Loading...
HomeMy WebLinkAbout2021-07-27 Agenda and BackupCity of Denton Meeting Agenda City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com City Council Council Chambers2:00 PMTuesday, July 27, 2021 WORK SESSION BEGINS AT 2:00 P.M. IN THE COUNCIL CHAMBERS CITY COUNCIL CONSIDERATION OF THE CONSENT AGENDA AND ITEMS FOR INDIVIDUAL CONSIDERATION WILL BEGIN IMMEDIATELY FOLLOWING THE WORK SESSION IN THE COUNCIL CHAMBERS Note: A quorum of the City Council, at time of posting, identified to be Mayor Gerard Hudspeth, Mayor Pro Tem Paul Meltzer, and Council Members Vicki Byrd, Brian Beck, Jesse Davis, Alison Maguire, and Deb Armintor will be participating in the work session and meeting in person in the Council Chambers. AS OF JUNE 14, IN-PERSON PUBLIC COMMENTS ARE ALLOWED AT THIS MEETING. FOR VIRTUAL PARTICIPATION, SEE THE REGISTRATION PROCESS DETAILED BELOW. REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL Citizens will also be able to participate in one of the following ways (NOTE: Other than public hearings, citizens are only able to comment one time per agenda item; citizens cannot use both methods to comment on a single agenda item. Public comments are not held for work session reports.) • Virtual White Card – On July 23, the agenda was posted online at www.cityofdenton.com/publicmeetings. Once the agenda is posted, a link to the Virtual White Card, an online form, will be made available under the main heading on the webpage. Within this form, citizens may indicate support or opposition and submit a brief comment about a specific agenda item. Comments may be submitted up until the start of the meeting, at which time, the Virtual White Card form will be closed. Similar to when a citizen submits a white card to indicate their position on the item, these comment forms will be sent directly to City Council members and recorded by the City Secretary. City Council Members review comments received in advance of the meeting and take that public input into consideration prior to voting on an agenda item. The Mayor will announce the number of Comment Cards submitted in support or opposition to an item during the public comment period. Comments will not be read during the meeting. The City Secretary will reflect the number of comments submitted in favor/opposition to an item, the registrant’s name, address, and (summary of) comments within the Minutes of the Meeting, as applicable. OR Page 1 Printed on 7/28/2021 1 July 27, 2021City Council Meeting Agenda • By phone – Citizens wishing to speak over the phone during this Council meeting, may call (940) 349-7800 beginning 30 minutes prior to the meeting start time. Comments by phone will be accepted until the item is opened for discussion by the Council. When the call is initially received, a staff member will receive the caller’s information and either: 1) offer to call the citizen back when it is time for them to speak, or 2) record the caller’s information, support or opposition, and comment. If the caller chooses to record their support or opposition, rather than speaking during the meeting, the Mayor will announce the number of comments submitted in support or opposition to the item. If the caller wishes to receive a call back, the voice of each caller will be broadcast into the meeting during the public commenting time of their desired agenda item. Individuals will be able to comment once per agenda item, no matter the method. • At regular meetings only, citizens can speak on any topic that is not on the agenda (Open Microphone). Alert the call taker if you wish to speak under the Open Microphone category. If you would like to give a public report, see the information below. After determining that a quorum is present, the City Council of the City of Denton, Texas will convene in a Work Session on Tuesday, July 27, 2021, at 2:00 p.m. in the Council Chambers at City Hall, 215 E. McKinney Street, Denton, Texas at which the following items will be considered: WORK SESSION 1. Citizen Comments on Consent Agenda Items This section of the agenda allows citizens to speak on any item listed on the Consent Agenda prior to its consideration. Each speaker will be given a total of three (3) minutes to address any item(s). Any person who wishes to address the City Council regarding these items may do so by utilizing the "By Phone" registration process as referenced under the REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL detailed at the beginning of this agenda. Registration is required prior to the time the City Council considers this item. Registrants may call in and remain on hold or receive a call back at the time the Work Session is called to Order and are encouraged to ensure they remain accessible to accept the call. 2. Requests for clarification of agenda items listed on this agenda. 3. Work Session Reports Receive a report, hold a discussion, and give staff direction regarding Audit Project 021 - Water System Operations: Distribution. ID 21-982A. Receive a report, hold a discussion, and give staff direction regarding FY 2021-22 departmental budget presentations for Fleet, Capital Projects/Engineering, Development Services/Real Estate, Solid Waste, Water, Wastewater/Drainage, Environmental Services and Streets. ID 21-456B. Receive a report, hold a discussion, and give staff direction regarding a follow up of federal American Rescue Plan (ARP) Act of 2021 and proposed uses for ARP funds received by the City of Denton. ID 21-1054C. NOTE: Any item for which a formal action at the Special Called Meeting has been taken by Council may be subject to a request for a motion for reconsideration at any time during the meeting, at the Concluding Items Section, or after the meeting. In order to comply with the Texas Open Meetings Act, a request for a motion for reconsideration made during, at the end of, or after a Council meeting will be placed on the agenda and considered at the next official meeting of the City Council. Page 2 Printed on 7/28/2021 2 July 27, 2021City Council Meeting Agenda Following the completion of the Work Session, the City Council will convene in a Special Called Meeting to consider the following items: 1. CONSENT AGENDA Each of these items is recommended by Staff and approval thereof will be strictly on the basis of the Staff recommendations. Approval of the Consent Agenda authorizes the City Manager or his designee to implement each item in accordance with the Staff recommendations. The City Council has received background information and has had an opportunity to raise questions regarding these items prior to consideration. Listed below are bids, purchase orders, contracts, and other items to be approved under the Consent Agenda (Agenda Items A - I). This listing is provided on the Consent Agenda to allow Council Members to discuss or withdraw an item prior to approval of the Consent Agenda. If no items are pulled, the Consent Agenda Items will be approved with one motion. If items are pulled for separate discussion, they may be considered as the first items following approval of the Consent Agenda. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a funding agreement with Denton Community Food Center to provide Community Development Block Grant-Coronavirus funds for public facility improvements in Denton, Texas; authorizing the expenditure of funds in an amount not to exceed $439,483.00; and providing an effective date. ID 21-966A. Consider approval of a resolution of the City of Denton, Texas, amending Resolution No. 19-2886 relating to the Bond Oversight Committee, to amend the manner in which members are appointed to the committee; and provide for an effective date. ID 21-1507B. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with On Computer Services, L.L.C., dba Unified Power, for uninterruptible power supply (UPS) maintenance and services for the Technology Services Department; providing for the expenditure of funds therefor; and providing an effective date (RFP 7546 - awarded to On Computer Services, L.L.C., dba Unified Power, for three (3) years, with the option for two (2) additional one (1) year extensions, in the total five (5) year not-to-exceed amount of $195,000.00). ID 21-1489C. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with Groggy Dog Sportswear & Graphic Design, LLC for athletic shirts and jerseys for the Parks and Recreation Department; providing for the expenditure of funds therefor; and providing an effective date (RFP 7602 - awarded to Groggy Dog Sportswear & Graphic Design, LLC, for one (1) year, with the option for two (2) additional one (1) year extensions, in the total three (3) year not-to-exceed amount of $120,000.00). ID 21-1490D. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with DLT Solutions, LLC, through the Department of Information Resources (DIR) Cooperative Purchasing Network Contract No. DIR-TSO-4236, for AutoCAD AEC Collection Software system subscription, maintenance, and purchase of licenses for the ID 21-1491E. Page 3 Printed on 7/28/2021 3 July 27, 2021City Council Meeting Agenda Technology Services Department; providing for the expenditure of funds therefor; and providing an effective date (File 7630 - awarded to DLT Solutions, LLC, in the four (4) year not-to-exceed amount of $228,873.00). Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the approval of Change Order No. 3 to the contract between the City of Denton and MSB Constructors, Inc., to provide additional services for the Development Services Center Parking Lot Improvements Project; providing for the expenditure of funds therefor; and providing an effective date (File 7452 - Change Order No. 3 in the not-to-exceed amount of $45,395.74, for a total contract award aggregated to $1,038,225.83). ID 21-1492F. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a First Amendment to Solid Waste Disposal Contract with Frontier Access, LLC; and providing an effective date. ID 21-1406G. Consider adoption of an ordinance of the City of Denton, Texas, authorizing the Interim City Manager, or her designee, to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas, Texas Department of Public Safety, authorizing the Denton Police Department to perform Uniform Commercial Vehicle Weight Inspections and Enforcement; and providing an effective date. ID 21-1446H. Consider adoption of an ordinance of the City of Denton, Texas, authorizing the Interim City Manager, or her designee, to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas, Texas Department of Public Safety, establishing responsibilities, policies, and guidelines for the Denton Police Department to conduct Federal Safety Regulation Inspections; and providing an effective date. ID 21-1447I. 2. ITEMS FOR INDIVIDUAL CONSIDERATION Consider approval of a resolution of the City of Denton abolishing The Community Development Advisory Committee; and providing an effective date. ID 21-1552A. Consider adoption of an ordinance of the City of Denton repealing Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas; and providing an effective date. ID 21-1553B. Consider approval of a resolution of the City of Denton creating a Community Services Advisory Committee to advise the city council on programs, services, and use of public resources to address complex social problems such as economic instability, housing, and homelessness and for meeting community service needs; and providing an effective date. ID 21-979C. Consider approval of a resolution of the City Council of the City of Denton for the appointment of one member to the Board of Managers of the Denco Area 9-1-1 District for a two-year term beginning on October 1, 2021 and ending on September 30, 2023, and providing an effective date. ID 21-1538D. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a Roadway Development Agreement between the City of Denton and Sagebrook ID 21-791E. Page 4 Printed on 7/28/2021 4 July 27, 2021City Council Meeting Agenda Denton, LP, for the dedication and installation of transportation infrastructure at or adjacent to the Sagebrook Addition; authorizing the expenditure of funds therefor; authorizing acceptance of land and improvements; and providing an effective date. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a Park Development Agreement between the City of Denton and Sagebrook Denton, LP, for the dedication of park land at the Sagebrook Addition; authorizing acceptance of land; and providing an effective date. ID 21-1514F. 3. CONCLUDING ITEMS A. Under Section 551.042 of the Texas Open Meetings Act, respond to inquiries from the City Council or the public with specific factual information or recitation of policy, or accept a proposal to place the matter on the agenda for an upcoming meeting AND Under Section 551.0415 of the Texas Open Meetings Act, provide reports about items of community interest regarding which no action will be taken, to include: expressions of thanks, congratulations, or condolence; information regarding holiday schedules; an honorary or salutary recognition of a public official, public employee, or other citizen; a reminder about an upcoming event organized or sponsored by the governing body; information regarding a social, ceremonial, or community event organized or sponsored by an entity other than the governing body that was attended or is scheduled to be attended by a member of the governing body or an official or employee of the municipality; or an announcement involving an imminent threat to the public health and safety of people in the municipality that has arisen after the posting of the agenda. C E R T I F I C A T E I certify that the above notice of meeting was posted on the official website (https://www.cityofdenton.com/en-us/government/open/agendas-minutes) and bulletin board at City Hall, 215 E. McKinney Street, Denton, Texas, on July 23, 2021, in advance of the 72-hour posting deadline, as applicable, and in accordance with Chapter 551 of the Texas Government Code. __________________________________________ CITY SECRETARY NOTE: THE CITY OF DENTON'S DESIGNATED PUBLIC MEETING FACILITIES ARE ACCESSIBLE IN ACCORDANCE WITH THE AMERICANS WITH DISABILITIES ACT. THE CITY WILL PROVIDE ACCOMMODATION, SUCH AS SIGN LANGUAGE INTERPRETERS FOR THE HEARING IMPAIRED, IF REQUESTED AT LEAST 48 HOURS IN ADVANCE OF THE SCHEDULED MEETING. PLEASE CALL THE CITY SECRETARY'S OFFICE AT 940-349-8309 OR USE TELECOMMUNICATIONS DEVICES FOR THE DEAF (TDD) BY CALLING 1-800-RELAY-TX SO THAT REASONABLE ACCOMMODATION CAN BE ARRANGED. Page 5 Printed on 7/28/2021 5 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-982,Version:1 AGENDA CAPTION Receive a report, hold a discussion, and give staff direction regarding Audit Project 021 - Water System Operations: Distribution. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™6 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Internal Audit CITY AUDITOR: Madison Rorschach DATE: July 27, 2021 SUBJECT Receive a report, hold a discussion, and give staff direction regarding Audit Project 021 – Water System Operations: Distribution. BACKGROUND City of Denton Charter Article VI, Section 6.04 states, the City Internal Auditor is responsible for providing an independent appraisal of City operations as directed by the City Council. These audits are conducted in accordance with Generally Accepted Government Auditing Standards promulgated by the US Government Accountability Office. Per Government Auditing Standards, internal auditors should make audit reports available to the public and should communicate results to the parties who can ensure that the results are given due consideration. In order to meet these Government Auditing Standards, the City of Denton’s Internal Audit Procedures Manual requires finalized audit reports to be presented to the City Council. Once presented, all published reports can be found on the City of Denton’s Internal Audit Webpage. DISCUSSION This audit project is intended to evaluate the effectiveness of the City’s water system operations and has been broken into three phases. The second phase – Distribution – is intended to provide assurance that the City’s water distribution line maintenance activities are effective. The City currently maintains about 630 miles of water lines that distribute treated water to its customers. These water lines must be adequately maintained, replaced, and repaired to minimize water losses and ensure continual services. Specifically, this audit evaluated small water line replacement and water line leak repairs. Initial, detailed findings from this audit project phase are presented in the attached Audit of Water System Operations: Distribution report. RECOMMENDATION Staff recommends closing phase two, Distribution, of Audit Project 021 – Water System Operations until a follow-up review is conducted to assess the implementation of the 12 issued recommendations. This follow-up review will