLILHG5HJLVWHUHGRU/LFHQVHG,QWHULRU'HVLJQHU SUHSDUHERWKWKH)) (DQGWKH6,'3DFNDJHDQGSDUWLFLSDWHLQDQ\GHVLJQFKDUHWWHVWRGHYHORSWKH EXLOGLQJIORRUSODQ$VUHTXLUHGWKH&RQWUDFWRUPXVWREWDLQVHUYLFHVRIHTXLSPHQWVSHFLDOLVWVWRVSHFLI\ WKHDXGLRYLVXDOVKRSRUVSHFLDOW\HTXLSPHQW7KH,QWHULRU'HVLJQHUDQGDQ\VSHFLDOLVWVPXVWQRWEH DIILOLDWHG ZLWK DQ\ IXUQLWXUH GHDOHUVKLSYHQGRU RU PDQXIDFWXUHU 7KH *RYHUQPHQW ,QWHULRU 'HVLJQHU UHVHUYHVWKHULJKWWRDSSURYHGLVDSSURYHWKHTXDOLILFDWLRQVRIWKH&RQWUDFWRU V,QWHULRU'HVLJQHU 6\VWHPVIXUQLVKLQJVLQVWDOOHUVPXVWEHWKHV\VWHPVIXUQLWXUHPDQXIDFWXUHU VDSSURYHGGHDOHURIUHFRUG ,Q DGGLWLRQ LQVWDOODWLRQ GHDOHUV PXVW EH ORFDWHG ZLWKLQ D PLOH UDGLXV RI WKH SURMHFW VLWH XQOHVV DSSURYHGE\WKHJRYHUQPHQW,QWHULRU'HVLJQHU )RU UHQRYDWLRQ SURMHFWV FRQWUDFWRU WR UHSXUSRVHUHF\FOH H[LVWLQJ IXUQLWXUH LI QRW UHORFDWHG E\ WKH JRYHUQPHQW&RQWUDFWRUWRSURYLGHYHULILFDWLRQWKDWWKHH[LVWLQJIXUQLWXUHZDVQRWGLVSRVHGRIDWWKH ODQGILOO :,1'2:75($70(176 3URYLGHLQWHULRUZLQGRZFRYHULQJVDVVRFLDWHGKDUGZDUHDQGFRQWUROVDWHDFKH[WHULRUZLQGRZDQGDWDQ\ LQWHULRUYLHZZLQGRZZKHUHSULYDF\PD\EHUHTXLUHG5HIHUWRWKH3URMHFW3URJUDPIRUVL]HSDWWHUQDQG VW\OHRIZLQGRZWUHDWPHQWV$WDPLQLPXPIXQFWLRQDOZLQGRZFRYHULQJVDUHUHTXLUHGRQDOOSURMHFWV 3URYLGHHQHUJ\HIILFLHQWVRODUVKDGLQJV\VWHPVIRUH[WHULRUZLQGRZV7KHV\VWHPVKDOOPDLQWDLQYLVLELOLW\ ZKLOHUHGXFLQJJODUHVRODUKHDWJDLQGXULQJWKHVXPPHUDQGKHDWORVVGXULQJWKHZLQWHU2SHQQHVV FRQILJXUDWLRQVKDOOEHQRPRUHWKDQIRUPRVWDUHDV7KHV\VWHPIDEULFVDQGFRPSRQHQWVPXVWEH GLPHQVLRQDOO\VWDEOHDQGPXVWEHPDQXIDFWXUHGWRZLWKVWDQGIDGLQJILUHPLOGHZDQGVRLOLQJ3URGXFW PXVWKDYHDPLQLPXP\HDUFRPPHUFLDOZDUUDQW\ 029$%/()851,6+,1*6 )XUQLVKLQJV)L[WXUHVDQG(TXLSPHQW)) (LQFOXGHVIXUQLWXUHVKRSHTXLSPHQWDXGLRYLVXDOHTXLSPHQW DQGVSHFLDOW\HTXLSPHQW:HDSRQUDFNVGU\LQJFDJHVDQGORFNHUVDUHQRWFRQVLGHUHG)) ()) ( PXVWEHIXOO\LQWHJUDWHGZLWKWKHEXLOGLQJV\VWHPVDQGILQLVKHV)) (PD\DOVRLQFOXGHVSHFLDOW\LWHPV IRUZKLFKWKHFXVWRPHUDFWLYLW\ZLOOEHUHVSRQVLEOHIRUVSHFLI\LQJ 'HVLJQDQGSURYLGHDVUHTXLUHG)) (IRUDOODUHDVDVGHYHORSHGGXULQJFOLHQWSURJUDPPLQJ'HVLJQDQ )) ( SDFNDJH DQG SUHSDUH VXSSRUWLQJ SODQV DQG SURFXUHPHQW GDWDLQ DFFRUGDQFH ZLWK WKH JHQHUDO LQWHULRUGHVLJQUHTXLUHPHQWVLQ8)& )) (3$&.$*( 'HVLJQDQGSURYLGHDIXOO\XVDEOHDQGFRPSOHWHIDFLOLW\WRLQFOXGHD)) (PRYDEOHIXUQLVKLQJVSDFNDJH IURP*RYHUQPHQWVXSSO\VRXUFHVDFFRUGLQJWR)HGHUDO$FTXLVLWLRQ5HJXODWLRQV7KH)) (ZLOOLQFOXGH EXW QRW OLPLWHG WR V\VWHPV DQG PRGXODU IXUQLWXUH WUDLQLQJ DQG FRQIHUHQFH IXUQLWXUH VHDWLQJ WDEOHV DUWZRUNGHFRUDWLYHZLQGRZFRYHULQJVSHFLDOW\IXUQLWXUHDQGHTXLSPHQWGRUPLWRU\URRPIXUQLVKLQJVDQG DFFHVVRULHV1$9683%ODQNHW3XUFKDVH$JUHHPHQWV%3$PXVWEHXVHG7KHJRYHUQPHQWZLOOSURYLGH VHSDUDWHIXQGLQJIRUWKH)) (SDFNDJH&RQVWUXFWLRQIXQGVZLOOQRWEHXVHG7KH)) (3DFNDJHPXVW LQFOXGHVKLSSLQJIUHLJKWKDQGOLQJLQVWDOODWLRQDQGWKH+$5SHUFHQWDJHDVDSSOLHGWRWKHILQDO)) (WRWDO FRVW 385&+$6($1',167$//$7,21 7KH&RQWUDFWRUPXVWFRRUGLQDWHWKHEXLOGLQJFRPSOHWLRQGDWHZLWKWKHLQVWDOODWLRQGHDOHUVSHFLILHGLQWKH )) (3DFNDJH7KH&RQWUDFWRURUFRQWUDFWRU VUHSUHVHQWDWLYHLVUHVSRQVLEOHIRUWKHIROORZLQJLVVXLQJ SXUFKDVHRUGHUVUHFHLYLQJ DFNQRZOHGJHPHQWV VHQGLQJFRSLHV RISXUFKDVH RUGHUV WR WKH LQVWDOODWLRQ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH GHDOHUVVSHFLILHGLQWKH)) (SDFNDJHDQGSURYLGLQJQHFHVVDU\GHSRVLWVWRIXUQLWXUHPDQXIDFWXUHUV 7KH )) ( LQVWDOODWLRQ GHDOHUV LV UHVSRQVLEOH IRU WKH IROORZLQJ 5HFHLYLQJ DQG LQVWDOOLQJ DOO )) ( VSHFLILHGLQWKH)) (SDFNDJHFRRUGLQDWLQJGHOLYHU\DQGLQVWDOODWLRQZLWKWKH&RQWUDFWRULQVSHFWLQJIRU GDPDJHSURYLGLQJGHOLYHU\UHFHLSWVWRWKH&RQWUDFWRUILOLQJQHFHVVDU\IUHLJKWFODLPVKDQJLQJDUWZRUN EXOOHWLQERDUGVHWFUHPRYLQJSDFNDJLQJPDWHULDOFOHDQLQJXSWKHVLWHXSRQFRPSOHWLRQDQGDGKHULQJWR &RQWUDFWRU VVDIHW\UHTXLUHPHQWV 'HSRVLWV 7KH&RQWUDFWRUVKRXOGDQWLFLSDWHSURYLGLQJDGHSRVLWRIEHWZHHQWRRIWKHIXUQLWXUH FRVWVZKHQSODFLQJWKHLURUGHU 7KH &RQWUDFWRU PXVW DOVR DQWLFLSDWH SRVVLEOH PDQXIDFWXUHU SULFH LQFUHDVHV 5HFRPPHQG RUGHULQJ )) ( SURGXFW RQFH IXQGV DUH UHFHLYHG WR DYRLG LQFXUULQJ DGGLWLRQDO FRVWV 'HOD\HG SURGXFWLRQ DQG GHOLYHU\ GDWHV FDQ EH QRWHG DW WKH WLPH RI RUGHU SODFHPHQW WR FRLQFLGH ZLWK EXLOGLQJFRPSOHWLRQGDWHV$Q\FRVWVLQFXUUHGGXHWRPDQXIDFWXUHUSULFHLQFUHDVHVZLOOEHWKH EXUGHQRIWKHFRQWUDFWRU 'DYLV%DFRQ:DJHV 'DYLV%DFRQ:DJHVGRQRWDSSO\WRWKH)) (LQVWDOOHUIURPWKHJRYHUQPHQWVXSSO\VRXUFHV7KH ZRUNIRUFHIRUWKH)) (LQVWDOODWLRQDQGGHOLYHU\VKDOOEHVHSDUDWHDQGGLVWLQFWIURPWKHODERU ZRUNIRUFHSHUIRUPLQJXQGHUWKHFRQVWUXFWLRQFRQWUDFW 6DOHV7D[ ([HPSWLRQV IRU FHUWDLQ 6WDWH RU /RFDO WD[HV PD\ EH DYDLODEOH WR WKH FRQWUDFWRU DQGRU LWV VXEFRQWUDFWRUV 7KH FRQWUDFWRU PXVW WDNH PD[LPXP DGYDQWDJH RI DOO H[HPSWLRQV LQFOXGLQJ REWDLQLQJDUHVDOHSHUPLWIURP6WDWHDQG/RFDOWD[DWLRQDXWKRULWLHVZKHWKHUDYDLODEOHWRLWGLUHFWO\ RUDYDLODEOHWRWKHFRQWUDFWRUEDVHGRQDQH[HPSWLRQDIIRUGHGWKHJRYHUQPHQW7KHUHVSRQVLELOLW\ IRUSD\LQJDSSOLFDEOHWD[HVUHVWVZLWKWKHFRQWUDFWRU6WDWHDQGORFDOWD[HVDSSOLFDEOHWRWKH )) (OLQHZLOOEHLQFOXGHGZLWKWKHVXEFRQWUDFWRU VTXRWHLIDSSOLFDEOH$Q\LWHPVSXUFKDVHGDV EXLOGLQJPDWHULDOVVXFKDVFDUSHWDUHWD[DEOH %RQGV )) (OLQHLWHPLVQRWFRQVLGHUHGFRQVWUXFWLRQDQGWKHSULPHFRQWUDFWRUVKDOOQRWEHUHTXLUHGWR VHFXUHDQ\DGGLWLRQDOERQGIRUWKHDZDUGRIWKH)) (OLQHLWHPXQOHVVRWKHUZLVHLQGLFDWHGLQWKH 5)3,IDQ\DGGLWLRQDOERQGLVUHTXLUHGIRUWKH)) (OLQHLWHPLWLVWREHLQFOXGHGLQWKHSULPH FRQWUDFWRU V)) (+$5 8QLTXHLWHPLGHQWLILFDWLRQDQGYDOXDWLRQLVDV\VWHPRIPDUNLQJDQGYDOXLQJLWHPVGHOLYHUHGWR 'R'WKDWHQKDQFHVORJLVWLFVFRQWUDFWLQJDQGILQDQFLDOEXVLQHVVWUDQVDFWLRQV7KH,8,'SROLF\LV PDQGDWRU\IRUDOO'R'FRQWUDFWVWKDWUHTXLUHWKHGHOLYHU\RILWHPV$QLWHPLVDVLQJOHDUWLFOHRUD VLQJOH XQLW IRUPHG E\ D JURXSLQJ RI VXEDVVHPEOLHV FRPSRQHQWV RU FRQVWLWXHQW SDUWV 7KH FRQWUDFWRUPXVWSURYLGH'R'8QLTXHLWHPLGHQWLILFDWLRQYDOXDWLRQDQGGHOLYHU\RIGDWDIRUDOO UHTXLUHG)) (LWHPVIRUZKLFKWKHJRYHUQPHQW VXQLWDFTXLVLWLRQFRVWLVRUPRUH ,QVWDOODWLRQ 7KH)) (SDFNDJHLQFOXGHVWKHLQVWDOODWLRQRIDOOIXUQLWXUHDQGIXUQLVKLQJVDVVSHFLILHGLQWKH )) ( SDFNDJH 7KH LQVWDOODWLRQ GHDOHU VSHFLILHG LQ WKH )) ( SDFNDJH ZLOO UHFHLYH VWRUH LI UHTXLUHGWUDQVSRUWWRWKHSURMHFWVLWHRIIORDGLQVLGHGHOLYHUXQSDFNDVVHPEOHSODFHLQVWDOO FOHDQLIUHTXLUHGDQGGLVSRVHRIDOOWKHWUDVKIRUDOOIXUQLWXUHDQGIXUQLVKLQJV7KH&RQWUDFWRU V ,QWHULRU 'HVLJQHU ZLOO EH UHVSRQVLEOH IRU VSHFLI\LQJ LQVWDOODWLRQ VHUYLFHV DQG ZDUHKRXVLQJ DV UHTXLUHGIRUDOOFROODWHUDOHTXLSPHQW,WLVWKH&RQWUDFWRU VUHVSRQVLELOLW\WRFRRUGLQDWHWKHEXLOGLQJ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH FRPSOHWLRQRFFXSDQF\DQGIXUQLWXUHLQVWDOODWLRQGDWHVZLWKWKHLQVWDOODWLRQGHDOHUVSHFLILHGLQWKH )) ( SDFNDJH $Q\ FRVWV DVVRFLDWHG ZLWK VWRULQJ RU GHOD\LQJ IXUQLWXUH VKLSPHQWV LV WKH UHVSRQVLELOLW\RIWKHFRQVWUXFWLRQFRQWUDFWRU ,QVWDOODWLRQ:DUUDQW\ $OOPRYDEOHIXUQLVKLQJVPXVWEHLQVWDOOHGLQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU VLQVWUXFWLRQVDQG ZDUUDQW\UHTXLUHPHQWV$OOPRYDEOHIXUQLVKLQJVPXVWEHOHYHODQGDOLJQHGDQGDOOGRRUVGUDZHUV DQGDFFHVVRULHVPXVWEHOHYHODQGDOLJQHGWRRSHQFORVHDQGRWKHUZLVHRSHUDWHVPRRWKO\DQG VHFXUHO\$OOV\VWHPVIXUQLWXUHPXVWEHLQVWDOOHGE\WKHV\VWHPVIXUQLWXUHPDQXIDFWXUHU VGHDOHU RI UHFRUG DQG QRW WKH JHQHUDO &RQWUDFWRU 7KH &RQWUDFWRU PXVW UHSDLU WR WKH FXVWRPHU V VDWLVIDFWLRQDQ\DOOGDPDJHWRDQ\IDFLOLW\ILQLVKWKDWLVDUHVXOWRIWKHIXUQLWXUHLQVWDOODWLRQDQG FRUUHFWDOOSXQFKOLVWLWHPVIRUWKHIXUQLWXUHIXUQLVKLQJV 2UGHULQJ'RFXPHQWDWLRQ 7ZRFRSLHVRIDOORUGHULQJGRFXPHQWDWLRQPXVWEHSURYLGHGWRWKHFRQWUDFWLQJRIILFHULQFOXGLQJ )DFWRU\2UGHUQXPEHU)2DQGZDUUDQW\LQIRUPDWLRQ 3RVW$ZDUG&KDQJHV $IWHUDZDUGRIWKH)) (OLQHLWHPPRGLILFDWLRQDQ\UHTXHVWWRFKDQJHWKH)) (LWHPVPXVWEH VXEPLWWHG RQ WKH &RQVWUXFWLRQ 3URMHFW 0DQDJHU 7KH )) ( PRGLILFDWLRQ KDV EHHQ DFFHSWHG SULFHGDQGQHJRWLDWHGEDVHGRQVSHFLILFOLQHLWHPVDVGHWDLOHGLQWKHILQDOSDFNDJH7KRVHLWHPV KDYHEHHQDJUHHGWRFRQVLGHULQJFRORUVSHFLILFW\SHDQGTXDOLW\RIPDWHULDOSULFHVXVWDLQDELOLW\ OLIH F\FOH DQG GHDOHUVKLS VHUYLFH 7KH *RYHUQPHQW ZLOO H[SHFWDQG UHTXLUH WKH FRQWUDFWRU WR SURYLGH H[DFWO\ WKRVH LWHPV 6KRXOG FKDQJHV EHFRPH QHFHVVDU\FDUHIXO FRQVLGHUDWLRQ LV UHTXLUHGWRHQVXUHWKDWHTXLYDOHQWTXDOLW\SULFHDQGRWKHUDVSHFWVRIWKHLWHPLVPDLQWDLQHG 2WKHUZLVHSULFHDGMXVWPHQWVPXVWEHQHJRWLDWHG7KH&RQVWUXFWLRQ3URMHFW0DQJHUZLOOREWDLQ DSSURYDOLQFRQVXOWDWLRQZLWKWKHFOLHQWGHSDUWPHQWIRUDQ\FKDQJHVWRWKH)) ( 3RVWDZDUG)) (PDQXIDFWXUHU VSULFHLQFUHDVHVDUHWKHUHVSRQVLELOLW\RIWKH&RQWUDFWRUDQG PXVWQRWEHWUDQVIHUUHGWRWKHJRYHUQPHQW5HFRPPHQGRUGHULQJ)) (SURGXFWRQFHIXQGVDUH UHFHLYHGWRDYRLGLQFXUULQJDGGLWLRQDOFRVWV'HOD\HGSURGXFWLRQDQGGHOLYHU\GDWHVFDQEHQRWHG DWWKHWLPHRIRUGHUSODFHPHQWWRFRLQFLGHZLWKEXLOGLQJFRPSOHWLRQGDWHV 63(&,$/&216758&7,21$1''(02/,7,21 6(/(&7,9(%8,/',1*'(02/,7,21 ,QJHQHUDOWHUPVGHPROLWLRQZRUNPXVWLQFOXGHWKHUHPRYDODQGHIIHFWLYHPDQDJHPHQWDQGGLVSRVLWLRQRI H[LVWLQJFRQVWUXFWLRQDQGRUVWUXFWXUHV7DNHFDUHWRSUHYHQWGDPDJHWRH[LVWLQJXWLOLWLHVDQGFRQVWUXFWLRQ WKDW DUH QRW VFKHGXOHG IRU GHPROLWLRQ ,I GDPDJH RFFXUV PDNH UHSDLUV WR WKH VDWLVIDFWLRQ RI WKH &RQVWUXFWLRQ3URMHFW0DQDJHUDQGDWQRFRVWWRWKH&LW\RI'HQWRQ&RPSO\ZLWKORFDO$FWLYLW\DQG ,QVWDOODWLRQORFDOUHTXLUHPHQWVUHJDUGLQJGHPROLWLRQDQGUHPRYDO8QOHVVRWKHUZLVHVSHFLILHGLQ3DUWDOO GHPROLVKHGPDWHULDOVDQGHTXLSPHQWPXVWEHUHPRYHGIURPJRYHUQPHQWSURSHUW\LQDFFRUGDQFHZLWK DSSOLFDEOHODZVDQGUHJXODWLRQVLQFOXGLQJORFDO$FWLYLW\RU,QVWDOODWLRQUHJXODWLRQV6HOOLQJRIGHPROLVKHG RUVDOYDJHGPDWHULDOVDQGHTXLSPHQWRQJRYHUQPHQWSURSHUWLHVLVSURKLELWHG 'HPROLWLRQ 3ODQ 1R GHPROLWLRQ ZRUN LV SHUPLWWHG WR WDNH SODFH XQWLO D 'HPROLWLRQ 3ODQ KDV EHHQ VXEPLWWHG WR DQG DSSURYHG E\WKH &RQVWUXFWLRQ3URMHFW 0DQDJHU 7KH 3ODQV PXVW WDNH LQWR FRQVLGHUDWLRQDQGLQGLFDWHPHWKRGRIUHPRYDOGLVSRVLWLRQDQGDEDWHPHQWRIHQYLURQPHQWDOO\KD]DUGRXV PDWHULDOV'HPROLWLRQGLVSRVLWLRQDQGDEDWHPHQWRIKD]DUGRXVPDWHULDOVPXVWFRPSO\ZLWKDOODSSOLFDEOH /RFDO6WDWHDQG)HGHUDOUHJXODWLRQVDQGODZV,IGHVWUXFWLYHLQYHVWLJDWLRQLVWRRFFXUWKH&RQVWUXFWLRQ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH 3URMHFW0DQDJHUVKDOODSSURYHD'HVWUXFWLYH,QYHVWLJDWLRQ3ODQ :KHQ KD]DUGRXV PDWHULDOV VXFK DV DVEHVWRV OHDG SDLQW 3&% DQGRWKHU KD]DUGRXV PDWHULDOV DUH LQYROYHGLQWKHSHUIRUPDQFHRIWKHZRUNWKHFRQWUDFWRUPXVWDEDWHUHPRYHDQGPDQDJHWKHKD]DUGRXV PDWHULDOVLQFRQVWUXFWLRQDQGILQLVKPDWHULDOVVXFKDVLQVXODWLRQIORRULQJZDOOPDWHULDOVFHLOLQJPDWHULDOV URRILQJ PDWHULDOV KHDWLQJ SOXPELQJ YHQWLODWLRQ DLU FRQGLWLRQLQJ HTXLSPHQW DQG LQVWDOODWLRQV LQ DFFRUGDQFHZLWK1DWLRQDODVZHOODVORFDO(QYLURQPHQWDO3URWHFWLRQ/DZVDQG5HJXODWLRQV +$=$5'286&20321(17$%$7(0(17 $VEHVWRV0DWHULDOV$VEHVWRVPXVWEHUHPRYHGWUDQVSRUWHGDQGPDQDJHGLQDFFRUGDQFHZLWK WKHHGLWHG8)*6(QJLQHHULQJ&RQWURORI$VEHVWRV&RQWDLQLQJ0DWHULDOV 3DLQW 5HODWHG :RUN 3HUIRUP ZRUN ZKLFK UHTXLUHV WKH GLVWXUEDQFH RI SDLQW WKDW KDYH EHHQ GHWHUPLQHGWRFRQWDLQDOORUDQ\RIWKHIROORZLQJOHDGFDGPLXPDQGFKURPLXPLQDFFRUGDQFH ZLWKWKHHGLWHG8)*6/HDGLQ&RQVWUXFWLRQ //5&RPSRQHQWV3HUIRUPZRUNZKLFKUHTXLUHVUHPRYDORIPHUFXU\DQG//5FRPSRQHQWVLQ DFFRUGDQFHZLWKWKHHGLWHG8)*67HPSRUDU\(QYLURQPHQWDO&RQWUROV 3&%V3HUIRUPZRUNZKLFKUHTXLUHVUHPRYDORI3&%FRQWDLQLQJFRPSRQHQWVRUPDWHULDOVLQ DFFRUGDQFH ZLWK WKH HGLWHG 8)*6 5HPRYDO DQG 'LVSRVDORI 3RO\FKORULQDWHG %LSKHQ\OV3&%V@ $QLPDO'URSSLQJV3HUIRUPZRUNZKLFKUHTXLUHVUHPRYDORIDQLPDOGURSSLQJVLQDFFRUGDQFH ZLWKWKHHGLW8)*67HPSRUDU\(QYLURQPHQWDO&RQWUROV 0ROG DQG 6SRUHV 3HUIRUP ZRUN ZKLFK UHTXLUHV UHPRYDO GLVSRVDO DQG UHPHGLDWLRQ RI PROG FRQWDPLQDWHGDUHDVLQDFFRUGDQFHZLWKWKHHGLW8)*60ROG5HPHGLDWLRQ 5DGRQ 3HUIRUP ZRUN ZKLFK LQYROYHV LPSOHPHQWDWLRQ RI D UDGRQ PLWLJDWLRQ V\VWHP LQ DFFRUGDQFHZLWKWKHHGLWHG8)*65DGRQ0LWLJDWLRQ 0HUFXU\ 3HUIRUP ZRUN ZKLFK UHTXLUHV WKH UHPRYDO RI PHUFXU\FRQWDLQLQJ HTXLSPHQW LQ DFFRUGDQFH ZLWK WKH HGLWHG 8)*6 +DQGOLQJ RI /LJKWLQJ%DOODVWV DQG /DPSV &RQWDLQLQJ3&%VDQG0HUFXU\ +D]DUGRXV0DWHULDOV5HSRUWLQJD'DLO\5HSRUW1RWLI\WKH&RQWUDFWLQJ2IILFHURIZRUNLQYROYLQJ KD]DUGRXV PDWHULDOV DEDWHPHQW DQG UHPRYDO LQFOXGLQJ WKH TXDQWLWLHV LQYROYHG RQ GDLO\ UHSRUWVE +D]DUGRXV 0DWHULDO ,QYHQWRU\ 5HSRUW 7KH &RQWUDFWRUPXVWSURYLGHDOLVWRIDOO KD]DUGRXVPDWHULDOVXVHGRQWKHVLWH (/(&75,&$/',675,%87,21 (OHFWULFDO 8WLOLWLHV 'HVLJQ DQG &RQVWUXFWLRQ 6LWH HOHFWULFDO XWLOLWLHV LQFOXGH DOO H[WHULRU HOHFWULFDOZRUNLQFOXGLQJWKHFRQQHFWLRQWRWKHSULPDU\GLVWULEXWLRQV\VWHP7KLVDOVRLQFOXGHV WHOHSKRQHDQGFDEOHWHOHYLVLRQVXSSOLHV 3URYLGHHOHFWULFDORYHUKHDGDQGXQGHUJURXQGGLVWULEXWLRQV\VWHPVLQDFFRUGDQFHZLWK,(((& 1DWLRQDO (OHFWULFDO 6DIHW\ &RGH 1)3$ ORFDO XWLOLWLHV FRPSDQ\ UHTXLUHPHQWV DQG ORFDO DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ 3URMHFW1XPEHU /RFXVW6WUHHW'HQWRQ7H[DV ([KLELW,,,(1*,1((5,1*$1'&216758&7,215(48,5(0(1763DJH $FWLYLW\JXLGHOLQHV &RRUGLQDWLRQ:LWK/RFDO8WLOLWLHV&RPSDQ\DQG/RFDO$FWLYLW\6HUYLFHPHWHUVIRUHOHFWULFDO VHUYLFHV PXVW EH SURYLGHG DQG LQVWDOOHG LQ FRQIRUPDQFH ZLWK WKH ORFDO XWLOLWLHV FRPSDQ\ UHTXLUHPHQWVDQGORFDODFWLYLW\JXLGHOLQHV 7UDQVIRUPHUV:KHQWUDQVIRUPHUVDUHUHTXLUHGWKH'HVLJQHURI5HFRUGPXVWXWLOL]H8)*6 6HFWLRQThree-Phase Pad Mounted Transformers8)*66HFWLRQSingle- Phase Pad Mounted TransformersRU8)*66HFWLRQOverhead Transmission and DistributionIRUWKHSURMHFWVSHFLILFDWLRQDQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQVHFWLRQDVD SDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW 6ZLWFKHV&RQWUROVDQG'HYLFHV:KHQVZLWFKHVRUFRQWUROGHYLFHVDUHUHTXLUHGWKH'HVLJQHU RI5HFRUGPXVWXWLOL]H8)*66HFWLRQ6)Insulated Pad Mounted SwitchgearRU 8)*66HFWLRQOverhead Transmission and DistributionIRUWKHSURMHFWVSHFLILFDWLRQ DQGPXVWVXEPLWWKHHGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW (;7(5,25/,*+7,1*),;785(6$1'&21752/6 8WLOL]H EURDG VSHFWUXP ZKLWH OLJKW VRXUFHV VXFK DV PHWDO KDOLGH LQGXFWLRQ /LJKW (PLWWLQJ 'LRGH /(' DQG IOXRUHVFHQW WR SURYLGH JRRG YLVLELOLW\ DW ORZOLJKW OHYHOV XQOHVV OLJKWLQJ LV UHTXLUHG WR PDWFK H[LVWLQJ VRXUFHV 7KH ,(61$ WK (GLWLRQ +DQGERRN KDV GHYHORSHG D PHWKRGRORJ\WRDSSO\ZKLWHOLJKW &RPSO\ZLWK$16,$6+5$(,(6IRUDOOH[WHULRUOLJKWLQJDSSOLFDWLRQVDQGFRQWUROV &RPSO\ZLWK(3$&7WKHH[WHULRUOLJKWLQJSRZHUGHQVLW\PXVWEHEHORZ$6+5$(E\ LIFRQVLGHUHGDEXLOGLQJORDGDQGLIFRQVLGHUHGDQRQEXLOGLQJORDG 3URYLGH VXUJH SURWHFWLYH GHYLFH 63' DW SDQHOERDUGV WKDW LQFOXGH FLUFXLWV IHHGLQJ H[WHULRU OLJKWLQJV\VWHPV &RRUGLQDWHWKHGHVLJQDQGOXPLQDLUHVHOHFWLRQZLWKWKHODQGVFDSHGHVLJQHU6XFKFRRUGLQDWLRQ VKRXOGLQFOXGHWKHORFDWLRQRISROHVZKLFKPD\FRQIOLFWZLWKWUHHORFDWLRQV :KHQH[WHULRUOLJKWLQJLVUHTXLUHGWKHGHVLJQHURIUHFRUGPXVWXWLOL]H8)*66HFWLRQIRU WKHSURMHFWVSHFLILFDWLRQVHFWLRQDVSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFWDQGPXVWVXEPLW WKHHGLWHGVSHFLILFDWLRQVHFWLRQDVDSDUWRIWKHGHVLJQVXEPLWWDOIRUWKHSURMHFW3URYLGH³GDUN VN\´FRPSOLDQWH[WHULRUOLJKWIL[WXUHVDQGGHVLJQWRPLQLPL]HOLJKWWUHVSDVVDQGOLJKWSROOXWLRQ 6,7(&20081,&$7,21 6(&85,7< 7HOHSKRQH'LVWULEXWLRQ6\VWHP3URYLGHDOOWHOHSKRQHGLVWULEXWLRQV\VWHPVLQDFFRUGDQFHZLWK (,$7,$6WDQGDUGV1)3$DQGWKHFRJQL]DQWWHOHSKRQHFRPSDQ\UHTXLUHPHQWV &DEOH7HOHYLVLRQ6\VWHP3URYLGHDOOFDEOHWHOHYLVLRQV\VWHPVLQDFFRUGDQFHZLWK1)3$ DQGWKHFRJQL]DQWFDEOHWHOHYLVLRQFRPSDQ\UHTXLUHPHQWVDQG%,&6,UHFRPPHQGDWLRQV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ ExhibitIV NetworkClosetStandards 'LPHQVLRQV Й6L]H; SUHIHUUHGVHH$SSHQGL[EHORZ ЙǡȂ /LJKWLQJUHTXLUHPHQWV Й/LJKWIL[WXUHVVKRXOGEHORFDWHGRYHUKHDG Й3URYLGHDWOHDVWOX[RIEULJKWO\OLW Й0RWLRQVHQVRUOLJKWVZLWFKIRUHQHUJ\HIILFLHQF\ +9$&QHHGVUHTXLUHPHQWV Й7KHV\VWHPVKRXOGEHVXIILFLHQWWRVXVWDLQDVWHDG\WHPSHUDWXUHRIGHJUHHV Й7KH+9$&PXVWGUDLQRXWVLGHWKHURRP (OHFWULFDORXWOHWVTXDQWLW\ Й7ZRRXWOHWVRQHDFKRIWKHIRXUZDOOVRQDWOHDVWWZRVHSDUDWH9$03FLUFXLWVDW VWDQGDUGKHLJKW Й(OHFWULFDOJURXQGURGSURYLGHGIRUJURXQGLQJWKHQHWZRUNUDFN 6HFXULW\ Й&DUGUHDGHUFRQWUROOHGDFFHVV /RFDWLRQRIWKHURRP Й&ORVHWPXVWEHFHQWUDOO\ORFDWHGWRSURYLGHQRPRUHWKDQ¶GLVWDQFHWRDQ\MDFN WHUPLQDWLRQLQWKHEXLOGLQJ Й,IDQ\VLQJOHKRPHUXQH[FHHGV¶WKHUHQHHGWREHDQDGGLWLRQDOURRPRQV\PPHWULFDO HQGRIEXLOGLQJ &HLOLQJ Й1RORRVHRUGXVWSURGXFLQJFHLOLQJPDWHULDO Й7ZR¶VWXEVIRUGDWDFDEOLQJHQWUDQFHWRWKHURRP :DOOV ЙôLQFK3O\ZRRGRQDOOIRXUZDOOVIHHWKLJKDQGVWDUWLQJIHHWIURPWKHIORRU )ORRULQJ Й6HDOHGFRQFUHWHWRSUHYHQWGXVWEUHDNGRZQ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ $SSHQGL[ 7KLV LWHP PD\EHDGMXVWHGWRPHHWWKHEXLOGLQJ VXQLTXH QHHGVE\FRQVXOWLQJZLWK WKH&LW\RI'HQWRQ 7HFKQRORJ\ 6HUYLFHVGHSDUWPHQW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ ŝƚǇŽĨĞŶƚŽŶd^ůŽƐĞƚǆĂŵƉůĞƐ WĂŐĞϭ KƉƚŝŽŶϭ͗ϭϬ͛ǆϴ͛ KƉƚŝŽŶϮ͗ϭϬ͛ǆϴ͛ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ ŝƚǇŽĨĞŶƚŽŶd^ůŽƐĞƚǆĂŵƉůĞƐ WĂŐĞϮ KƉƚŝŽŶϯ͗ϭϬ͛ǆϳ͛ KƉƚŝŽŶϰ͗ϵ͛ǆϴ͛ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ ŝƚǇŽĨĞŶƚŽŶd^ůŽƐĞƚǆĂŵƉůĞƐ WĂŐĞϯ KƉƚŝŽŶϱ͗ϲ͛Ͳϵ͟ǆϴ͛ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ KƉƚŝŽŶϲ͗ϲ͛Ͳϵ͟ǆϳ͛ ŝƚǇŽĨĞŶƚŽŶd^ůŽƐĞƚǆĂŵƉůĞƐ WĂŐĞϰ KƉƚŝŽŶϳ͗ϲ͛ǆϴ͛ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E ŝƚǇŽĨĞŶƚŽŶĞǀĞůŽƉŵĞŶƚ^ĞƌǀŝĐĞƐƵŝůĚŝŶŐ WƌŽũĞĐƚEƵŵďĞƌ ϭϯϬϳ>ŽĐƵƐƚ^ƚƌĞĞƚĞŶƚŽŶ͕dĞǆĂƐ KƉƚŝŽŶϴ͗ϱ͛Ͳϯ͟ǆϳ͛ DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI '(6,*1%8,/'(5¶6$5&+,7(&7(1*,1((56(59,&(6 $1''(/,9(5$%/(6 7KLVGRFXPHQWRXWOLQHVWKHPLQLPXPVHUYLFHVUHTXLUHGDQGLVQRWLQWHQGHGWRSUHFOXGHDQ\RWKHUVHUYLFHV UHTXLUHG E\ WKH FRQWUDFW RU JRRG SUDFWLFH $OO &RQVWUXFWLRQ 'RFXPHQWV DQG RWKHU GHVLJQ ZRUN VKDOO LQFRUSRUDWHWKHUHTXLUHPHQWVRIDOOJRYHUQLQJORFDOPXQLFLSDOVWDWHDQGIHGHUDOFRGHVLQFOXGLQJJRYHUQLQJ FRGHVDQGUHJXODWLRQVIRUDFFHVVLELOLW\ 7KHSURMHFWVKDOOLQFOXGHEXWQRWEHOLPLWHGWRWKHIROORZLQJ • 3URJUDPPLQJDVUHTXLUHGIRUWKLVSURMHFW • 6LWH'HYHORSPHQWOLPLWHGPRGLILFDWLRQVWRVLWH • 6LWH8WLOLWLHVPRGLILFDWLRQVSHUSURMHFWUHTXLUHPHQWV • 6WUXFWXUDO6\VWHPVPRGLILFDWLRQVSHUSURMHFWUHTXLUHPHQWV • ([WHULRU(QYHORSHOLPLWHGPRGLILFDWLRQVIRUWKLVSURMHFW • ,QWHULRUEXLOGRXWGUDZLQJVDQGILQLVKHVGRFXPHQWDWLRQ • &DVHZRUNIL[WXUHVHTXLSPHQWDQGVSHFLDOWLHV • (OHFWULFDO0HFKDQLFDODQG3OXPELQJ6\VWHPV • /LIH6DIHW\6\VWHPV • 'DWD&RPPXQLFDWLRQ6\VWHPV 7KH'HVLJQ%XLOGHUVKDOOHVWDEOLVKDQGPDLQWDLQDSURMHFWZHEVLWHIRUWKHGXUDWLRQRIWKHSURMHFWWRIDFLOLWDWH FRPPXQLFDWLRQ7KHZHEVLWHVKDOOEHRUJDQL]HGWRKROGDOOPHHWLQJPLQXWHVGUDZLQJVUHSRUWVVKRS GUDZLQJVXEPLWWDOORJV5HTXHVWIRU,QIRUPDWLRQORJHWFDQGVKDOOEHDFFHVVLEOHWRWKH&LW\RI'HQWRQVWDII FRQVXOWDQWV'HVLJQ%XLOGHUVDQGRWKHUVDVGHWHUPLQHGWREHDSSURSULDWHGXULQJWKHOLIHRIWKHSURMHFW 'HOLYHUDEOHVUHTXLUHGE\WKLVGRFXPHQWVKDOOFRPSO\ZLWKWKHIROORZLQJVWDQGDUGV :LWKWKHH[FHSWLRQRIGUDZLQJVDQGUHQGHULQJVDOOGRFXPHQWVLHUHSRUWVPHHWLQJPLQXWHVWKH3URJUDP RI5HTXLUHPHQWVVSHFLILFDWLRQVSURMHFWPDQXDOVHVWLPDWHVHWFVKDOOHDFKEHSUHSDUHGXVLQJ0LFURVRIW :RUG0LFURVRIW([FHORU0LFURVRIW3URMHFWIRUPDWDVDSSURSULDWHDQGSULQWHGRQZKLWH´;´SDSHU 6SHFLDOUHSRUWVVXFKDVWKH3URJUDPRI5HTXLUHPHQWVVKDOOEHERXQGLQWKUHHULQJVODQWULQJELQGHUV 3DJHVVKDOOEHUHDGDEOHZLWKWKHVKRUWD[LVLQWKHKRUL]RQWDOGLUHFWLRQLHVWDQGDUGEXVLQHVVOHWWHUIRUPDW 6HFWLRQVVKDOOEHGLYLGHGZLWKFDUGVWRFNDQGWDEV'LVWULEXWLRQRIWKHVHGRFXPHQWVVKDOOEHPDGHWR LQGLYLGXDODGGUHVVHVDVZLOOEHSURYLGHGE\WKH&LW\RI'HQWRQ&RQVWUXFWLRQ3URMHFW0DQDJHU'LVWULEXWLRQ VKDOODOVRLQFOXGHDQHOHFWURQLFILOHGHOLYHUHGDVDQHOHFWURQLFPDLODWWDFKPHQWRURQD&' 'UDZLQJVVKDOOEHSUHSDUHGXVLQJ$XWR&DGIRUPDWWHGIRUDSULQWLQJVL]HRI´[´$OO&$'GRFXPHQWV DUHDOORZHGWREHFRPSOHWHGXVLQJILUP¶VOD\HULQJVWDQGDUGVDQGSURWRFROLQFOXGLQJSRO\OLQHRIDOOURRPV )RQWVOLQHZHLJKWVDQGRWKHUIHDWXUHVVKDOOEHVHOHFWHGDVLVDSSURSULDWHWRUHDGLO\DOORZVDYLQJWKHILOHV LQ$XWR&DGZLWKRXWORVVRIIHDWXUHV)RQWVOLQHZHLJKWVDQGRWKHUIHDWXUHVVKDOOEHVHOHFWHGDSSURSULDWHO\ IRUSULQWLQJDQGKDOIVL]HZKLOHPDLQWDLQLQJFODULW\DQGOHJLELOLW\'LVWULEXWLRQRIWKHVHGRFXPHQWVVKDOOEH PDGHWRLQGLYLGXDODGGUHVVHVDVZLOOEHSURYLGHGE\WKH&LW\RI'HQWRQ&RQVWUXFWLRQ3URMHFW0DQDJHU 'LVWULEXWLRQVKDOODOVRLQFOXGHDQHOHFWURQLFILOHGHOLYHUHGDVDQHOHFWURQLFPDLODWWDFKPHQWRURQD&' 'UDZLQJVSUHSDUHGIRUSUHVHQWDWLRQVVKDOOEH´[´DQGODPLQDWHGRQ´SUHVHQWDWLRQERDUG 6WXG\DQGRUSUHVHQWDWLRQPRGHOVVKDOOEHFRQVWUXFWHGWRZLWKVWDQGKDQGOLQJE\GHOLYHU\SHUVRQVDQG VKDOOLQFOXGHDSURWHFWLYHER[HV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI )ROORZLQJDUHWKHUHTXLUHPHQWVDQGGHOLYHUDEOHVE\SKDVH 3UH'HVLJQ3URJUDPPLQJ3KDVH 'HVLJQ%XLOG$UFKLWHFWXUH (QJLQHHULQJ$FWLYLWLHV 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO PHHW ZLWK &LW\ RII'HQWRQ VWDII DQG RWKHU RXWVLGH VRXUFHVDVLVQHFHVVDU\WRDVFHUWDLQDQGFRQILUPWKHSURJUDPPDWLFQHHGVDQGUHTXLUHPHQWV IRUWKHSURMHFW7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOGHYHORSDFRPSUHKHQVLYH3URJUDPRI 5HTXLUHPHQWVGRFXPHQWWKDWLQFOXGHVSHUVRQQHOSURMHFWLRQVVSDFHSURMHFWLRQVLHURRP E\URRP VXPPDU\ URRP GDWD VKHHWV HTXLSPHQW GDWD URRP E\URRP IXQFWLRQDO UHTXLUHPHQWVURRPE\URRPV\VWHPVFULWHULDEXLOGLQJIXQFWLRQDOFULWHULDEXLOGLQJV\VWHPV FULWHULDDGMDFHQF\GLDJUDPVDQGVLPSOHGLDJUDPVRIHDFKURRP 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOVWXG\DOWHUQDWLYHGHVLJQVFHQDULRVLIUHTXLUHGDVUHTXLUHG E\ WKH 5HTXHVW IRU 3URSRVDO DQG WKH UHODWLRQVKLS RI WKH EXLOGLQJ WR LWV FRQWH[W LQ WKH DOWHUQDWLYHORFDWLRQV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOLGHQWLI\DQGDQDO\]HPDMRUSURMHFWLVVXHVDQGFKDOOHQJHV LQFOXGLQJFLYLOXWLOLW\DQGRWKHUHOHPHQWVDIIHFWHGE\DQGRULQYROYHGLQWKHFRQVWUXFWLRQRI WKHSURMHFWSULRUWRWKHVWDUWRIVFKHPDWLFGHVLJQ7KLVVKDOOLQFOXGHDQDQDO\VLVRI]RQLQJDQG FRGHLPSOLFDWLRQVOLPLWDWLRQDQGUHTXLUHPHQWV 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO HYDOXDWH DOWHUQDWLYH DSSURDFKHV IRU WKH GHVLJQ DQG FRQVWUXFWLRQRIWKHSURMHFWDQGWKHFRVWDQGVFKHGXOHLPSOLFDWLRQRIWKRVHDSSURDFKHV 7KH'HVLJQ%XLOGHUVKDOOSUHSDUHDVFKHGXOHIRUWKHSURMHFW 7KH'HVLJQ%XLOGHU¶VHVWLPDWLQJWHDPVKDOOSUHSDUHDFRVWHVWLPDWHEDVHGRQWKHDSSURYHG 3URJUDPRI5HTXLUHPHQWV 7KH'HVLJQ%XLOGHU¶VHVWLPDWLQJWHDPVKDOODVVLVW&LW\RI'HQWRQLQSUHSDULQJDSURMHFW EXGJHW 'HOLYHUDEOHV &RSLHV RI D 3UH'HVLJQ 5HSRUW ZKLFK VKDOO VXPPDUL]H DOOWKH UHVXOWV DOWHUQDWLYHV FRQVXOWDWLRQVVFKHGXOHVDQGFRVWHVWLPDWHVSUHVHQWHGWRWKH&LW\RI'HQWRQLQWKHIRUHJRLQJ DFWLYLWLHVDQGDFFRPSDQLHGE\DVHSDUDWHERXQG3URJUDPRI5HTXLUHPHQWV7KLVUHSRUW VKDOOFRQWDLQDOLVWRIUHFRPPHQGDWLRQVWRWKH&LW\RI'HQWRQFRQFHUQLQJWKH'HVLJQ%XLOGHU¶V $UFKLWHFWXUDOUDPLILFDWLRQVRIWKH3URJUDPRI5HTXLUHPHQWV $ZULWWHQOLVWRIUHFRPPHQGDWLRQVWR&LW\RI'HQWRQFRQFHUQLQJWKHPDMRUFRVWLPSOLFDWLRQVWR WKHSUHOLPLQDU\3URJUDPRI5HTXLUHPHQWV 0LVFHOODQHRXV 7KH'HVLJQ%XLOGHUVKDOOHVWDEOLVKDQGPDLQWDLQDSURMHFWZHEVLWHIRUWKHGXUDWLRQRIWKH SURMHFWWRIDFLOLWDWHFRPPXQLFDWLRQ7KHZHEVLWHVKDOOEHRUJDQL]HGWRKROGDOOPHHWLQJ PLQXWHVGUDZLQJVUHSRUWVVKRSGUDZLQJVXEPLWWDOORJVHWFDQGVKDOOEHDFFHVVLEOHWRWKH &LW\RI'HQWRQVWDIIFRQVXOWDQWVDQGRWKHUVDVDSSURSULDWHGXULQJWKHOLIHRIWKHSURMHFW 7KH3UH'HVLJQ5HSRUWDQGWKH3URJUDPRI5HTXLUHPHQWVVKDOOHDFKEHSULQWHGRQZKLWH´ ;´SDSHUDQGERXQGLQELQGHU DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI (QJLQHHULQJDQDO\VLVDQGFRVWFRPSDULVRQVQHFHVVDU\WRVXSSRUWSURJUDPPDWLFGDWDDQGWR GHILQHDOWHUQDWLYHVVKDOOEHUHYLHZHGZLWKWKH&LW\RI'HQWRQEHIRUHSURFHHGLQJ 7KHLPSDFWRIH[LVWLQJXWLOLWLHVDQGVRLOFRQGLWLRQVVKDOOEHUHYLHZHGZLWKWKH&LW\RI'HQWRQ EHIRUHSURFHHGLQJ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOOQRWSURFHHGLQWRWKH6FKHPDWLF3KDVH RIGHVLJQXQWLOWKH3UH'HVLJQUHSRUWKDVEHHQDSSURYHGE\WKH&LW\RI'HQWRQ&RQVWUXFWLRQ 3URMHFW0DQDJHU $OOGRFXPHQWVVKDOOEHGHOLYHUHGWRWKH&LW\RI'HQWRQLQSULQWHGDQGHOHFWURQLFIRUPDW$OO HOHFWURQLFWH[WILOHVVKDOOEHGHOLYHUHGLQ0LFURVRIW:RUGRU([FHOIRUPDW &$'GRFXPHQWVDUHWREHSURYLGHGWR&LW\RI'HQWRQLQ$XWR&$'IRUPDWRQ&'RU86%GULYH 6FKHPDWLF'HVLJQ %DVHGRQWKH3URJUDPRI5HTXLUHPHQWVDQGEXGJHWHVWDEOLVKHGDQGDSSURYHGE\WKH&LW\RI 'HQWRQ WKH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO SURSRVH DOWHUQDWHVFKHPDWLF GHVLJQV DQG DOWHUQDWLYHVIRUVROYLQJUHTXLUHPHQWVLVVXHVDQGTXHVWLRQVLQFOXGLQJ • 3ODQDUUDQJHPHQWRIDOOSURJUDPVSDFHV • 6ROXWLRQRIDGMDFHQF\UHTXLUHPHQWV • 0DVVLQJRISURJUDPEXLOGLQJHOHPHQWV • &KRLFHRIEXLOGLQJPDWHULDOV • &KRLFHRI%XLOGLQJ6\VWHPVWREHFRPSOLPHQWDU\WRWKHH[LVWLQJ • 3KDVLQJRIFRQVWUXFWLRQLIUHTXLUHGRUDGYDQWDJHRXV • $OORWKHUSHUWLQHQWUHFRPPHQGDWLRQVE\WKH'HVLJQ%XLOGHU¶V$UFKLWHFW $IWHUUHYLHZLQJDYDLODEOHLQIRUPDWLRQWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOLQYHVWLJDWHDQG DQDO\]HWKHPDMRUSURMHFWFKDOOHQJHVDORQJZLWKLGHQWLI\LQJDQ\PDMRULVVXHVWKDWQHHGWREH UHVROYHGSULRUWRWKHVWDUWRI'HVLJQ'HYHORSPHQWLQFOXGLQJDGHWDLOHGDQDO\VLVDQGUHSRUWRI DSSOLFDEOHFRGHVDQGUHJXODWLRQV $WWKHHQGRIWKH6FKHPDWLF'HVLJQ3KDVHWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHYLHZZLWK WKH&LW\RI'HQWRQDOWHUQDWLYHDSSURDFKHVIRUWKHGHVLJQDQGFRQVWUXFWLRQRIWKH3URMHFWDQG WKHFRVWDQGVFKHGXOHLPSOLFDWLRQVRIWKRVHDSSURDFKHV 6WXGLHVVKDOOLQFOXGHVNHWFKHVGUDZLQJVHWFLOOXVWUDWLQJWKHVFDOHIXQFWLRQVDQGUHODWLRQVKLSV RIWKHSURMHFWFRPSRQHQWVLQDPDQQHUWKDWGHPRQVWUDWHVRQHRUPRUHVROXWLRQVWRWKH SURJUDP 7KH 'HVLJQ%XLOGHU¶V HVWLPDWLQJ WHDP VKDOO SUHSDUH D VFKHPDWLF GHVLJQ HVWLPDWH $GGLWLRQDOO\WKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOZRUNZLWKWKHFRVWHVWLPDWRUWRUHVROYHDQ\ GLIIHUHQFHEHWZHHQWKHHVWLPDWHVWRZLWKLQILYHSHUFHQWEHWZHHQWKHP 7KHVFKHPDWLFGHVLJQSDFNDJHVKDOOEHSUHSDUHGDQGLVVXHGIRUWKH&LW\RI'HQWRQUHYLHZ 7KH UHSRUW VKDOO LQFOXGH ZULWWHQ DQG JUDSKLF GHVFULSWLRQV RI 'HVLJQ%XLOGHU¶V SURSRVHG $UFKLWHFWXUDODQGEXLOGLQJV\VWHPV7KHUHSRUWVKDOODOVRLQFOXGHDWDEXODWLRQRIDUHDVJURVV QHWVTXDUHIHHWDFRGHDQDO\VLVDFRVWHVWLPDWHDQGDQRXWOLQHVSHFLILFDWLRQSURMHFW GHVFULSWLRQLQFOXGLQJDWDPLQLPXPWKHIROORZLQJ &LYLO •6LWH'HYHORSPHQWOLPLWHGVFRSHIRUWKLVSURMHFW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI •8WLOLWLHVDVUHTXLUHGIRUWKLVSURMHFW 'HVLJQ%XLOGHU¶V$UFKLWHFWXUDO •&RQFUHWH •6WHHO •&DUSHQWU\ •5RRILQJ •'RRUV :LQGRZV •(DUWKZRUNDVUHTXLUHGIRUWKLVSURMHFW •([WHULRUPDWHULDODQGILQLVKHV •,QWHULRUPDWHULDOVDQGILQLVKHV •6SHFLDOW\,WHPV 6WUXFWXUDO±DVUHTXLUHGIRUWKLVSURMHFW •'HVLJQ&ULWHULD •)UDPLQJ&RQFHSW 0HFKDQLFDO •'HVLJQ&ULWHULD •3ULPDU\(TXLSPHQW (OHFWULFDO •'HVLJQ&ULWHULD •/LJKWLQJ&RQFHSWVDQGOHYHOV •%XLOGLQJ/RDGV •3ULPDU\HTXLSPHQW 3OXPELQJ •'HVLJQ&ULWHULD •)L[WXUHV •)LUH3URWHFWLRQ /DQGVFDSH •3DYHG$UHDVDVUHTXLUHGIRUWKLVSURMHFW •3ODQWHG$UHDVDVUHTXLUHGIRUWKLVSURMHFW 6LWH8WLOLWLHV •([WHQVLRQVLIUHTXLUHGIRUWKLVSURMHFW •'UDLQDJHDQGVHZHUV\VWHPLIUHTXLUHGIRUWKLVSURMHFW 'HOLYHUDEOHV &RSLHVRIWKHVFKHPDWLFGHVLJQGRFXPHQWV 3UHVHQWDWLRQ PDWHULDOV DV UHTXHVWHG E\ WKH &LW\ RI 'HQWRQ LQFOXGLQJ 'HVLJQ%XLOGHU¶V $UFKLWHFWXUDOFRPSXWHUJHQHUDWHGJUDSKLFVLQFOXGLQJYLGHRZDONWKUXVHWF'HVLJQ%XLOGHU¶V $UFKLWHFW¶VVWXGLHVVNHWFKHVUHQGHULQJVFRPSXWHUJHQHUDWHGJUDSKLFVDQGVWXG\PRGHOV DUHLQFOXGHGLQWKHEDVHSURSRVDODGGLWLRQDOKLJKTXDOLW\SUHVHQWDWLRQPDWHULDOVLIVSHFLDOO\ UHTXHVWHGDUHUHLPEXUVDEOHH[SHQVHV $OOGRFXPHQWVVKDOOEHGHOLYHUHGWRWKH&LW\RI'HQWRQLQSULQWHGDQGHOHFWURQLFIRUPDW 'HVLJQ'HYHORSPHQW3KDVH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI $ ($FWLYLWLHV %DVHGRQ6FKHPDWLF'HVLJQ'RFXPHQWVDQGDQ\DGMXVWPHQWVDXWKRUL]HGE\WKH&LW\RI 'HQWRQLQWKHSURJUDPRU3URMHFWEXGJHWWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSUHSDUH'HVLJQ 'HYHORSPHQW6WXGLHVRIGHYHORSHGDQGGHWDLOHGGHVLJQVLQFOXGLQJEXWQRWOLPLWHGWR •6LWH3ODQV • /DQGVFDSH3ODQDVUHTXLUHGIRUWKLVSURMHFW • 8QGHUJURXQG8WLOLW\/D\RXWVDVUHTXLUHGIRUWKLVSURMHFW • 3KDVLQJSODQVLIUHTXLUHGIRUWKLVSURMHFW • )ORRUSODQV • :DOODQGIORRUILUHUHVLVWDQFHUDWLQJVVKRZQRQDOOEDFNJURXQGV'HVLJQ%XLOGHU¶V $UFKLWHFWXUDOPHFKDQLFDOHOHFWULFDO • 5RRISODQV • 'HWDLOHGSODQVIRUHDFKVSHFLDOW\DUHD • %XLOGLQJHOHYDWLRQV • %XLOGLQJVHFWLRQV • 8QLTXH'HVLJQ%XLOGHU¶V$UFKLWHFWXUDOIHDWXUHV • 7\SLFDOVHFWLRQVDQGHOHYDWLRQV • 'LVWULEXWLRQRIEXLOGLQJXWLOLWLHV • 6HFXULW\SODQVGRRUNH\LQJORJLF • 0HFKDQLFDOIORRUSODQVDQGGHWDLOV • 'HWDLOVRIPHFKDQLFDOHTXLSPHQWVSDFHV • +9$&URXWLQJDQGFRQWUROVFKHPHV • /LVWRIUHTXLUHGPHFKDQLFDOHTXLSPHQW • (OHFWULFDOVLQJOHOLQHGLDJUDPV • (OHFWULFDOIORRUSODQV • 7\SLFDOHOHFWULFDOGHWDLOV • 'HWDLOVRIHOHFWULFDOHTXLSPHQWVSDFHV • (OHFWULFDOSHUIRUPDQFHGDWD • /LVWRIUHTXLUHGHOHFWULFDOHTXLSPHQW • 3URFHVVXWLOLW\UXQV • 6DQLWDU\DQGZDVWHUXQV • 5LVHU'LDJUDPVIRUDOOVHUYLFHV • 3URYLGHGHVLJQFDOFXODWLRQVIRUPHFKDQLFDOV\VWHPV • 3URYLGHFXWVKHHWVRIPDMRU0(3HTXLSPHQW • .LQGVRIPDWHULDOV • $OORWKHULWHPVRUFRQFHSWVWREHLQFOXGHGLQWKHEXLOGLQJWKDWUHTXLUHGHWDLOLQJ H[SODQDWLRQRUZLOOUHVXOWLQFRQVWUXFWLRQGUDZLQJVRUFRQVWUXFWLRQVSHFLILFDWLRQV • 'DWD&RPPXQLFDWLRQ3ODQVDQGHTXLSPHQWOD\RXWV 'HVLJQGHYHORSPHQWVWXGLHVVKDOOPHDQGUDZLQJVVNHWFKHVDQDO\VLVJUDSKLFVDQGRWKHU GRFXPHQWVWKDWUHILQHWKH'HVLJQ'HYHORSPHQW'RFXPHQWVWRDOHYHOZKHUH&RQVWUXFWLRQ 'RFXPHQW'UDZLQJVFDQEHEHJXQ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOOLQYHVWLJDWHDQGHYDOXDWHFULWLFDO LVVXHVWKDWUHTXLUHDGGLWLRQDOVWXG\LQFOXGLQJEXWQRWOLPLWHGWR • 0HFKDQLFDOEORFNORDGFDOFXODWLRQV • (OHFWULFDOEORFNORDGFDOFXODWLRQV • &RGHUHTXLUHPHQWVIURPORFDODJHQFLHV • $Q\PDMRULWHPDIIHFWLQJFDSLWDOFRVWV • $Q\PDMRULWHPDIIHFWLQJRSHUDWLQJFRVWV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHYLHZWKHILQGLQJVRIWKHVHVWXGLHVZLWKWKH&LW\RI 'HQWRQDWUHJXODUO\VFKHGXOHGPHHWLQJV7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWV VKDOODOVRSUHVHQWUHFRPPHQGDWLRQVIRUUHVROYLQJSUREOHPVDQGFKRRVLQJDPRQJDOWHUQDWLYH FRXUVHVRIDFWLRQ $IWHUUHYLHZLQJZLWKWKH&LW\RI'HQWRQWKHLQIRUPDWLRQDQGDQDO\VLVRILQIRUPDWLRQJDWKHUHG LQ 6HFWLRQVWKH'HVLJQ%XLOGHU¶V $UFKLWHFWVKDOOSURGXFHWKH'HVLJQ'HYHORSPHQW 5HSRUW7KLVUHSRUWVKDOOLQFOXGHDZULWWHQQXPHULFDODQGJUDSKLFDOSUHVHQWDWLRQRIGHWDLOVRI WKHVROXWLRQVSUHVHQWHGDWWKHHQGRIWKH'HVLJQ3KDVH7KLVUHSRUWVKDOODOVRLQFOXGHD 7DEXODWLRQRI$UHDVDVGHILQHGE\WKH2ZQHUVKRZLQJWKHQHWDVVLJQDEOHVTXDUHIRRWDUHDV LQWKHEXLOGLQJVWUXFWXUHVRIWKH3URMHFWDVLOOXVWUDWHGE\WKH'HVLJQ'HYHORSPHQW'UDZLQJV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOOSUHSDUHIRU&LW\RI'HQWRQUHYLHZ EDVHG XSRQ PDUNHGXS VSHFLILFDWLRQV 7KHVH VSHFLILFDWLRQV VKDOO LQFOXGH GHWDLOHG GHVFULSWLRQVDQGH[DFWSHUIRUPDQFHUHTXLUHPHQWVRIWKHVXEMHFWDUHDVFRYHUHGLQ6HFWLRQ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOOSUHSDUHSUHVHQWDQGGHOLYHUWRWKH &LW\RI'HQWRQUHSRUWVLQFOXGLQJEXWQRWOLPLWHGWR • 6WUXFWXUDOFDOFXODWLRQV • %XLOGLQJDLUEDODQFHKHDWORDG • &KRLFHVRIEXLOGLQJSULPDU\HTXLSPHQW • &RGHFRPSOLDQFHFDOFXODWLRQV • 3UHVVXUL]DWLRQFRQWUROVFKHPH*UDSKLFDO 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHYLHZWKHILQGLQJVRIWKHVHVWXGLHVZLWKWKH&LW\RI 'HQWRQ DW VFKHGXOHG PHHWLQJV 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW DQG LWV FRQVXOWDQWV VKDOO SUHVHQWUHFRPPHQGDWLRQVIRUUHVROYLQJSUREOHPVDQGFKRRVLQJDPRQJDOWHUQDWLYHFRXUVHV RIDFWLRQ 7KH'HVLJQ%XLOGHUWKH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOO FROODERUDWHWRSUHSDUHDOLVWRIORQJOHDGWLPHPDWHULDOVLQFOXGLQJEXWQRWOLPLWHGWR • 6WUXFWXUDOVWHHO • 3ULPDU\PHFKDQLFDOHTXLSPHQW • (OHFWULFWUDQVIRUPHUVDQGVZLWFKJHDU • 6SHFLDOW\LWHPVUHTXLUHGE\WKHGHVLJQ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOVHOHFWILQLVKHGPDWHULDOVDQGFRORUVWREHLQFRUSRUDWHGLQ WKH:RUNDQGVKDOOSUHSDUHVFKHGXOHVRIVXFKPDWHULDOVDQGFRORUVIRUWKH2ZQHU¶VDSSURYDO 7KH'HVLJQ%XLOGHU¶VHVWLPDWLQJWHDPVKDOOSUHSDUHDQGVXEPLWWRWKH&LW\RI'HQWRQD'HVLJQ 'HYHORSPHQW&RVW(VWLPDWHEDVHGRQDQLWHPE\LWHPWDNHRIIXQLWFRVWVFXUUHQWDWWKHWLPH RIVXFKHVWLPDWH7KLV'HVLJQ'HYHORSPHQW&RVW(VWLPDWHVKDOOLQFOXGHWKHFRVWRIWKH HOHPHQWVVKRZQLQWKHSURMHFW&RVW0RGHODIDFWRUIRUFRVWULVHWRWKHHVWLPDWHGELGGLQJGDWH DQGDGHVLJQFRQWLQJHQF\IDFWRURIWHQSHUFHQW$GGLWLRQDOO\WKH'HVLJQ%XLOGHU¶V $UFKLWHFWVKDOOZRUNZLWKFRVWHVWLPDWLQJWHDPWRUHVROYHDQ\GLIIHUHQFHEHWZHHQWKH'HVLJQ %XLOGHU¶VHVWLPDWLQJWHDPDQGWKDWRI&LW\RI'HQWRQDVVLJQHGHVWLPDWRU¶VHVWLPDWHWRZLWKLQ WKUHHSHUFHQWEHWZHHQWKHP 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODWWHQGSURJUHVVPHHWLQJVDQGSUHSDUHPHHWLQJ PLQXWHV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI 'HOLYHUDEOHV &RSLHVRIDERXQG'HVLJQ'HYHORSPHQW5HSRUW 6HWVRIUHSURGXFLEOHVRIWKH'HVLJQ'HYHORSPHQW'UDZLQJVIRUWKH&LW\RI'HQWRQUHYLHZDQG DSSURYDO7KLVVKDOOLQFOXGHVKHHWVIRUDOOLWHPVLQFOXGHGLQ6HFWLRQ(YHU\V\VWHPRI VXEV\VWHPWREHSODFHGLQWKHEXLOGLQJVKDOOEHGHWDLOHGLQDGUDZLQJ &RSLHVRIWKHHQJLQHHULQJFDOFXODWLRQVUHTXLUHGWRVXSSRUWDQ\DQGHYHU\GHFLVLRQLQFOXGLQJ DOOWKHLWHPVLQ6HFWLRQ7KHVHFDOFXODWLRQVVKDOOEHERXQGWRJHWKHUE\WKH'HVLJQ %XLOGHU¶V$UFKLWHFWIRUSUHVHQWDWLRQWRWKH&LW\RI'HQWRQ &RSLHVRIDOLVWRIORQJOHDGWLPHPDWHULDOVDVGHILQHGLQ $OOGRFXPHQWVVKDOOEHGHOLYHUHGWRWKH&LW\RI'HQWRQLQSULQWHGDQGHOHFWURQLFIRUPDWDV SUHYLRXVO\GHVFULEHG 6HWVDQGHOHFWURQLFVFRS\RIWKH'HVLJQ%XLOGHU¶VHVWLPDWLQJWHDP¶V'HVLJQ'HYHORSPHQW &RVW(VWLPDWH $OOPRGHOVRURWKHUGRFXPHQWVJHQHUDWHGDVDUHVXOWRI'HVLJQ'HYHORSPHQW &$'GRFXPHQWVDUHWREHSURYLGHGWRWKH&LW\RI'HQWRQLQ$XWR&$'IRUPDWRQ&' 0LVFHOODQHRXV 7KH'HVLJQ'HYHORSPHQW'UDZLQJVKDOOEHDWWKHVDPHVFDOHDVWKHVFDOHWREHXVHGLQWKH &RQVWUXFWLRQ'RFXPHQWV'UDZLQJV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHSRUWWRWKH&LW\RI'HQWRQLQZULWLQJWKDWWKH'HVLJQ 'HYHORSPHQW'UDZLQJVDQG6SHFLILFDWLRQVFRQIRUPWRDOODSSOLFDEOHODZVUHJXODWLRQVDQG EXLOGLQJFRGHVDQG&LW\RI'HQWRQ6WDQGDUGV 7KH'HVLJQ%XLOGHU¶VHVWLPDWLQJWHDP$UFKLWHFWDQGDOOLWVFRQVXOWDQWVVKDOOVLJQWKH'HVLJQ 'HYHORSPHQW&RVW(VWLPDWH5HSRUWWRLQGLFDWHDJUHHPHQWZLWKWKHGDWDSUHVHQWHGWKHUHLQ 7KLV3KDVHZLOOEHUHYLHZHGWKURXJKDVHULHVRISURJUHVVUHYLHZVERWKRQVLWHDQGDWWKH 'HVLJQ%XLOGHU¶VRUWKH'HVLJQ%XLOGHU¶V$UFKLWHFW¶VRIILFHDVPXWXDOO\DJUHHGZLWKWKH&LW\ RI'HQWRQ &RQVWUXFWLRQ'RFXPHQW3KDVH $ ($FWLYLWLHV %DVHGRQWKH'HVLJQ'HYHORSPHQW'RFXPHQWVDQGDQ\IXUWKHUDGMXVWPHQWVLQWKHVFRSHRU TXDOLW\RIWKH3URMHFWRULQWKH3URMHFWEXGJHWDXWKRUL]HGE\WKH&LW\RI'HQWRQWKH'HVLJQ %XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVXSRQUHTXHVWRIWKH&LW\VKDOOSUHSDUHIRUDSSURYDO E\ &LW\ &RQVWUXFWLRQ 'RFXPHQW 'UDZLQJV DQG 6SHFLILFDWLRQV VHWWLQJ IRUWK LQ GHWDLO WKH UHTXLUHPHQWVIRUWKHFRQVWUXFWLRQRIWKH3URMHFWLQFOXGLQJEXWQRWOLPLWHGWRWKHIROORZLQJ 1RWDOOLWHPVEHORZPD\DSSO\WRWKLVSURMHFW *HQHUDO &RYHUVKHHW DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI ,QGH[ 6KHHWRIV\PEROVDEEUHYLDWLRQVHWF &LYLO 6LWHSODQLQFOXGLQJSDYHGDQGVLWHFRQFUHWH 8WLOLW\3ODQ *UDGLQJ3ODQ 3DYLQJZDWHUVHZHUDQGFRQFUHWHDQGVLWHDPHQLWLHVGHWDLOV /DQGVFDSH3ODQ 'HVLJQ%XLOGHU¶V$UFKLWHFWXUDO .H\SODQV %XLOGLQJSODQVIORRUDQGURRI 5RRIGHWDLOVLIDSSOLFDEOH :LQGRZVFKHGXOHVDQGGHWDLOV (QWU\GRRUVVFKHGXOHVDQGGHWDLOV +DUGZDUHNH\LQJORJLFDQGVFKHGXOH /RXYHUVFKHGXOHDQGGHWDLOV 'HWDLOIORRUSODQVDQGHOHYDWLRQIRUHDFKVSHFLDOL]HGDUHD %XLOGLQJH[WHULRUHOHYDWLRQV (QODUJHGSDUWLDOHOHYDWLRQV :DOOVHFWLRQV :DOOV\VWHPGHWDLOV ,QWHULRUHOHYDWLRQV /RQJLWXGLQDODQGWUDQVYHUVHVHFWLRQV 5HIOHFWHGFHLOLQJSODQV 6WDLUSODQV 6KDIWSODQV 8QLTXH'HVLJQ%XLOGHU¶V$UFKLWHFWXUDOIHDWXUHV 6HFWLRQVDQGHOHYDWLRQ 7\SLFDORIILFHSODQVHFWLRQDQGHOHYDWLRQ 5RRPPDWHULDOVFKHGXOHDQGGHWDLOV 3DUWLWLRQGHWDLOV 'RRUVFKHGXOHDQGGHWDLOV ,QWHULRUJOD]LQJVFKHGXOHDQGGHWDLOV &XVWRPFDVHZRUNGHWDLOV 0LVFHOODQHRXVGHWDLOV 0HFKDQLFDO (TXLSPHQWVFKHGXOH (TXLSPHQWURRPSODQVDQGGHWDLOV´VFDOH (TXLSPHQWURRPVHFWLRQV (TXLSPHQWURRPHOHYDWLRQV 'XFWUXQSODQVVHFWLRQVDQGHOHYDWLRQV´VFDOH 6KRZDOOHTXLSPHQWSLSHVGXFWVHWFLQGRXEOHOLQH 3UHVVXUL]DWLRQFRQWUROVFKHPHGHWDLOV (QHUJ\FRQWUROVFKHPHGHWDLOV 0LVFHOODQHRXVGHWDLOV (OHFWULFDO 0DVWHUXWLOLW\SODQ (TXLSPHQWVFKHGXOH (TXLSPHQWURRPSODQV (TXLSPHQWURRPHOHYDWLRQV 0DLQVHUYLFHGHWDLOV %XLOGLQJVHOHFWULFDOVFKHPDWLF 3DQHOVFKHGXOHV /LJKWLQJVFKHPDWLFV /LJKWLQJSODQVDQGGHWDLOV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI )LUHDODUPGHYLFHSODQVDOOGHYLFHVWREHVKRZQRQRQHVHTXHQFHRIVKHHWVHLWKHU ZDOORUFHLOLQJ 7HOHFRPPXQLFDWLRQVSODQVDQGGHWDLOV 'DWDFRPPXQLFDWLRQVSODQVDQGGHWDLOV 6HFXULW\SODQVDQGGHWDLOV 3OXPELQJ 6FKHGXOHVKHHW 0DVWHUXWLOLW\SODQ 6FKHPDWLFSLSLQJGLDJUDPVLQFOXGLQJULVHUV 6FKHPDWLFFRQWUROGLDJUDPV 3RWDEOHZDWHUSODQDQGGHWDLOVLQFOXGLQJULVHUV 6DQLWDU\VHZHUSODQDQGGHWDLOVLQFOXGLQJULVHUV 6SHFLDOVHUYLFHVSODQDQGGHWDLOV )LUHVSULQNOHUSODQV $Q\DQGDOORWKHUGHWDLOVWREHFRQVWUXFWHGVKDOODOVREHVXSSRUWHGE\GUDZLQJV3ODQV W\SLFDOO\DW´VFDOHH[FHSWIRUPDVWHUXWLOLW\WLHLQV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOOSUHSDUHIRUWKH&LW\RI'HQWRQUHYLHZ WKHSURSRVHG3URMHFW0DQXDOZKLFKVKDOOLQFOXGHWKHFRPSOHWHILQDO6SHFLILFDWLRQVFRQWUDFW IRUJHQHUDOFRQVWUXFWLRQDQGJHQHUDOFRQGLWLRQV7KHVHVSHFLILFDWLRQVVKDOOLQFOXGHWKHILQDO GHWDLOHGGHVFULSWLRQVDQGH[DFWSHUIRUPDQFHUHTXLUHPHQWVRIWKHVXEMHFWDUHDVFRYHUHGLQ 6HFWLRQSUHVHQWHGLQWKHPDQQHUWREHLVVXHGLQELGGLQJ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSUHSDUHDQGVXEPLWWRWKH&LW\RI'HQWRQWKH'HVLJQ %XLOGHU¶V$UFKLWHFW¶VDQG&RQVWUXFWLRQ'RFXPHQWGUDZLQJDQGHVWLPDWLQJWHDP &RVW(VWLPDWHEDVHGRQDQLWHPE\LWHPWDNHRIIXQLWFRVWVFRUUHFWDWWKHWLPHRIVXFK HVWLPDWH7KLV'HVLJQ%XLOGHU¶V$UFKLWHFW¶VDQG&RQVWUXFWLRQ'RFXPHQW'UDZLQJ &RVW(VWLPDWHVKDOO LQFOXGHWKHFRVWRIWKH HOHPHQWVVKRZQLQWKH3URMHFW&RVW0RGHO $GGLWLRQDOO\ WKH 'HVLJQ%XLOGHU¶V HVWLPDWLQJ WHDP VKDOO ZRUN ZLWK WKH &LW\ RI 'HQWRQ¶V DVVLJQHGLQGHSHQGHQWFRVWHVWLPDWRUWRUHVROYHDQ\YDOLGDWLRQFRPPHQWVWRWKHVDWLVIDFWLRQ RIWKDWLQGHSHQGHQWFRVWHVWLPDWRU 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSUHSDUHDILQDO7DEXODWLRQRI$UHDVEDVHGXSRQWKH FRPSOHWHG&RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG6SHFLILFDWLRQVVKRZLQJWKHQHWDVVLJQDEOH VTXDUHIRRWDQGWKHJURVVVTXDUHIRRWDUHDVLQWKHEXLOGLQJVWUXFWXUHVRIWKH3URMHFW 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODVVLVWWKH&LW\RI'HQWRQDQGWKH'HVLJQ%XLOGHULQ VHFXULQJEXLOGLQJSHUPLWVIRUWKLV3URMHFW 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODWWHQGZHHNO\SURJUHVVPHHWLQJVZLWKWKH&LW\RI'HQWRQ DQGSUHSDUHPHHWLQJPLQXWHV 'HOLYHUDEOHV &RSLHVRI&RQVWUXFWLRQ'RFXPHQW'UDZLQJVIRUWKH&LW\RI'HQWRQUHYLHZ7KH&LW\RI 'HQWRQ&RQVWUXFWLRQ3URMHFW0DQDJHUVKDOOFRQILUPUHTXLUHGVKHHWVL]HVDQGGLVWULEXWLRQ &RSLHVRIWKH6SHFLILFDWLRQ7KHVHVKDOOEHDYDLODEOHDWWKH&RQVWUXFWLRQ'RFXPHQW 'UDZLQJUHYLHZ 6HWVRID&RQVWUXFWLRQ'RFXPHQW&RVW(VWLPDWH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI 6HWVRIILQDO&RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG6SHFLILFDWLRQVIRU&LW\RI'HQWRQUHYLHZ DQGVLJQRII7KLVVKDOOLQFOXGHVKHHWVIRUDOOLWHPVLQ6HFWLRQ 2QHVHWRI´[´VL]HFRUUHFWHGDQGDSSURYHGILQDO&RQVWUXFWLRQ'RFXPHQW'UDZLQJV GHOLYHUHGWR&LW\RI'HQWRQ $OOPRGHOVRUGRFXPHQWVJHQHUDWHGDVDUHVXOWRIFRQVWUXFWLRQGRFXPHQWJHQHUDWLRQ &RSLHVRIILQDOVWDPSHGDQGVLJQHGHQJLQHHULQJFDOFXODWLRQV7KHVHFDOFXODWLRQVVKDOOEH ERXQGWRJHWKHUE\WKH'HVLJQ%XLOGHU¶V$UFKLWHFWIRUSUHVHQWDWLRQWRWKH&LW\IRUWKH%XLOGLQJ 3HUPLW'HVLJQ%XLOGHU¶V$UFKLWHFWWRVXEPLWSODQVIRUSHUPLWSURFHVV 6HWRIILQDOFRQVWUXFWLRQGUDZLQJVIRUSUHVHQWDWLRQWRWKH&LW\IRUWKH%XLOGLQJ3HUPLW 7ZRVHWVRIILQDOFRORUDQGILQLVKERDUGV $OOGRFXPHQWVVKDOOEHGHOLYHUHGWR&LW\RI'HQWRQLQSULQWHGDQGHOHFWURQLFIRUPDW 0LVFHOODQHRXV (DFK &RQVWUXFWLRQ 'RFXPHQW 'UDZLQJ VXEPLWWHG IRU EXLOGLQJ SHUPLW VKDOO EH DSSURYHG VLJQHGDQGEHDUWKHVHDORIDUHJLVWHUHGTXDOLILHGHQJLQHHULQWKHSDUWLFXODUFDWHJRU\RIZRUN FRYHUHGE\WKHGUDZLQJ $OO &RQVWUXFWLRQ 'RFXPHQW 'UDZLQJV DQG RWKHU GHVLJQ ZRUN VKDOO EH DFFRPSOLVKHG LQ DFFRUGDQFHZLWKDOOJRYHUQLQJORFDOPXQLFLSDOVWDWHDQGIHGHUDOFRGHV (DFK&RQVWUXFWLRQ'RFXPHQW 'UDZLQJVKDOOFRQWDLQ FRPSOHWHGHWDLOV GHOLQHDWLQJYDULRXV FRQGLWLRQVRIZRUN (TXLSPHQWDQGPDWHULDOFDOORXWVRQHDFK&RQVWUXFWLRQ'RFXPHQW'UDZLQJVKDOOFRQWDLQ FRPSOHWHGHVFULSWLYHLQIRUPDWLRQZKLFKPD\EHUHTXLUHGIRUHQJLQHHULQJSURFXUHPHQWRU LQVWDOODWLRQSXUSRVHV&OHDULGHQWLILFDWLRQVKDOOEHPDGHRIVZLWFKHVYDOXHVDQGRWKHUVDIHW\ GHYLFHV HVVHQWLDO WR VDIHW\ RU SURSHU RSHUDWLRQ DQG PDLQWHQDQFH RI WKH SXUFKDVHU¶V HTXLSPHQW 7KH 'HVLJQ%XLOGHU¶V HVWLPDWLQJ WHDP $UFKLWHFW DQG LWVFRQVXOWDQWV VKDOO VLJQ WKH &RQVWUXFWLRQ'RFXPHQW&RVW(VWLPDWH5HSRUWWRLQGLFDWHDJUHHPHQWZLWKWKHGDWDSUHVHQWHG WKHUHLQ 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO QRW SURFHHG IXUWKHU XQGHU WKLV &RQWUDFW XQWLO DOO WKH &RQVWUXFWLRQ 'RFXPHQW 'UDZLQJV DQG 6SHFLILFDWLRQV LQFOXGLQJ WKH VLJQHGRII )LQDO &RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG)LQDO2XWOLQH6SHFLILFDWLRQ5HSRUWDUHDSSURYHGE\ &LW\RI'HQWRQ %LGGLQJ3KDVH $ ($FWLYLWLHV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSURYLGHWKH'HVLJQ%XLOGHUZLWKDVVLVWDQFHLQFOXGLQJ EXWQRWOLPLWHGWR • 3UHSDUDWLRQDQGGLVWULEXWLRQRIELGGLQJSDFNDJHV • (YDOXDWLRQRIFRQVWUXFWLRQELGV • $QVZHUFRPSLOHDQGGLVWULEXWHDQ\TXHVWLRQVUHFHLYHGGXULQJWKHELGGLQJSHULRG DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI • 3UHSDULQJDQGGLVWULEXWLQJ$GGHQGD • $WWHQG3UH%LG0HHWLQJDQGSUHSDUHPLQXWHV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODVVLVWWKH'HVLJQ%XLOGHUZLWKSUHSDULQJELGGLQJ LQIRUPDWLRQZKLFKVKDOOLQFOXGH • ,QYLWDWLRQWRELG • ,QVWUXFWLRQVWRELGGHUV • &RQGLWLRQVRIWKHFRQWUDFW • %LGGLQJLQIRUPDWLRQIRUDOWHUQDWHV • )RUPRIELGSURSRVDO  ,QVXUDQFHUHTXLUHPHQWV 'HOLYHUDEOHV $SSURYHG&RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG3URMHFW0DQXDOVUHTXLUHGIRUELGGLQJ &RQVWUXFWLRQ3KDVH $ ($FWLYLWLHV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHYLHZDQGDSSURYH • 6KRSGUDZLQJV • 0DWHULDOVDQGVDPSOHVVXEPLWWDOV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSURYLGH&LW\RI'HQWRQZLWKDVVLVWDQFHLQFOXGLQJEXW QRWOLPLWHGWR • 7HFKQLFDODGYLFHIRUSODFLQJEXLOGLQJIXQFWLRQHTXLSPHQWLQRSHUDWLRQ • &RUUHFWLRQRIFRQVWUXFWLRQGUDZLQJV • 3UHSDUDWLRQRIQHHGHGDGGLWLRQDOGUDZLQJV 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO SURPSWO\ SURYLGH IXOO FRPSOHWH DQG UHVSRQVLYH DVVLVWDQFH WR 'HVLJQ%XLOGHU UHTXHVWV IRU GUDZLQJ DQG VSHFLILFDWLRQ FODULILFDWLRQV 7KH 'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSURPSWO\SURYLGHIXOOFRPSOHWHDQGUHVSRQVLYHDVVLVWDQFH WR'HVLJQ%XLOGHU¶V³UHTXHVWIRULQIRUPDWLRQ´ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSURYLGHWKHQHFHVVDU\GUDZLQJVDQGVSHFLILFDWLRQ FKDQJHVWRPHHW2ZQHUDSSURYHG&KDQJH2UGHUV 1RWXVHG 1RWXVHG 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSUHSDUHZULWWHQ3XQFK/LVWVLQHYHU\GLVFLSOLQHWKDWVKDOO EHLVVXHGWRERWK'HVLJQ%XLOGHUDQG&LW\RI'HQWRQ 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO EH D UHSUHVHQWDWLYH RI &LW\ RI 'HQWRQ GXULQJ WKH &RQVWUXFWLRQ3KDVHDQGVKDOODGYLVHDQGFRQVXOWZLWKWKH&LW\RI'HQWRQDVQHFHVVDU\DQG XVHLWVEHVWHIIRUWWRDVVLVWLQWKHWLPHO\DQGFRVWHIIHFWLYHFRPSOHWLRQRIWKH:RUN 1RWXVHG DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODWDOOWLPHVKDYHDFFHVVWRWKH:RUNZKHUHYHULWLVLQ SUHSDUDWLRQRUSURJUHVV 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOFDXVHLWVHPSOR\HHVDQGFRQVXOWDQWVWREHSUHVHQWDW WKHVLWHDWDOOWLPHVQHFHVVDU\IRUWKHSHUIRUPDQFHRI'HVLJQ%XLOGHU¶VREOLJDWLRQVKHUHXQGHU 7KH'HVLJQ%XLOGHU¶V$UFKLWHFW¶VORFDODXWKRUL]HGUHSUHVHQWDWLYHVKDOOYLVLWWKHVLWHDWLQWHUYDOV QRWWREHH[KDXVWLYHRUFRQWLQXRXVEXWDSSURSULDWHWRWKHVWDJHRIFRQVWUXFWLRQEXWQRWOHVV IUHTXHQWO\WKDQWZLFHDZHHNWREHFRPHIDPLOLDUZLWKWKHSURJUHVVDQGTXDOLW\RIWKH:RUN DQGWRGHWHUPLQHLIWKH:RUNLVSURFHHGLQJLQDFFRUGDQFHZLWKWKH&RQVWUXFWLRQ'RFXPHQW 'UDZLQJVDQG6SHFLILFDWLRQV2QWKHEDVLVRIVXFKRQVLWHREVHUYDWLRQVWKH'HVLJQ%XLOGHU¶V $UFKLWHFWVKDOONHHSWKH&LW\RI'HQWRQLQIRUPHGRIWKHSURJUHVVRIWKH:RUNDQGVKDOO HQGHDYRUWRSURWHFWWKH&LW\RI'HQWRQDJDLQVWGHIHFWDQGGHILFLHQFLHVLQWKH:RUNRIWKH 'HVLJQ%XLOGHU7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOODWWHQGZHHNO\MREVLWHPHHWLQJVFDOOHG E\WKH'HVLJQ%XLOGHU 8QOHVVRWKHUZLVHGLUHFWHGE\WKH&LW\RI'HQWRQDWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOEH WKHLQWHUSUHWHURIWKHUHTXLUHPHQWVRIWKH&RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG6SHFLILFDWLRQ DQGWKHMXGJHRIWKHSHUIRUPDQFHRIWKH'HVLJQ%XLOGHUWKHUHXQGHUDQGEWKH'HVLJQ %XLOGHU¶V$UFKLWHFWVKDOOUHQGHULQWHUSUHWDWLRQVQHFHVVDU\IRUWKHSURSHUH[HFXWLRQRIWKH:RUN ZLWKUHDVRQDEOHSURPSWQHVVRQZULWWHQUHTXHVWRIHLWKHUWKH&LW\RI'HQWRQRUWKH'HVLJQ %XLOGHUDQGVKDOOUHQGHUZULWWHQGHFLVLRQVZLWKLQDUHDVRQDEOHWLPHRQDOOPDWHULQTXHVWLRQ UHODWLQJWRWKHH[HFXWLRQRUSURJUHVVRIWKH:RUNRUWKHLQWHUSUHWDWLRQRIWKH&RQWUDFWLRQ 'RFXPHQW'UDZLQJVDQG6SHFLILFDWLRQV 7KH 'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO UHYLHZ 'HVLJQ%XLOGHU¶V VXEPLWWDOV VXFK DV VKRS GUDZLQJVSURGXFWGDWDDQGVDPSOHVEXWRQO\IRUFRQIRUPLW\WRWKHGHVLJQFRQFHSWRIWKH :RUNDQGZLWKWKHLQIRUPDWLRQJLYHQLQ&RQVWUXFWLRQ'RFXPHQW'UDZLQJVDQG6SHFLILFDWLRQV 6XFKDFWLRQVKDOOEHWDNHQZLWKUHDVRQDEOHSURPSWQHVVVRDVWRFDXVHQRGHOD\7KH'HVLJQ %XLOGHU¶V$UFKLWHFW¶VDSSURYDORIDVSHFLILFWLPHVKDOOQRWFRQVWLWXWHDQDVVHPEO\RIZKLFKWKH LWHPLVDFRPSRQHQW 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOUHYLHZSURSRVDOVDQGSD\RXWUHTXHVWIURPWKH'HVLJQ %XLOGHUDQGUHFRPPHQGSUHSDUDWLRQRI&KDQJH2UGHUVIRU&LW\RI'HQWRQ¶VDSSURYDODQG H[HFXWLRQLQDFFRUGDQFHZLWKWKH&RQWUDFWIRU&RQVWUXFWLRQ 7KH'HVLJQ%XLOGHU¶V$UFKLWHFWDQGLWVFRQVXOWDQWVVKDOODVVLVWWKH'HVLJQ%XLOGHULQSURYLGLQJ LQLWLDOVWDUWXSWHVWLQJDGMXVWPHQWDQGEDODQFLQJRIEXLOGLQJV\VWHP 'HOLYHUDEOHV 'UDZLQJVDQGVSHFLILFDWLRQVDVUHTXLUHGLQ6HFWLRQ 3XQFKOLVWVDVUHTXLUHGLQ6HFWLRQ 0LVFHOODQHRXV 7KH&RQVWUXFWLRQ3KDVHZLOOEHJLQZLWKWKHDFFHSWDQFHRID'HVLJQ%XLOGHUELGE\WKH&LW\RI 'HQWRQDQGZLOOWHUPLQDWHDWWKH'DWHRI)LQDO&RPSOHWLRQ $OO&KDQJH2UGHUVVKDOOEHH[HFXWHGDVVSHFLILHGLQWKH$JUHHPHQWEHWZHHQ2ZQHUDQG 'HVLJQ%XLOGHU¶V$UFKLWHFWDQGWKH&RQWUDFWIRU&RQVWUXFWLRQ 3RVW&RQVWUXFWLRQ3KDVH $ ($FWLYLWLHV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ'HYHORSPHQW6HUYLFH%XLOGLQJ3URMHFW1XPEHU 5HY1(OP6WUHHW 'HQWRQ7H[DV 'HVLJQ%XLOGHU¶V$UFKLWHFW(QJLQHHU6HUYLFHVDQG'HOLYHUDEOHV 3DJHRI 'XULQJDOOSHULRGVRIJXDUDQWHHRIWKH:RUNSURYLGHGIRULQWKH&RQWUDFWRI&RQVWUXFWLRQ \HDUWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOSURYLGHWHFKQLFDODVVLVWDQFHLQVHFXULQJFRUUHFWLRQ RIDQ\DQGDOOGHIHFWVDQGGHILFLHQFLHVFRYHUHGE\JXDUDQWHHV 8SRQILQDODFFHSWDQFHE\WKH&LW\RI'HQWRQRIFRQVWUXFWLRQRIWKH:RUNWKH'HVLJQ%XLOGHU¶V $UFKLWHFW VKDOO FROOHFW IURP WKH 'HVLJQ%XLOGHU WKH PDUNHGXS &RQVWUXFWLRQ 'RFXPHQW 'UDZLQJVDQG6SHFLILFDWLRQVFRRUGLQDWLRQGUDZLQJVDQG&KDQJH2UGHU'UDZLQJV7KHVH VKDOOEHLQFRUSRUDWHGLQWRWKHILQDO&RQVWUXFWLRQ'RFXPHQWHOHFWURQLFILOHVWRSURGXFHDVHWRI 5HFRUG 'UDZLQJV 7KHVH 5HFRUG 'UDZLQJV VKDOO VKRZ WKH DVEXLOWILQDO ORFDWLRQV RI DOO PHFKDQLFDOHTXLSPHQWXWLOLW\OLQHVGXFWVDQGRXWOHWVDVZHOODVDQ\RWKHUFKDQJHVPDGHLQ WKH ILHOG WKDW DIIHFW WKH RSHUDWLRQ PDLQWHQDQFH RU DELOLW\ WR UHFRQILJXUH UHPRGHO RU DGYDQWDJHRXVO\XVHWKH:RUN 3ULRUWRVXEVWDQWLDOFRPSOHWLRQWKH'HVLJQ%XLOGHU¶V$UFKLWHFWVKDOOFROOHFWIURPWKH'HVLJQ %XLOGHU2SHUDWLRQV(QJLQHHUV0DQXDOV 'HOLYHUDEOHV 5HFRUG'UDZLQJV 6HWRI&$'ILOHVLQFOXGLQJOD\HULQJLQ$XWR&$'IRUPDWRQFRPSDFWGLVFRU86%GULYH 3URYLGHVFKHPDWLFIORRUSODQV´[´VKRZLQJURRPVFRUULGRUVHTXLSPHQWURRPV3ODQV VKDOOLQGLFDWHORFDWLRQVRIDOOSDQHOVPDMRUHTXLSPHQWYDOYHVDQGXWLOLW\FRQQHFWLRQV DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW(±&RQWURO(VWLPDWH 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW)±6FKHGXOLQJ5HTXLUHPHQWV 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $FWLYLW\2'6WDUW)LQLVKCity of Denton - DevelopmentCity of Denton - Development SerCity of Denton - Development Services BuCity of Denton - Development Services Building'RFXPHQW'HVLJQ'RFXPHQW'HVLJQ'RFXPHQW'HVLJQ'RFXPHQW'HVLJQ1733UHFRQVWUXFWLRQ)HE 6FKHPDWLF'HVLJQ)HE0DU'RFXPHQW'HVLJQ0DU0DU3UHSDUH&' V0DU$SU6XEPLWWDO5HYLHZ$SU$SU3USHDUH&' V$SU$SU&' V,VVXHG$SU3UHFRQVWUXFWLRQ3UHFRQVWUXFWLRQ3UHFRQVWUXFWLRQ3UHFRQVWUXFWLRQ%\UQH5HYLHZRI&' V %LG3DFNDJHV$SU$SU&''RF V %LG3DFNDJHV2XWWR%LG$SU0D\3XEOLF$GYHUWLVHPHQW$SU3XEOLF$GYHUWLVHPHQW0D\3UH%LG6XEFRQWUDFWRU0HHWLQJ0D\0D\)LQDO5), VIURP6XEFRQWUDFWRUV0D\)LQDO$GGHQGXP0D\%LG'D\0D\0D\%\UQH%LG5HYLHZDQG(YDOXDWLRQ0D\0D\7HDP%XGJHW3UHSDUDWLRQ 5HYLHZ0D\0D\,VVXH*03IRU$SSURYDO0D\*03$SSURYDOE\2ZQHU6WDII-XQ&RXQFLO$SSURYDO-XQ-XQ1RWLFHWR3URFHHG-XQ3HUPLWWLQJ3HUPLWWLQJ3HUPLWWLQJ3HUPLWWLQJ6XEPLW&''RF VIRU3HUPLWWLQJ$SU&LW\3HUPLW5HYLHZ$SU0D\3HUPLW&RPPHQWV5HFHLYHGIURP&LW\0D\'HVLJQ7HDP3UHSDUH5HVSRQVHWR&RPPHQWV0D\0D\&LW\5HYLHZRI'HVLJQ7HDP5HVSRQVHV0D\-XQ%XLOGLQJ3HUPLW,VVXHG-XQ3URFXUHPHQW3URFXUHPHQW3URFXUHPHQW3URFXUHPHQW,VVXH6XEFRQWUDFWV-XQ-XO0(33UHSDUH6XEPLWWDOV6KRS'UDZLQJV-XQ-XQ6WUXFWXUDO6WHHO3UHSDUH6XEPLWWDOV6KRS'UDZLQJ-XQ-XQ0(36XEPLWWDO5HYLHZ&0 'HVLJQ7HDP-XQ-XO6WUXFWXUDO6WHHO6XEPLWWDO5HYLHZ&0 'HVLJQ7H-XQ-XO0(3)DEULFDWH 'HOLYHU-XO$XJ6WUXFWXUDO6WHHO)DEULFDWH 'HOLYHU-XO$XJ&RQVWUXFWLRQ&RQVWUXFWLRQ&RQVWUXFWLRQ&RQVWUXFWLRQ0RELOL]DWLRQ0RELOL]DWLRQ0RELOL]DWLRQ0RELOL]DWLRQ2IILFH7UDLOHU'HOLYHU &RQQHFW8WLOLWLHV-XQ-XQ/RFDWH([LVWLQJ8WLOLWLHV-XQ-XQ6HOHFWLYH%XLOGLQJ'HPROLWLRQ-XQ-XO6LWHZRUN6LWHZRUN6LWHZRUN6LWHZRUN6LGHZDONV_+DUGVFDSH6HS2FW5HPRYH([LVWLQJ6WULSLQJ 6LJQDJH2FW2FW,QVWDOO6WULSLQJ2FW2FW,QVWDOO6LJQDJH2FW2FW6WUXFWXUH6WUXFWXUH6WUXFWXUH6WUXFWXUH)HE0DU$SU0D\-XQ-XO$XJ6HS2FW1RY'HF-DQ)HE0DU$SU1733UHFRQVWUXFWLRQ6FKHPDWLF'HVLJQ'RFXPHQW'HVLJQ3UHSDUH&' V6XEPLWWDO5HYLHZ3USHDUH&' V&' V,VVXHG%\UQH5HYLHZRI&' V %LG3DFNDJHV&''RF V %LG3DFNDJHV2XWWR%LG3XEOLF$GYHUWLVHPHQW3XEOLF$GYHUWLVHPHQW3UH%LG6XEFRQWUDFWRU0HHWLQJ)LQDO5), VIURP6XEFRQWUDFWRUV)LQDO$GGHQGXP%LG'D\%\UQH%LG5HYLHZDQG(YDOXDWLRQ7HDP%XGJHW3UHSDUDWLRQ 5HYLHZ,VVXH*03IRU$SSURYDO*03$SSURYDOE\2ZQHU6WDII&RXQFLO$SSURYDO1RWLFHWR3URFHHG6XEPLW&''RF VIRU3HUPLWWLQJ&LW\3HUPLW5HYLHZ3HUPLW&RPPHQWV5HFHLYHGIURP&LW\'HVLJQ7HDP3UHSDUH5HVSRQVHWR&RPPHQWV&LW\5HYLHZRI'HVLJQ7HDP5HVSRQVHV%XLOGLQJ3HUPLW,VVXHG,VVXH6XEFRQWUDFWV0(33UHSDUH6XEPLWWDOV6KRS'UDZLQJV6WUXFWXUDO6WHHO3UHSDUH6XEPLWWDOV6KRS'UDZLQJV0(36XEPLWWDO5HYLHZ&0 'HVLJQ7HDP6WUXFWXUDO6WHHO6XEPLWWDO5HYLHZ&0 'HVLJQ7HDP0(3)DEULFDWH 'HOLYHU6WUXFWXUDO6WHHO)DEULFDWH 'HOLYHU2IILFH7UDLOHU'HOLYHU &RQQHFW8WLOLWLHV/RFDWH([LVWLQJ8WLOLWLHV6HOHFWLYH%XLOGLQJ'HPROLWLRQ6LGHZDONV_+DUGVFDSH5HPRYH([LVWLQJ6WULSLQJ 6LJQDJH,QVWDOO6WULSLQJ,QVWDOO6LJQDJH&LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ'HVLJQ%XLOG3URMHFW6FKHGXOH3URMHFW6WDUW'DWH)HE3URMHFW)LQLVK'DWH'HF3DJHRIDesign-Builderacknowledges CityCouncil consideration &possible approval of thisAgreement will not beuntil 25 FEB, and haveagreed to work at riskuntil then.)HE City of Denton's Development Services BuildingAIA A141 Owner-Consultant AgreementExhibit F.2 - Design-Builder's Project ScheduleDocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E $FWLYLW\2'6WDUW)LQLVK,QVWDOO,QILOO#/RDGLQJ'RFN-XO-XO,QVWDOO6WUXFWXUH#(QWU\-XO$XJ([WHULRU)DFDGH([WHULRU)DFDGH([WHULRU)DFDGH([WHULRU)DFDGH,QVWDOO([WHULRU'HVLJQ(PSKDVLV#(QWU\$XJ6HS,QWHULRU)LQLVKHV,QWHULRU)LQLVKHV,QWHULRU)LQLVKHV,QWHULRU)LQLVKHV2YHUKHDG0(35RXJK,Q-XO$XJ:DOO/D\RXW-XO-XO)UDPH:DOOV_2QH6LGH:DOOV-XO$XJ,Q:DOO0(35RXJK,Q-XO$XJ&ORVH:DOOV$XJ6HS7DSH%HG 3ULPH3DLQW:DOOV$XJ6HS)UDPH&HLOLQJV$XJ6HS,QVWDOO&HLOLQJ*ULG$XJ6HS0LVFHOODQHRXV6SHFLDOWLHV6HS6HS&HUDPLF_3RUFHODLQ7LOHDW5HVWURRPV6HS6HS0(35RXJK,QDW'U\ZDOO&HLOLQJV6HS6HS0LOOZRUN6HS6HS0(3,QVSHFWLRQVDW'U\ZDOO&HLOLQJV6HS6HS7DSH%HG 3ULPH3DLQW&HLOLQJV6HS6HS7RLOHW3DUWLWLRQV6HS6HS7RLOHW$FFHVVRULHV6HS6HS&ORVH&HLOLQJV6HS6HS0(3:DOO7ULP2XW6HS6HS,QWHULRU$OXPLQXP_*ODVV6\VWHPV6HS2FW0(3&HLOLQJ7ULP2XW_/LJKWLQJDW*ULG6HS2FW&DUSHW_5HVLOLHQW_7LOH)ORRULQJ6HS2FW2YHUKHDG0(3,QVSHFWLRQV2FW2FW'RRUV +DUGZDUH2FW2FW,QVWDOO&HLOLQJ7LOH2FW2FW)LQDO3DLQW2FW2FW)LQDO,QVSHFWLRQV)LQDO,QVSHFWLRQV)LQDO,QVSHFWLRQV)LQDO,QVSHFWLRQV3OXPELQJ)LQDO,QVSHFWLRQ2FW2FW(OHFWULFDO)LQDO,QVSHFWLRQ2FW2FW0HFKDQLFDO)LQDO,QVSHFWLRQ2FW2FW)LUH$ODUP_6SULQNOHU,QVSHFWLRQ2FW2FW%XLOGLQJ)LQDO,QVSHFWLRQ2FW1RY,QVSHFWLRQV &ORVH2XW,QVSHFWLRQV &ORVH2XW,QVSHFWLRQV &ORVH2XW,QVSHFWLRQV &ORVH2XW)LQDO&OHDQ2FW1RY%\UQH3XQFKOLVW2FW1RY&RQWUDFWRU V3URMHFW)ORDW1RY1RY2 02ZQHU7UDLQLQJ 2ZQHU)) (_,71RY1RY3URMHFW6XEVWDQWLDO&RPSOHWLRQ1RY3XQFKOLVW &ORVH2XW1RY'HF2ZQHU6WDII0RYH,Q1RY'HF)LQDO$FFHSWDQFH'HF6WDII)XOO\)XQFWLRQDOLQ%XLOGLQJ'HF)HE0DU$SU0D\-XQ-XO$XJ6HS2FW1RY'HF-DQ)HE0DU$SU,QVWDOO,QILOO#/RDGLQJ'RFN,QVWDOO6WUXFWXUH#(QWU\,QVWDOO([WHULRU'HVLJQ(PSKDVLV#(QWU\2YHUKHDG0(35RXJK,Q:DOO/D\RXW)UDPH:DOOV_2QH6LGH:DOOV,Q:DOO0(35RXJK,Q&ORVH:DOOV7DSH%HG 3ULPH3DLQW:DOOV)UDPH&HLOLQJV,QVWDOO&HLOLQJ*ULG0LVFHOODQHRXV6SHFLDOWLHV&HUDPLF_3RUFHODLQ7LOHDW5HVWURRPV0(35RXJK,QDW'U\ZDOO&HLOLQJV0LOOZRUN0(3,QVSHFWLRQVDW'U\ZDOO&HLOLQJV7DSH%HG 3ULPH3DLQW&HLOLQJV7RLOHW3DUWLWLRQV7RLOHW$FFHVVRULHV&ORVH&HLOLQJV0(3:DOO7ULP2XW,QWHULRU$OXPLQXP_*ODVV6\VWHPV0(3&HLOLQJ7ULP2XW_/LJKWLQJDW*ULG&DUSHW_5HVLOLHQW_7LOH)ORRULQJ2YHUKHDG0(3,QVSHFWLRQV'RRUV +DUGZDUH,QVWDOO&HLOLQJ7LOH)LQDO3DLQW3OXPELQJ)LQDO,QVSHFWLRQ(OHFWULFDO)LQDO,QVSHFWLRQ0HFKDQLFDO)LQDO,QVSHFWLRQ)LUH$ODUP_6SULQNOHU,QVSHFWLRQ%XLOGLQJ)LQDO,QVSHFWLRQ)LQDO&OHDQ%\UQH3XQFKOLVW&RQWUDFWRU V3URMHFW)ORDW2 02ZQHU7UDLQLQJ 2ZQHU)) (_,73URMHFW6XEVWDQWLDO&RPSOHWLRQ3XQFKOLVW &ORVH2XW2ZQHU6WDII0RYH,Q)LQDO$FFHSWDQFH6WDII)XOO\)XQFWLRQDOLQ%XLOGLQJ&LW\RI'HQWRQ'HYHORSPHQW6HUYLFHV%XLOGLQJ'HVLJQ%XLOG3URMHFW6FKHGXOH3URMHFW6WDUW'DWH)HE3URMHFW)LQLVK'DWH'HF3DJHRIDocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E EXCELLENCE QUALITY SERVICE Management Team MembersAMEPConsultingEngineers, Inc.MEP/DataEngineerEric ChambersAIA, CDT, CPO, LEED GADesign TeamLeadBCICarlaKolberAssistant ProjectManagerJQ Infrastructure, LLCStructural EnginnerLee HowellLEED APChief EstimatorElizabeth HolserAssociate AIADesign ProjectManagerBCIPaulAustinSuperintendentJasonMooreConstructionManagerPreconstructionDesign TeamConstructionMartin LehmanPrincipal-in-ChargeByrne Executive ManagementMichael