likely take place in the next eighteen to thirty-six months. PRIOR ACTION/REVIEW (Council, Boards, Commissions) This audit project was approved as part of the fiscal year 2020-21 Audit Plan adopted on October 6, 2020 and amended on March 16, 2021. City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 7 EXHIBITS 1. Agenda Information Sheet 2. Audit of Water System Operations: Distribution 3. Presentation Respectfully submitted: Madison Rorschach, 940-349-7228 City Auditor 8 Office of the City Auditor Accountability  Transparency  Integrity  Quality 215 E. McKinney St., Denton, TX 76201  (940) 349-7228 Audit of Water System Operations Distribution The City of Denton’s water distribution infrastructure is generally maintained effectively. However, formalized asset management planning and improved record keeping would increase the effectiveness of replacement activities. Additional staff guidance for leak repairs would ensure compliance with the City’s established practices and statutory requirements. Audit Team City Auditor Madison Rorschach, CIA, CGAP Audit Staff Neeraj Sama, MBA 9 Audit of Water System Operations: Rate Structure June 2021 Audit Project #: 021 P a g e | 2 Table of Contents Audit at a Glance ......................................................................................................... 3 Introduction ................................................................................................................... 4 Management Responsibility ...................................................................................... 4 Audit Objectives, Scope, and Methodology .......................................................... 4 Findings & Analysis ........................................................................................................ 6 Formal Asset Management Plan May Improve Replacement Planning .............. 6 Replacement Project Management Process Seems Adequate; Critical Documentation Not Maintained .............................................................................. 8 Moratorium Checks and ROW Permit Requirements Not Established ................ 10 Replacement Project Material & Labor Costs Not Effectively Reconciled ........ 13 Replacement Project Infrastructure Not Capitalized Timely ............................... 15 Leak Repair Timeliness Can’t Be Determined Due to Data Limitations, Lack of Parameters ................................................................................................................ 17 Additional Guidance Would Improve Compliance with Established Practices and Requirements for Minor Maintenance ........................................................... 20 Safety Assurance Activities Generally Seem Effective ......................................... 22 Appendix A: Management Response Summary ..................................................... 25 10 Audit of Water System Operations: Rate Structure June 2021 Audit report translations may be requested by emailing InternalAudit@CityofDenton.com. Audit at a Glance Why we did this Audit: The City maintains about 630 miles of water lines that distribute treated water to customers. In order to effectively provide water service, the Water Department must adequately maintain, replace, and repair these water lines to minimize water losses and ensure continual service. This audit project was included on the City’s fiscal year 2020-21 Audit Plan as approved by the City Council. This report details findings and recommendations from phase two of the project. What we Found: This audit generally evaluated the City’s water distribution maintenance activities including, infrastructure replacement projects and leak repairs. Findings about each of these operational areas are summarized below: Infrastructure Replacement Projects. The Department has generally designed an effective process to identify and carry out small water line replacement projects; however, documentation of some critical steps in this process is not well maintained. Furthermore, the Department has not established processes to ensure proper communication with other stakeholders in the small water line replacement process such as the Streets and Public Works Inspections Divisions. In addition, replacement project costs for labor and materials are not adequately reconciled by the Water Department to ensure new infrastructure value is accurately calculated. Similarly, coordination issues and lack of guidance on defined time periods for closing projects may be delaying the capitalization of replacement project infrastructure. Leak Repairs. The Water Department does not proactively identify leaks in the distribution system and instead generally relies on resident reports. Due to data limitations, it is not possible to determine how quickly a leak is repaired after a report is received. In addition, the Department has not established parameters around how quickly repairs should be made or to help prioritize repair work. Finally, while some standard operating procedures have been developed, there are inconsistencies in how leak repair activities are documented, potentially leading to quality issues. What we Recommend: Recommendation 1 & 2 Develop a formal asset management plan & ensure replacement projects are adequately documented. Recommendation 3 & 4 Clarify process for moratorium checks and right of way permits with the Streets and Public Works Inspections Division. Recommendation 5 & 6 Refine processes to reconcile replacement project labor & material costs. Recommendation 7 & 8 Ensure replacement project infrastructure is capitalized timely. Recommendation 9 & 10 Develop formal parameters for leak repair timeliness and prioritization. Recommendation 11 & 12 Formalize guidance for staff on how to complete work orders and comply with safety requirements. 11 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 4 Introduction The Internal Audit Department is responsible for providing: (a) an independent appraisal1 of City operations to ensure policies and procedures are in place and complied with, inclusive of purchasing and contracting; (b) information that is accurate and reliable; (c) assurance that assets are properly recorded and safeguarded; (d) assurance that risks are identified and minimized; and (e) assurance that resources are used economically and efficiently and that the City’s objectives are being achieved. The Internal Audit Department has completed a performance audit of the City’s water distribution infrastructure projects and maintenance activities. We conducted this performance audit in accordance with generally accepted government auditing standards. Those standards require that we plan and perform the audit to obtain sufficient, appropriate evidence to provide a reasonable basis for our findings and conclusions based on our audit objectives. We believe that the evidence obtained provides a reasonable basis for our findings and conclusions based on our audit objectives. Management Responsibility City management is responsible for ensuring that resources are managed properly and used in compliance with laws and regulations; programs are achieving their objectives; and services are being provided efficiently, effectively, and economically. Audit Objectives, Scope, and Methodology The Internal Audit Department has completed an audit of the City’s water system distribution infrastructure projects and maintenance activities. This report is intended to provide assurance that the City’s water distribution infrastructure is effectively constructed and maintained. This report is the second phase in an audit project series covering water system operations. Phase One Rate Structure was published in June 2021 and Phase Three Production is expected to be published in September. Audit fieldwork was conducted during March, April, May, and June 2021. The scope of review varied depending on the procedure being performed. The following list summarizes major procedures performed during this time: 1 The City of Denton’s Internal Audit Department is considered structurally independent as defined by generally accepted government auditing standard 3.56. 