Carroll, AIAPrincipal-in-ChargeBCIRyanBalliettEstimator Design/Builder's Onsite Staff for ConstructionHours per WeekConstruction Manager Jason Moore 10Assistant Project Manager Carla Kolber 40Superintendent Paul Austin 40Safety Coordinator Juan Lopez 10Field Secretary TBD 10Design Project Manager Elizabeth Holser Available as NecessaryChief Estimator Lee Howell Available as NecessaryEstimator Ryan Balliett Available as NecessaryCity of Denton's Development Services BuildingAIA A141 Owner-Consultant AgreementExhibit G - Key Firms & PersonnelDocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ$,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO)HH ,QVXUDQFH3URSRVDO8SGDWHGRQ)(%3HUFHQWDJH /XPS6XP 3HUFHQWDJH /XPS6XP 3HUFHQWDJH /XPS6XP 3HUFHQWDJH /XPS6XP'HYHORSPHQW6HUYLFHV%OGJ5HQR$VVXPHG&RQWUDFW$PRXQW $ 'HVLJQ%XLOGHU V6XEFRQWUDFWRU0DUNXS3ROLF\,QVXUDQFHV$ 3HUIRUPDQFH 3D\PHQW%RQGV $ 0DLQWHQDQFH%RQG $ %XLOGHU V5LVN,QVXUDQFH $ *HQHUDO/LDELOLW\,QVXUDQFH $ 3URIHVVLRQDO/LDELOLW\,QVXUDQFH $ 3ROOXWLRQ/LDELOLW\,QVXUDQFH,QFOXGHG ,QFOXGHG ,QFOXGHG ,QFOXGHG ,QFOXGHG ,QFOXGHG ,QFOXGHG ,QFOXGHG$ ([FHVV?8PEUHOOD/LDELOLW\,QVXUDQFH $ 2WKHU,QVXUDQFH5HTXLUHPHQWV1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$$ % 'HVLJQ%XLOGHU V)HHV% 'HVLJQ%XLOGHU V'HVLJQ (QJLQHHULQJ)HHV5HLPEXUVDEOHV1$ Z*HQ&RQG % 2WKHU'HVLJQ%XLOGHU V3UHFRQVWUXFWLRQ6HUYLFHV1$ Z*HQ&RQG %1$ /XPS6XP /XPS6XP /XPS6XP % 'HVLJQ%XLOGHU V)HHV% 'HVLJQ%XLOGHU V+RPH2IILFH2YHUKHDG % 'HVLJQ%XLOGHU V+RPH2IILFH3URILW % 2WKHU'HVLJQ%XLOGHU)HHV5HTXLUHGIRUWKH3URMHFW 1$ 1$ 1$1$1$1$1$1$%$% RIWKHFRVWRIWKHZRUNSOXVWKHDVVRFLDWHGLQFUHDVHLQWKHLQVXUDQFHDQGERQGSUHPLXPV3HUFHQWDJHRI6XEFRQWUDFWRU&RVW3URSRVHGIRU'% V)HHRQ&KDQJH2UGHUV 'HVLJQ%XLOGHU V3UHFRQVWUXFWLRQ)HHV 5HLPEXUVDEOHV7RWDO'HVLJQ%XLOGHU V6XEFRQWUDFWRU0DUNXS3ROLF\)HHV'HVLJQ%XLOGHU V6XEFRQWUDFWRU0DUNXS3ROLF\7RWDO)(%5)3 )(%5)3 )(%5)32ULJLQDO-$16XEPLWWDO'HVLJQ%XLOGHU V'LUHFW&RVWRI:RUN,QVXUDQFHV,WHP 'HVFULSWLRQ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP3DJHRI$OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//&DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ$,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW([KLELW+'HVLJQ)HHV8SGDWHGRQ)(%3ULQWHGRQDW30'HVFULSWLRQ $UFKLWHFWXUDO 6WUXFWXUDO0HFKDQLFDO+9$& 3OXPELQJ(OHFWULFDO &LYLO/DQGVFDSH'HVLJQ,QWHULRU'HVLJQ)L[HG,QWHULRU'HVLJQ)) (.LWFKHQ'HVLJQ,77HOHGDWD7HOHFRPP $96HFXULW\&RVW(VWLPDWLQJ6XVWDLQDEOH'HVLJQ*HRWHFKQLFDO(QJLQHHULQJ)DFLOLWLHV&RQGLWLRQ$VVHVPHQWV2WKHU&RQVXOWDQWV7RWDO &RPPHQWV'HVLJQDQG(QJLQHHULQJ)HHV6FKHPDWLF'HVLJQ ,QFOXGHG 1$ 1$ ,QFOXGHG 1$ 1$ 1$ 1$ 1$ ,QFOXGHG 1$ ,QFOXGHG 1$ &RVW(VWLPDWLQJ&RYHUHG%\'%6HUYLFHV6XEWRWDO6FKHPDWLF'HVLJQ)HHV 'HVLJQ'HYHORSPHQW ,QFOXGHG 1$ 1$ ,QFOXGHG 1$ 1$ 1$ 1$ 1$ ,QFOXGHG 1$ ,QFOXGHG 1$ &RQVWUXFWLRQ'RFXPHQWV ,QFOXGHG 1$ 1$ ,QFOXGHG 1$ 1$ 1$ 1$ 1$ ,QFOXGHG 1$ 1$ 1$ %LGGLQJ 1HJRWLDWLRQ ,QFOXGHG 1$ 1$ ,QFOXGHG 1$ 1$ 1$ 1$ 1$ ,QFOXGHG 1$ 1$ 1$ &RQWUDFW$GPLQLVWUDWLRQ ,QFOXGHG 1$ 1$ ,QFOXGHG 1$1$ 1$ 1$ 1$ ,QFOXGHG 1$ 1$ 1$ 6XEWRWDO'HVLJQ)HHV 5HLPEXUVDEOH([SHQVHV5HSURGXFWLRQ 3ULQWLQJ&RVWV 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 6KLSSLQJ2YHUQLJKW6HUYLFHV 3RVWDJH 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$0LOHDJH$LUIDUH/RGJLQJ0HDOV 7UDYHO&RVWV 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 5HLPEXUVDEOH&RQWLQJHQF\ 1$ 1$ 1$ 1$ 1$ 1$ 1$ 1$1$ 1$ 1$ 1$ 1$ 6XEWRWDO5HLPEXUVDEOH([SHQVHV 7RWDORI)HHV5HLPEXUVDEOH $OWHUQDWHV WĂŐĞϮŽĨϵΞϮϬϭϵůůƌŝŐŚƚƐƌĞƐĞƌǀĞĚďǇZ/ŶƚĞŐƌĂƚĞĚWƌŽŐƌĂŵDĂŶĂŐĞŵĞŶƚ͕/ŶĐ͘DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ$,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO*HQ&RQGLWLRQV3URSRVDO8SGDWHGRQ)(% 'HYHORSPHQW6HUYLFHV%XLOGLQJ5HQR*HQHUDO&RQGLWLRQV&RVWV 0RELOL]DWLRQ 'HVLJQ%XLOGHU V2Q6LWH6WDII 8WLOLWLHV 2QJRLQJ([SHQVHV +RLVWLQJ 0DWHULDO0DQDJHPHQW %\6XEV 7HPSRUDU\3URWHFWLRQRIWKH:RUN %\6XEV 0DWHULDOV7HVWLQJ %\&LW\ 3HUPLWV 7DS3ODQ&KHFN)HHV %\&LW\Z)HHV,WHP 'HVFULSWLRQ $VVXPH02'HVLJQ%XLOGHU V*HQHUDO&RQGLWLRQV&RVWV2WKHU'HVLJQ%XLOGHU*HQHUDO&RQGWLRQV&RVWV1RWZ$ERYHD5DQJHRI3UREDEOH&RVWIRUWKH'HVLJQ%XLOGHU V2Q6LWH*HQHUDO&RQGLWLRQV&RVWVIRU0''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP3DJHRI$OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//&DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW 'HVLJQ%XLOGHU V3URSRVDORI&RVWVWR%H5HLPEXUVHG1RWWR([FHHG $ ,QVXUDQFH 3HUIRUPDQFH 3D\PHQW%RQGV /6 0DLQWHQDQFH%RQG /6 %XLOGHU V5LVN,QVXUDQFH /6 *HQHUDO/LDELOLW\,QVXUDQFH /6 3URIHVVLRQDO/LDELOLW\,QVXUDQFH /6 3ROOXWLRQ/LDELOLW\,QVXUDQFH /6 ,QFOXGHG ,QFOXGHG ([FHVV?8PEUHOOD/LDELOLW\,QVXUDQFH /6 2WKHU,QVXUDQFH5HTXLUHPHQWV 1$ /6 1$ 1$ $ % 'HVLJQ%XLOGHU V2QVLWH6WDII 3URMHFW0DQDJHU 02 1$ 1$ 3URMHFW6XSHULQWHQGHQW 02 3URMHFW&RRUGLQDWRU 02 1$ 1$ 0HFKDQLFDO(OHFWULFDO&RRUGLQDWRU 1$ 02 1$ 1$ :RUNLQJ)RUHPDQ6DIHW\&RRUGLQDWRUDW 02 $VVLVWDQW3URMHFW0DQDJHU 02 2IILFH(QJLQHHU 1$ 02 1$ 1$ )LHOG(QJLQHHU 1$ 02 1$ 1$ )LHOG(VWLPDWRU 1$ 02 1$ 1$ *HQHUDO/DERUHU 1$ 02 1$ 1$ 7LPHNHHSHU 1$ 02 1$ 1$ )LHOG2IILFH0DQDJHU 1$ 02 1$ 1$ :DUHKRXVH0DQDJHU 1$ 02 1$ 1$ 1RWH$OOERQGV LQVXUDQFHVKRXOGDVVXPHD'HVLJQ%XLOGWRWDOFRQWUDFWDPRXQWRI 'HVLJQ%XLOGHU V(VWLPDWHG&RVWRI,QVXUDQFH6XEWRWDO 3HUFHQWDJHRI&RVW3URSRVHGIRU'HVLJQ%XLOGHU V,QVXUDQFHVRQ&KDQJH2UGHUV ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW )LHOG6HFUHWDU\$FFRXQWDQWDW 02 2WKHU2QVLWH&RQWUDFWRU6WDII&0DW 02 % & 'HVLJQ%XLOGHU V2QVLWH5HLPEXUVDEOH([SHQVHV 0RELOL]DWLRQ )LHOG(QJLQHHULQJ(TXLSPHQW 02 ([FOXGHG ([FOXGHG 6LWH6XUYH\ /6 /D\RXW:LWKLQ6LWH /6 %\6XE %\6XE 2IILFH7UDLOHU 02 2IILFH6XSSOLHV (TXLSPHQW 02 6WRUDJH7UDLOHU 02 %\6XE %\6XE :DUHKRXVH 02 1$ 1$ 6HW8S2QVLWH2IILFH /6 6HW8S2QVLWH6WRUDJH?/D\GRZQ$UHDV /6 %\6XE %\6XE 6HW8S2QVLWH3DUNLQJ$UHDV /6 %\6XE %\6XE 7HPSRUDU\5RDGZD\V /6 %\6XE %\6XE 7HPSRUDU\)HQFLQJ /) 7HPSRUDU\7RLOHWV 02 3URMHFW6LJQ ($ 6DIHW\ 6DIHW\(TXLSPHQW /6 1$ &RVWRI:RUN )LUVW$LG6XSSOLHV (D 1$ &RVWRI:RUN )LUH3URWHFWLRQ /6 %\6XE %\6XE )LUH([WLQJXLVKHUV ($ 1$ &RVWRI:RUN )DOO3URWHFWLRQ /6 %\6XE %\6XE 7KLUG3DUW\6DIHW\,QVSHFWLRQV 02 1$ 1$ 7HPSRUDU\:DONZD\V /6 1$ 1$ 'HVLJQ%XLOGHU V(VWLPDWHG&RVWRI2QVLWH6WDII6XEWRWDO ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW %DUULFDGHV /6 %\6XE %\6XE 7UDIILF&RQWURO /6 %\6XE %\6XE 6HFXULW\?:DWFKPDQ6HUYLFHV 02 %\6XE %\6XE 8WLOLWLHV ,QVWDOO7HPSRUDU\(OHFWULF6HUYLFHDW6LWH2IILFH /6 %\6XE %\6XE ,QVWDOO7HPSRUDU\7HOHGDWD6HUYLFHDW6LWH2IILFH /6 %\6XE %\6XE ,QVWDOO7HPSRUDU\:DWHU 6HZHU6HUYLFHDW6LWH /6 %\6XE %\6XE ,QVWDOO7HPSRUDU\*DV6HUYLFHDW6LWH /6 %\2ZQHU %\2ZQHU 2QJRLQJ(OHFWULF&KDUJHVIRUWKH6LWH2IILFH 02 2QJRLQJ7HOHGDWD&KDUJHVIRUWKH6LWH2IILFH 02 2QJRLQJ:DWHU 6DQLWDU\'LVWULFW&KDUJHV 02 2QJRLQJ*DV8WLOLW\&KDUJHVH[OXGLQJ7HPS+HDW 02 2QJRLQJ([SHQVHV -REVLWH&HOO3KRQHVIRU6LWH6WDII 02 3URMHFW6FKHGXOH6HWXS 0DLQWHQDQFH /6 ([FOXGHG ([FOXGHG %,00RGHO6HWXS 0DLQWHQDQFH /6 ([FOXGHG ([FOXGHG 3URMHFW([WUDQHW6HWXS 0DLQWHQDQFH /6 3URMHFW3KRWR'RFXPHQWDWLRQ 0R 9LGHR?:HEFDP'RFXPHQWDWLRQ 02 1$ 1$ (PSOR\HH3DUNLQJ 02 %\6XE %\6XE +RPH2IILFH7UDYHO&RVWV /6 1$ 1$ 0RYLQJ 6XEVLVWHQFH /6 1$ 1$ $GGLWLRQDO3ODQV 6SHFVGXULQJ&RQVWUXFWLRQ /6 6KLSSLQJ&RXULHUV 3RVWDJH 02 3URMHFWVSHFLILF'HOLYHU\ +DXOLQJWR?IURP6LWH /6 1$ 1$ 7HPSRUDU\5DGLRV /6 1$ 1$ ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW 7HPSRUDU\:LULQJ /LJKWV 02 %\6XE %\6XE :DWHU,FH &XSV 02 /DGGHUV 6WDLUV /6 %\6XE %\6XE (URVLRQ&RQWURO /6 %\6XE %\6XE 6KRULQJ /6 %\6XE %\6XE :HHNO\&OHDQXS :. )LQDO&OHDQXS /6 'XPSVWHU5HQWDO 02 'XPSVWHU3XOOV ($ ,QFOXGHG ,QFOXGHG 7HPSRUDU\*HQHUDWRU 02 1$ 1$ 0LVF3RZHU(TXLSPHQW /6 1$ 1$ (TXLSPHQW5HSDLUV 0DLQWHQDQFH /6 1$ 1$ 7HPSRUDU\3DUWLWLRQV 6) %\6XE %\6XE 3LFN8S5HQWDO 02 $XWRPRELOH5HQWDO 02 3LFN8S)XHO 0DLQWHQDQFH 02 $XWRPRELOH)XHO 0DLQWHQDQFH 02 :DWHU7UXFN 02 %\6XE %\6XE +RLVWLQJ 0DWHULDO0DQDJHPHQW )RUNOLIW5HQWDO /6 %\6XE %\6XE 7RZHU&UDQH5HQWDO0RELOL]DWLRQ'HPRELOL]DWLRQ /6 1$ 1$ +\GUR&UDQH5HQWDO :. 