12 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 5 ➢ Reviewed documentation to develop criteria including industry standards, best practices, policies, and procedures; ➢ Developed process narratives to identify current control activities in water distribution maintenance and capitalization processes that were certified by Water Department and Finance Department staff; ➢ Interviewed Water Department and Finance Department staff and reviewed policies and procedures pertaining to water distribution projects; ➢ Interviewed Safety Department staff and examined safety measures and standards observed in water distribution maintenance projects’ job sites; ➢ Reviewed a statistical sample2 of 262 work orders to verify the timeliness and effectiveness of leak repairs; ➢ Reviewed six water distribution small water line replacement projects completed since March 2020 to analyze and verify the management and administration of those projects; ➢ Reviewed project closure and capitalization details of 21 small water line replacement projects completed since November 2018 to verify that the completed projects were timely closed and capitalized; ➢ Reviewed small water line replacement project documentation to determine that moratorium check and right of way permit requirements are being followed; and ➢ Reviewed small water line replacement project records to verify that material and labor costs are regularly reconciled to ensure accurate cost allocation. 2 This sample size provides with 95 percent confidence that the true population mean is within ±5 percent of the sample estimate. 13 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 6 Findings & Analysis The City of Denton’s water distribution system currently consists of a water line network that provides water service to approximately 140 square miles. The City's Water Department is generally responsible for maintaining the water lines within this service area. Water distribution maintenance3 is generally broken into two categories as shown in Figure 1: Figure 1: Water Distribution Maintenance Activities During fiscal year 2019-20 and fiscal year 2020-21, the Department completed 19 water line replacement projects with a total capitalized value of $2.61 million and repaired almost 500 water line breaks. This audit generally evaluated the City’s water distribution maintenance activities including small water line replacement projects and water line leak (i.e. from breaks or cuts) repairs – fire hydrant repairs, main and service taps, and valve repairs were not reviewed. Formal Asset Management Plan May Improve Replacement Planning The Government Finance Officers Association best practices recommend that local governments adopt formal policies for their capital improvement and asset replacement activities. Additionally, the Environment Protection Agency recommends that water utilities conduct asset management activities through an asset management program and have an asset management plan covering asset replacement and funding planning. 3 Water lines greater than 12 inches are generally replaced as part of the City’s capital improvement process, which is managed by the City’s Capital Projects Delivery Division of the Engineering Department. Water Distribution Maintenance Activities Major Maintenance In-house replacement of six to 12 inch water distribution lines Minor Maintenance Water line and fire hydrant break repairs, water main and service taps, valve repair 14 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 7 What We Found • The Water Department utilizes a geographic information-based asset management and capital planning software, as an asset management program for water line replacement projects. o The asset management program recommends rehabilitation actions for each section of water line based on predefined parameters including: break rates, location information, condition score, criticality score, and risk score. o The Water Department's asset management program is administered by an asset management group consisting of Water Department staff. The asset management groups activities are generally overseen by the asset management committee, which includes a Deputy Director and Water Department Managers. • The Water Department's asset management and replacement activities appear to generally align with the Environmental Protection Agency’s best practices on asset management except for formal financial and strategic planning. o Asset management related activities broadly cover asset inventory planning, condition assessment, critical assets identification, replacement planning and performance tracking. o The asset management program has not been formally adopted through an asset management plan covering that covers financial and strategic planning aspects. o The costs of replacement projects are generally recovered through the City's water revenues. Budgeting for these projects is included in the City's annual budgeting process. • According to Water Department staff, the amount of water line to be replaced is planned annually based on historical data and replacement capacity. o The Water Department planned to replace 16,000 linear feet of small waterlines during fiscal year 2020-21 with an estimated cost of $27.2 million. o The Water Department appears to have replaced 19,473 and 12,875 liner-feet of water lines during fiscal year 2019-20 and fiscal year 2020- 21, respectively. 15 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 8 Why It Matters Adopting a comprehensive asset management plan would help increase the effectiveness of the asset management program by providing clear guidance to staff about the strategic and financial objectives of asset management and replacement activities. Additionally, having formal guidance on asset management activities would help Water Department staff retain institutional knowledge and promote consistency when planning for asset replacement. Recommendation: 1. Develop and adopt a formal, comprehensive asset management plan, including the annual asset replacement planning considerations and strategic and financial planning objectives. Water Department Comments: There is an asset management program (Software) that the City currently uses to develop a list of annual asset replacement projects. This program does not include strategic and financial planning. Water Utilities staff will develop and adopt a comprehensive asset management plan that includes strategic goals and financial planning objectives to guide the long-term maintenance plan. Replacement Project Management Process Seems Adequate; Critical Documentation Not Maintained The Project Management Body of Knowledge – PMBOK – provides best practices on project management including five basic process groups and ten knowledge areas typical of almost all projects. In general, the project management process includes: initiating, planning, executing, controlling & monitoring, and closing. PMBOK recommends the following knowledge areas for effective administration of projects: ➢ Integration ➢ Resources ➢ Scope ➢ Communication ➢ Time ➢ Risk ➢ Cost ➢ Procurement ➢ Quality ➢ Stakeholders What We Found • The Water Department has developed a capital improvement process guide for small water line replacement projects. Based on this guide, staff should 16 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 9 also document critical process steps in replacement projects as outlined in Figure 2. Figure 2: Water Line Replacement Project Critical Steps o Based on a comparison of PMBOK’s best practices to the process guide and other Water Department activities, the process followed for managing replacement projects generally aligns with PMBOK’s recommended knowledge areas and project management process. • Small water line replacement projects are managed and tracked in the Water Department’s work order system and the City’s collaborative work management software. The Engineering Design Division designs plans for these replacement projects. • Based on a review of six small water line replacement projects completed since March 2020, some project documentation needed for quality and monitoring assurance was missing. o Documentation relating to the 30-60-90 project design process and the project completion walkthrough process could not be obtained. o In addition, some documentation was not centrally stored in the Department’s work order system or work management software. According to Water Department staff, the City is working to implement a new construction management software, which can centrally track and store project documentation. Plan •Field Assessments •Work Orders •Asset Management Committee Review Revise •Project Scope •Asset Management Committee Review Schedule •Moratorium Check •Assess OPCC •Design Request •Project Construction Schedule Design •30-60-90 Design Process •Finalized Design Construct •Material List •Call Line Locate •Traffic Planning Record •Walkthrough and Punch List Items •Bacteriological Reports •Request Capitalization 17 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 10 • Established traffic impact planning was followed for all reviewed projects by submission of a Utilities Traffic Impact Information Sheet (UTILITIIS).4 Why It Matters PMBOK's methodology is recognized as an industry best practice for project management. In general, the Water Department appears to have designed a water line replacement project management process that follows this methodology. That being said, without documenting critical steps in this process, it is difficult to determine if projects were administered per the established capital improvement project guide. Specifically, ensuring the results from the final walkthrough are documented and these punch list items are completed is essential for quality assurance. Similarly, the capital improvement process guide calls for a 30-60-90 design process, which is generally used to help focus design review by providing increasing detail at each level. Ensuring that design plans and reviews are documented at each of these stages should help to timely resolve any discrepancies found during the process and save time and City's resources. Recommendation: 2. Instruct Water Department staff to execute and maintain project documents for the steps and activities prescribed under the capital improvement process guide. Consider designating a central repository to facilitate document retention. Water Department Comments: Water Utilities staff is currently working on implementing Procore (software) to manage the in-house asset replacement projects. Once implemented, project documents, review’s, approvals, walkthrough, etc. can be documented and stored at a central location for easy access in the future. Moratorium Checks and ROW Permit Requirements Not Established Checking street moratorium and obtaining right of way – or ROW – permits are important steps in planning water line replacement projects. City ordinance requires every party, external or internal, to apply for a ROW permit if they plan to engage in construction, excavation, or occupy a work area within or upon any right of way. 4 Utilities Traffic Impact Information Sheet (UTILITIIS) is a form to be filled out in the Department’s work management software for traffic impact planning for construction activities. 18 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 11 Additionally, the City’s Streets Department currently places a moratorium on streets that have recently been improved. These moratoriums are intended to prevent the accelerated deterioration that comes when a street is cut into and patched. Streets current practices state: “Utilities should request authorization to be able to construct in [moratorium] areas.” In general, construction activities are not permitted for projects under moratorium streets unless there is an emergency. What We Found • The Water Department does not obtain ROW permits for small water line replacement projects. o A ROW permit was not obtained for any of the 21 completed projects reviewed. o According to Water Department staff, a ROW permit is not required to be obtained for small water line replacement projects; however, based on discussion with Public Works Inspections staff, who issue right of way permits, it is unclear why these projects would be exempt from the ordinance requirements. o Water Department staff do generally obtain ROW permits for planned minor maintenance activities. • During the project planning phase, Water Department staff check moratorium conflicts on a GIS map for the streets involved in proposed water line replacement projects. Based on the review of moratorium information available in the GIS map for 21 small water line replacement projects completed since November 2018: o Of the 21 projects, only two were at locations under a moratorium. According to Water Department staff, in one of these instances the moratorium was not identified before the project was initiated. For the other project, Water Department staff stated they received approval from Streets as the project was an emergency; however, there was no documented evidence of this discussion or approval. o There is currently no formal process or procedure for the Water Department to receive documented approval to conduct work on a moratorium road with the Streets Division for planned projects. Development of this kind of process was originally recommended to the Water Department as part of the 2019 Audit of Utility Street Cuts, which reviewed the moratorium process for water distribution minor maintenance activities. 19 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 12 Why It Matters The City requires all work in the right of way to be permitted in order to ensure that the safe passage of pedestrian and vehicular traffic is maintained to the greatest extent possible. While the City’s right of way ordinance does provide some exemptions to this requirement, it is unclear how small water line replacement projects qualify for one of these exemptions. For that reason, it is important to clarify if a right of way permit is necessary for water line replacement projects and, if so, that staff apply for these permits properly and in a timely manner. Additionally, newly improved streets are placed under a construction moratorium in an effort to preserve their useful life, as any excavation weaken the street’s integrity. For this reason, non-emergency work on water lines under moratorium streets should be minimized as much as possible and emergency work should be clearly communicated. Without proper documentation or a formalized process for approving construction on moratorium streets, it is unclear if all stakeholders were informed and approved of weakening the City’s streets infrastructure. Recommendations: 3. Clarify if the Water Department is required to obtain right of way permits for its small water line replacement projects by consulting with the Public Works Inspections Division and the City Attorney’s Office. If right of way permits are required for small water line replacement projects, incorporate this step into the water capital improvement process guide. Water Department Comments: Water Utilities staff will consult with Public Works staff and the City Attorney’s office to determine a path forward on the right-of-way permit requirement for replacing water infrastructure. 4. Document and track formal approval from the Streets Division to perform water distribution projects on water lines under moratorium streets. For emergency projects, the Water Department should ensure that the Streets Division is notified even if formal approval is received after the fact. Water Department Comments: Water Utilities staff is currently working on implementing Procore (software) to manage the in-house asset replacement projects. Once implemented, the clearance of streets under moratorium can be obtained from the Streets department through the RFI process in the software. 20 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 13 Replacement Project Material & Labor Costs Not Effectively Reconciled Labor and material costs are major components of in-house water distribution project costs, which are ultimately capitalized as assets in the City’s accounting records. Material usage and labor hours should be regularly reconciled to ensure project costs are accurate and labor and materials are used efficiently. What We Found • Material for small water line replacement projects is generally obtained from the City’s Warehouse Division.5 o Materials needed for each project are determined by the crew leader based on the project plans. This materials list is then approved by the Field Service Supervisor and forwarded to the Warehouse. o According to Water Department staff, crews then pick up materials from the Warehouse during construction as needed and do not collect material that will not be used in the project; however, there is currently no process to reconcile the materials used in the projects to those in the Department’s work order system for each project. o Each month, Warehouse staff do send a report of issued materials to the Water Department. According to Water Department staff, this report is used to ensure materials are charged to the correct account and job code in the City’s financial system. • Daily, each crew leader records labor hours in the work order of their active project. Water crew members separately complete a physical timesheet, which is used by the Water Department’s Administrative Assistant to record labor hours to each project in the City’s time and attendance tracking software. The Field Service Supervisor verifies that labor hours in the time tracking software are accurately allocated to each project. o Based on a review of randomly selected crew members’ 20 days’ work hours in 14 cases, work hours were not appropriately logged in the work order system or were inaccurately allocated to projects in time and attendance tracking software in those cases. 5 Occasionally materials needed that are not in inventory are ordered through the standard procurement process. 21 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 14 • The City generally owns the equipment used in small water line replacement projects, and a process is in place to record the equipment used for the assigned project. Why It Matters Inaccurately recording material and labor costs lead to inaccurate project cost estimation and reporting. Specifically, reconciling materials used to those ordered for each project would ensure that material costs have been correctly recorded in each replacement project and that any unused material is accurately reported and returned. Additionally, it would also help identify any discrepancies between estimated project costs and costs associated with used materials. While only collecting materials when they are needed does provide some assurance that materials are not wasted, it does not completely ensure that all materials collected are needed and recorded for each project. Similarly, effectively reconciling labor hours in the work order system to those in the City’s time keeping system would help the Water Department ensure project costs are accurate. Recommendations: 5. Consider implementing a reconciliation process to verify and confirm that the materials obtained were used for the correct project and recorded in the work order system and to ensure that any unused material is accurately reported to Warehouse and returned. Water Department Comments: Water Utilities will develop and implement a process to confirm that the material checked out from the warehouse is tracked and allocated to the appropriate project. 6. Evaluate opportunities to streamline the process of recording and allocating water crew labor hours to projects. If a more streamlined process cannot be implemented, ensure labor hour discrepancies between the work order system and time keeping system are minimized. Water Department Comments: Water Utilities staff will work on evaluating opportunities for streamlining the allocation of labor hours to the appropriate replacement project. 22 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 15 Replacement Project Infrastructure Not Capitalized Timely Project closure and asset capitalization are the final steps of small water line replacement projects. Ideally, an asset should be capitalized when it is placed in service and the economic benefit of that asset is being received. Therefore, water project closure requests should be communicated as soon as a project is completed, enabling the Finance Department to initiate the capitalization process timely. What We Found • After completing a small water line replacement project, a Water Department project manager is required to submit a project closure request to the Finance Department. In order to complete a replacement project, not only does the water line have to be replaced, but all costs associated with the right of way restoration must also be finalized. o Of the 21 reviewed projects with complete water line replacement since November 2018, six closure requests have not yet been submitted to the Finance Department. These projects have been open after the replacement was finished between three and 22 months. o Based on review of the 15 capitalized projects, it takes an average of eight months from water line replacement completion for Water Department staff to request project closure. The time taken from water line replacement to closure request to capitalization for these projects is illustrated in Figure 3. Figure 3: Timeliness of Replacement Project Capitalization6 6 The timeliness presented here are based on the estimated project end dates recorded in the Department’s work management software. 0% 20% 40% 60% 80% Less than 3 Months Less than 6 Months Less than 9 Months Less than 1 Year Greater than 1 YearPercent of Projects ReviewedTime from Replacement to Closure Request Time from Closure Request to Capitalization 23 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 16 o There are currently no guidelines to define how long it should take after the water line replacement is complete before requesting the project be closed. • In general, it took the Finance Department less than three months to capitalize water projects after receiving a closure request as illustrated in Figure 3. o According to the Finance Department, sometimes capitalization may be delayed due to a higher number of transactions involved in closing the project or because additional capitalization information may be needed from the Department. • According to Finance’s Budget Division staff, they generally discuss project closures with the Water Department as part of the preparation for the quarterly capital improvement project department presentation; however, Finance’s Accounting Division, which is responsible for closing and capitalizing infrastructure projects, has not typically been included in these meetings. The Accounting Division has developed a formal Project Closure Request Form that must be submitted to initiate the closure and capitalization process. • Of the 15 capitalized projects, nine projects valued at around $2.5 million had not been capitalized by the end of the applicable fiscal year. o It should be noted that the City does not lose depreciation benefits if expenses incurred under the project were not capitalized in the in the fiscal year. In addition, project costs not yet capitalized are included as construction work in progress in the City’s financial statements. o Furthermore, the City of Denton’s independent auditor’s report on the comprehensive annual financial report for fiscal years 2017-18, 2018-19, and 2019-20 did not identify any material misstatements. Why It Matters Timely capitalization of capital projects is crucial for effective record keeping per government accounting standards. Based on discussions with Finance and Water Department staff, most delays appear to be due to coordination issues between the Water and Finance Departments during the closure and capitalization process. Similarly, without guidelines for how quickly project closure should be requested after the water line is replaced, the capitalization process may be delayed as project managers shift their focus to other active projects while restoration work is being completed and paid. 24 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 17 Recommendations: 7. Streamline the communication process for the closure and capitalization of water distribution projects between the Water and Finance Departments. Water Department Comments: Water Utilities staff will work with Finance staff to develop and implement a process for streamlining the closure and capitalization of the replaced water assets. Finance Department Comments: The Finance Department is now utilizing Smartsheet software for tracking project maintenance requests. This includes project set up, project funding, project closure, and fixed asset capitalization in JDE. Finance maintains a database of all completed requests and will be implementing a process to communicate with departments monthly regarding job status. 