1$ 1$ 2WKHU&UDQH&RVWV /6 1$ 1$ 0DWHULDO+RLVW :. %\6XE %\6XE 3HUVRQQHO+RLVW /6 1$ 1$ (UHFW+RLVWV /6 1$ 1$ ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW +RLVW/DQGLQJV /6 1$ 1$ 7HPSRUDU\+RLVW2SHUDWLRQ 02 1$ 1$ +RLVWLQJIRU6XEV /6 %\6XE %\6XE 6FDIIROGLQJ /6 %\6XE %\6XE 2WKHU+RLVWLQJ 0DWHULDOV0DQDJHPHQW&RVWV /6 1$ 1$ 7HPSRUDU\3URWHFWLRQRIWKH:RUN 7HPSRUDU\6LWH3URWHFWLRQQRWZ(URVLRQ&RQWURO /6 %\6XE %\6XE 7HPSRUDU\%XLOGLQJ3URWHFWLRQ :. %\6XE %\6XE 7HPSRUDU\%XLOGLQJ+HDWQRWZ*DV&KDUJHV :. %\6XE %\6XE 'HZDWHULQJ6\VWHP 2WKHU:DWHU5HPRYDO /6 %\6XE %\6XE 6QRZ5HPRYDO /6 1$ 1$ 2WKHU3URWHFWLRQRI:RUN,WHPV :. %\6XE %\6XE 7HVWLQJ 6RLO7HVWLQJ /6 %\2ZQHU &RQFUHWH7HVWLQJ /6 %\2ZQHU 0DVRQU\7HVWLQJ /6 %\2ZQHU :HOG7HVWLQJ /6 %\2ZQHU 2WKHU0DWHULDOV7HVWLQJ /6 %\2ZQHU 3HUPLWV )HHV %XLOGLQJ3HUPLW /6 %\2ZQHU 3ODQ&KHFN)HH /6 %\2ZQHU :DWHU7DS)HHV /6 %\2ZQHU 6HZHU7DS)HHV /6 %\2ZQHU 6DQLWDU\7DS)HHV /6 %\2ZQHU (OHYDWRU3HUPLW ,QVSHFWLRQV /6 %\6XE %\6XE 0HFKDQLFDO (OHFWULFDO3HUPLWV ,QVSHFWLRQV /6 %\2ZQHU %\2ZQHU ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW+'HVLJQ%XLOGHU V)HH&RVW3URSRVDO &RVW3URSRVDO'HWDLO 8SGDWHGRQ)(% ,WHP 'HVFULSWLRQ 4XDQWLW\ 8QLW 8QLW&RVW 7RWDO&RVW +HDOWK'HSDUWPHQW3HUPLWV ,QVSHFWLRQV /6 %\2ZQHU %\2ZQHU 2WKHU*RYHUQPHQW)HHV?3HUPLWV5HTXLUHGIRU)&2 /6 %\2ZQHU %\2ZQHU 2WKHU'HVLJQ%XLOGHU2QVLWH5HLPEXUVDEOH&RVWV 2WKHU'HVLJQ%XLOGHU V2QVLWH&RVWV1HHGHGIRUWKH:RUN /6 1$ 1$ & 'HVLJQ%XLOGHU V3URSRVHG&RVWVWR%H5HLPEXUVHGZR,QVXUDQFH 'HVLJQ%XLOGHU V7RWDO3URSRVHG&RVWVWR%H5HLPEXUVHG 'HVLJQ%XLOGHU V(VWLPDWHG2QVLWH5HLPEXUVDEOH([SHQVHV6XEWRWDO ''6%$2ZQHU'%$JPQW([EW+)HH&RVW5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\3HDN3WURJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW,±%LOOLQJ5DWHV 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW-±&RQILGHQWLDOLW\RIWKH3URMHFW 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW.±&RQILGHQWLDOLW\RIWKH3URMHFW 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW/±$OWHUQDWHVZLWK&RVWVDQG([SLUDWLRQ'DWHV 7REH3URYLGHGZLWKWKH*XDUDQWHHG0D[LPXP3ULFH &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW0±8QLW&RVWV 7REH3URYLGHGZLWKWKH*XDUDQWHHG0D[LPXP3ULFH &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW1±$OORZDQFHV 7REH3URYLGHGZLWKWKH*XDUDQWHHG0D[LPXP3ULFH &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW2±6FKHGXOHRI9DOXHV 7REH3URYLGHGZLWKWKH*XDUDQWHHG0D[LPXP3ULFH DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW3±'LVSXWHG:RUN6FKHGXOH 7REH3URYLGHG2QO\LIDQGZKHQ1HHGHG DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW4±(TXDO2SSRUWXQLW$PSOR\PHQW 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW5±(WKLFV$IILGDYLW 7REH3URYLGHGE\0$5 DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &LW\RI'HQWRQ V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$&2ZQHU&RQVXOWDQW$JUHHPHQW ([KLELW6±(VFURZ )LQDQFLQJ&RQGLWLRQV 1RW8VHG DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E &R' V'HYHORSPHQW6HUYLFHV%XLOGLQJ $,$$2ZQHU'HVLJQ%XLOGHU$JUHHPHQW ([KLELW=6FKHGXOHRI([KLELWV 8SGDWHG)(% 3ULQWHGDW30 'HVFULSWLRQ 3UHSDUHG%\ 'DWH'XH ([KLELW$±'HVLJQ%XLOG$PHQGPHQW 'HVLJQ%XLOGHU $V0XWXDOO\$JUHHG ([KLELW%±,QVXUDQFH %RQGV 2ZQHU $WWDFKHG ([KLELW&±3URMHFW0DQDJHPHQW3URFHVV 2ZQHU 0DU ([KLELW'±'HVLJQ&ULWHULD 2ZQHU $WWDFKHG ([KLELW(±&RQWURO(VWLPDWH 'HVLJQ%XLOGHU 0DU ([KLELW)±6FKHGXOLQJ5HTXLUHPHQWV 2ZQHU 0DU ([KLELW)±'HVLJQ%XLOGHU¶V3URMHFW6FKHGXOH 'HVLJQ%XLOGHU $WWDFKHG ([KLELW*±.H$LUPVDQG3HUVRQQHO 'HVLJQ%XLOGHU $WWDFKHG ([KLELW+±'HVLJQ%XLOGHU¶V)HH &RVW3URSRVDO 'HVLJQ%XLOGHU $WWDFKHG ([KLELW,±%LOOLQJ5DWHV 'HVLJQ%XLOGHU 0DU ([KLELW-±&RQILGHQWLDOLW\RIWKH3URMHFW 2ZQHU 0DU ([KLELW.±5HQWDO5DWHV 2ZQHU 0DU ([KLELW/±$OWHUQDWHVZLWK&RVWVDQG([SLUDWLRQ'DWHV 'HVLJQ%XLOGHU ZLWK*03 ([KLELW0±8QLW&RVWV 'HVLJQ%XLOGHU ZLWK*03 ([KLELW1±$OORZDQFHV 'HVLJQ%XLOGHU ZLWK*03 ([KLELW2±6FKHGXOHRI9DOXHV 'HVLJQ%XLOGHU ZLWK*03 ([KLELW3±'LVSXWHG:RUN6FKHGXOH 2ZQHU ,I1HFHVVDU\ ([KLELW4±(TXDO2SSRUWXQLW\(PSOR\PHQW 2ZQHU 0DU ([KLELW5±(WKLFV$IILGDYLW 2ZQHU 0DU ([KLELW6±(VFURZDQG)LQDQFLQJ&RQGLWLRQV 1RW8VHG 1$ $([KLELW=6FKHGXOHRI([KLELWV5(9WR7HDP 3DJHRI $OO5LJKWV5HVHUYHGE\ 3HDN3URJUDP9DOXH//& DocuSign Envelope ID: 3ED5894F-4E64-4CC0-8D45-49E0B4ACF31E Certificate Of Completion Envelope Id: 3ED5894F4E644CC08D4549E0B4ACF31E Status: Completed Subject: Please DocuSign: City Council Contract 7228-Development Services Bldg. Source Envelope: Document Pages: 177 Signatures: 5 Envelope Originator: Certificate Pages: 7 Initials: 1 Jody Word AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-08:00) Pacific Time (US & Canada) 901B Texas Street Denton, TX 76209 jody.word@cityofdenton.com IP Address: 129.120.6.150 Record Tracking Status: Original 2/28/2020 8:01:22 AM Holder: Jody Word jody.word@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Jody Word jody.word@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 129.120.6.150 Sent: 2/28/2020 8:25:18 AM Viewed: 2/28/2020 8:25:55 AM Signed: 2/28/2020 8:26:47 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 174.206.10.224 Signed using mobile Sent: 2/28/2020 8:26:49 AM Resent: 2/28/2020 8:33:56 AM Resent: 2/28/2020 8:43:08 AM Resent: 2/28/2020 9:00:46 AM Resent: 2/28/2020 9:05:23 AM Viewed: 2/28/2020 9:07:18 AM Signed: 2/28/2020 9:07:49 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Larry Collister larry.collister@cityofdenton.com First Assistant City Attorney City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 129.120.6.150 Sent: 2/28/2020 9:07:52 AM Viewed: 2/28/2020 9:08:34 AM Signed: 2/28/2020 9:39:12 AM Electronic Record and Signature Disclosure: Accepted: 9/26/2017 12:27:28 PM ID: 01f5f868-f109-4e29-ad49-21db9046c882 Martin Lehman mlehman@tsbyrne.com President Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 47.44.199.82 Sent: 2/28/2020 9:39:14 AM Resent: 2/28/2020 10:00:29 AM Resent: 2/28/2020 10:44:54 AM Viewed: 2/28/2020 11:47:37 AM Signed: 2/28/2020 11:48:10 AM Electronic Record and Signature Disclosure: Accepted: 2/28/2020 11:47:37 AM ID: f178e6c1-de3c-47aa-a507-11bc493794f5 Signer Events Signature Timestamp Sara Hensley Sara.Hensley@cityofdenton.com Sara Hensley Security Level: Email, Account Authentication (None)Signature Adoption: Drawn on Device Using IP Address: 75.87.0.122 Signed using mobile Sent: 2/28/2020 11:48:13 AM Viewed: 2/28/2020 11:59:28 AM Signed: 2/28/2020 12:00:00 PM Electronic Record and Signature Disclosure: Accepted: 2/28/2020 11:59:28 AM ID: d2cf758c-7fcb-4210-9a8c-fd20599d6b94 Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 129.120.6.150 Sent: 2/28/2020 12:00:04 PM Viewed: 3/4/2020 6:48:53 AM Signed: 3/4/2020 6:49:03 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Todd Hileman Todd.Hileman@cityofdenton.com City Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 129.120.6.150 Sent: 3/4/2020 6:49:07 AM Viewed: 3/4/2020 7:52:19 AM Signed: 3/4/2020 7:52:29 AM Electronic Record and Signature Disclosure: Accepted: 7/25/2017 9:02:14 AM ID: 57619fbf-2aec-4b1f-805d-6bd7d9966f21 Rosa Rios rosa.rios@cityofdenton.com City Secretary Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 129.120.6.150 Sent: 3/4/2020 7:52:32 AM Resent: 3/5/2020 1:32:18 PM Viewed: 3/6/2020 5:57:10 AM Signed: 3/6/2020 5:57:46 AM Electronic Record and Signature Disclosure: Accepted: 3/6/2020 5:57:10 AM ID: bff67775-eee0-450d-a2be-ea9cc04dd644 In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 2/28/2020 8:26:50 AM Electronic Record and Signature Disclosure: Carbon Copy Events Status Timestamp Not Offered via DocuSign Sherri Thurman sherri.thurman@cityofdenton.com City of Denton Security Level: Email, Account Authentication (None) Sent: 2/28/2020 12:00:04 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Jane Richardson jane.richardson@cityofdenton.com Assistant City Secretary City of Denton Security Level: Email, Account Authentication (None) Sent: 3/4/2020 6:49:06 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Zolina Parker zolina.parker@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 3/4/2020 6:49:06 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Dean Hartley Dean.Hartley@cityofdenton.com Facilities Manager Security Level: Email, Account Authentication (None) Sent: 3/6/2020 5:57:50 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Larry Chan larry.chan@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 3/6/2020 5:57:51 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Dawn Wilson Dawn.Wilson@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 3/6/2020 5:57:52 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Jody Strickland jody.strickland@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 3/6/2020 5:57:53 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 3/6/2020 5:57:53 AM Envelope Summary Events Status Timestamps Certified Delivered Security Checked 3/6/2020 5:57:53 AM Signing Complete Security Checked 3/6/2020 5:57:53 AM Completed Security Checked 3/6/2020 5:57:53 AM Payment Events Status Timestamps Electronic Record and Signature Disclosure ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. #! !#$! " "$!!# !#"!# !!% "#!!#!"% " " How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you.