8. Establish guidelines for how quickly a replacement project closure request should be submitted to Finance after completing construction. While not all projects may meet this guidance due to delays, guidance will help ensure projects are closed as quickly as possible. Water Department Comments: Water Utilities will work with Finance staff on developing guidelines for closing a project in a timely manner. Leak Repair Timeliness Can’t Be Determined Due to Data Limitations, Lack of Parameters The bulk of minor maintenance activities include water line leak repairs. During the past three years, about 800 work orders relating to water main break and service line repairs were created and completed. The leak repair process is briefly outlined in Figure 4. Figure 4: Minor Maintenance Process 25 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 18 In order to ensure that reported leak incidents are timely completed, there should be parameters around how quickly water leak repairs are completed after being reported that are tied to the type and urgency of each work order. What We Found • Water leak incidents are generally reported by Denton Residents to City staff via phone calls or through the City's 'EngageDenton’ web portal. According to Water Department staff, a work order should be created for all reported leaks in order to tracked and manage work; however based on a review of a statistical sample of 262 work orders, it is unclear how quickly after a leak is reported it is repaired. o Based on a review of work order creation dates to repair completion dates, almost one fourth of work orders are created after the repair is complete as shown in Figure 5, indicating that the work order was not created on the same day that the leak was reported. Figure 5: Time Between Repair Completion and Work Order Creation •Report Water Leak Incident via Phone or Engage Denton Denton Resident •Create Work Order Cus. Ser. / Water/ Utility Disp. Dep.•Water Crews Complete Leak Repair •Supervisor Verifies Work Order •Admin. Asst Closes Work Order Water Department Repair Completed Before 24% Repair Completed on Same Day 45% < 3 Days 11% > 3 Days 20% 26 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 19 o According to Water Department staff, leak repair requests are generally completed as quickly as possible on a first-come, first-serve basis. Formal parameters for how quickly leak repair work orders should be created and completed after being reported have not been established. • Based on review of a statistical sample of 262 work orders created from 2018 to 2021, water leaks generally only take one day to repair after work is begun. o Leak repairs for 74 percent of work orders were completed on the same day the crew started repairing the leak and another 23 percent were completed within seven days. • Similarly, guidelines for categorizing repair work as general or emergency have not been defined. Instead, work orders are automatically categorized by the work order system depending on the nature of work selected. o About 93 percent of reviewed leak repair work orders were categorized as emergencies. According to Water Department staff, emergency work orders for repairing major leaks are completed as soon as possible; however, as previously discussed, due to data issues, it is difficult to tell how quickly after being reported these leaks were repaired. • Water Department staff do not have a process to proactively identify leaks in the water distribution system. o According to Denton’s 2019 Water Loss Audit,7 real losses (i.e. from line breaks or leaks) accounted for about 9 percent of water produced. In addition, the Audit calculated that Denton’s water system had an infrastructure leakage index8 of 2.13, which is within the appropriate target range for the City based on American Water Works Association guidance. Why It Matters Establishing parameters for when leak repair work orders should be created and completed would help staff prioritize repair work and further minimize the City’s real water losses. It would also help regulate the time taken in restoration work and permit inspections, benefiting the residents. 7 The Water Loss Audit is generally completed each year by Water Department staff. Results for this Audit were not independently verified as part of this audit. 8 The infrastructure leakage index is a ratio of estimated unavoidable real losses based on the water system’s design to calculated real losses. For example, an index of three would mean real losses are three times higher than unavoidable real losses. 27 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 20 Additionally, establishing criteria for general and emergency work orders would help staff assign and complete work orders by priority according to the nature and urgency of the repair work. Recommendations: 9. Establish parameters for how quickly leak repair work orders should be created and completed. Water Department Comments: Water Utilities will work on developing an appropriate level of service plan that will establish the parameters and timeframes for minor maintenance activities. 10. Define criteria for general and emergency work orders to help further prioritize repairs. Water Department Comments: Water Utilities will work on developing criteria for defining general and emergency work orders to help prioritize repairs. Additional Guidance Would Improve Compliance with Established Practices and Requirements for Minor Maintenance In order to be a work order system effective, work orders should contain complete information about the job performed for review. What We Found • Performing a leak repair includes various activities such as obtaining a right of way permit, calling a utility line locate9 and arranging street restoration work. As per the work order approval process followed, once the water crew completes the work order, a Field Service Supervisor reviews the work order to verify the job completed. • Based on a review of sample 262 work orders, it was observed that support documentation for leak repair activities is not consistently attached with work orders. o About 11 percent of work orders did not have any pictures of the job site or work performed. Job site pictures are essential to verify that completed work is adequate before the supervisor closes the work order as they are not always onsite. o Right of way permit details are not available in the work order system for about 25 percent of work orders. The Water Department has 9 The Texas One-Call law requires everyone digging 16 inches or deeper at any site using mechanical equipment to call 811 Line Locate at least two working days before beginning excavation. 28 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 21 recently started recording and tracking the right of way permit based on work order number. o About 47 percent of work orders did not have documentation indicating that a utility line locate call was made. o About 32 percent of work orders did not have attached documentation showing that contracted right of way restoration had been paid. Based on a review of ten randomly selected work orders, the invoices were paid according to the contracts executed with the contractors. • The Water Department has developed standard operating procedures for performing minor maintenance activities that contain guidance and instructions, including the steps, job procedures, and safety guidelines; however, standard operating procedures for creating and completing work orders for minor maintenance activities are in draft form and have not yet been implemented. Additionally, these draft procedures do not contain guidance on: o Staff responsible for creation and closure of work order in the work order system; o Documentation to be attached to each work order such as number and type of pictures, right of way permit information, and restoration work invoices; and o Steps and requirements for calling for a utility line locate. Why It Matters Supporting documents attached to leak repair work orders provide assurance that the repair was completed following the City's established practices and statutory requirements. Without a copy of the right of way permit or permit number or a reference number for the utility line locate, it is difficult to determine if leak repairs followed State and City regulations around construction work in the right of way. In addition, attaching all records relating to restoration work to each work order would act as a repository for the Water Department staff for future reference and tracking for timely completion and payment. Finally, adopting formal standard operating procedure that incorporate the requirements mentioned earlier would provide the Water Department staff with institutional knowledge, facilitate consistency, help navigate emergency situations and provide further clarity on water maintenance work and responsibilities. 29 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 22 Recommendation: 11. Finalize and implement draft standard operating procedures for creating work order and documenting minor maintenance activities. Procedures should cover staff responsible for creating, approving, and closing work orders, information about utility line locates, and details of work order supporting documentation attachments. Water Department Comments: Water Utilities will develop and implement standard operating procedures for creating work orders and properly documenting the minor maintenance activities in Cityworks. Safety Assurance Activities Generally Seem Effective Best practices recommend that water utilities have a safety program based on a 'Job Safety Analysis.' According to Occupational Health and Safety Standards, job safety analysis means studying and recording steps and hazards involved in a job and determining the best ways to perform the job to reduce or eliminate these hazards. Therefore, a job safety manual or standards based on job safety analysis as part of the safety program would help the Water Department staff understand and follow the safety measures and standards observed in the water distribution maintenance projects. What We Found • The Water Department staff regularly attends safety training organized by the Safety Department. The Safety Department has determined training needs based on the job requirements and the risks involved in water distribution maintenance projects. o As part of the Safety Department’s initiatives, a safety committee consisting of Water and Safety Department staff has been formed that meets monthly to discuss safety concerns, procedures, and initiatives. o The Safety Department staff also regularly meets with Water Department staff to discuss any safety concerns and get feedback. • Safety on water distribution project job sites is monitored through safety inspections carried out by the Safety Department. o The assigned Safety Manager conducts weekly safety inspections at water distribution project job sites to verify that work is appropriately carried out to ensure the safety of water crews and residents. 30 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 23 o Safety inspections are conducted using an inspection checklist. The results of these inspections are generally discussed with the site crew and supervisor onsite. o Results of inspections are recorded in the City’s collaborative work management software, along with the discrepancies observed, and corrective measures are taken. • A job site safety practices and standards manual has not been developed to aid water crews in complying with the safety checklist. o The Safety Department is in the process of developing policies and procedures to ensure safety in the City's operations. o The safety inspections checklist created by Safety Department staff appears to be in line with the activities undertaken in the water distribution maintenance projects. Why It Matters Education and specialized safety training are important tools for making construction crews aware of the hazards and safety procedures involved in their jobs. If any safety incident happens at a job site, it may result in injury to City staff and financial losses, and project delays. The Safety Department provides knowledge and education to water crews through safety training and safety inspection feedback. However, without a construction project safety manual, water crew members may not know what safety standards they are required to follow to reduce job site hazards and avoid injury and loss. A comprehensive safety manual describing the safety standards and procedures would help provide clear guidance to water crews on how to adhere to the safety measures incorporated in the compliance checklist utilized by the Safety Department staff for water distribution maintenance projects safety inspections. Recommendation: 12. Develop a water distribution maintenance projects safety manual in consultation with Safety Department for water crews’ guidance. The manual should for based on job safety analyses to reduce job site hazards and avoid injury and loss. Water Department Comments: Water Utilities will work with Safety staff on developing a safety manual for water distribution maintenance projects. 31 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 24 Safety Department Comments: The Safety Department will work with Water Utilities to develop a safety manual that defines safe work practices and standards to be used during work activities. 32 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 25 Appendix A: Management Response Summary The following summarizes the recommendations issued throughout this report. The auditors found that staff and the Department were receptive and willing to make improvements where needed. Management has provided their response to each recommendation. 1 Develop and adopt a formal, comprehensive asset management plan, including the annual asset replacement planning considerations and strategic and financial planning objectives. Concur Expected Completion: Dec 2022 Water Department Comments: There is an asset management program (Software) that the City currently uses to develop a list of annual asset replacement projects. This program does not include strategic and financial planning. Water Utilities staff will develop and adopt a comprehensive asset management plan that includes strategic goals and financial planning objectives to guide the long-term maintenance plan. Responsibility: Water Utilities 2 Instruct Water Department staff to execute and maintain project documents for the steps and activities prescribed under the capital improvement process guide. Concur Expected Completion: September 2021 Water Department Comments: Water Utilities staff is currently working on implementing Procore (software) to manage the in-house asset replacement projects. Once implemented, project documents, review’s, approvals, walkthrough, etc. can be documented and stored at a central location for easy access in the future. Responsibility: Water Utilities 3 Clarify if the Water Department is required to obtain right of way permits for its small water line replacement projects by consulting with the Public Works Inspections Division and the City Attorney’s Office. Concur Expected Completion: September 2021 Water Department Comments: Water Utilities staff will consult with Public Works staff and the City Attorney’s office to determine a path forward on the right-of-way permit requirement for replacing water infrastructure. Responsibility: Water Utilities 4 Document and track formal approval from the Streets Division to perform water Concur Expected Completion: September 2021 33 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 26 distribution projects on water lines under moratorium streets. Water Department Comments: Water Utilities staff is currently working on implementing Procore (software) to manage the in-house asset replacement projects. Once implemented, the clearance of streets under moratorium can be obtained from the Streets department through the RFI process in the software. Responsibility: Water Utilities 5 Consider implementing a reconciliation process to verify and confirm that the materials obtained were used for the correct project and recorded in the work order system and to ensure that any unused material is accurately reported to Warehouse and returned. Concur Expected Completion: July 2022 Water Department Comments: Water Utilities will develop and implement a process to confirm that the material checked out from the warehouse is tracked and allocated to the appropriate project. Responsibility: Water Utilities 6 Evaluate opportunities to streamline the process of recording and allocating water crew labor hours to projects. Concur Expected Completion: July 2022 Water Department Comments: Water Utilities staff will work on evaluating opportunities for streamlining the allocation of labor hours to the appropriate replacement project. Responsibility: Water Utilities 7 Streamline the communication process for the closure and capitalization of water distribution projects between the Water and Finance Departments. Concur Expected Completion: City Wide – January 2022 Water Department Comments: Water Utilities staff will work with Finance staff to develop and implement a process for streamlining the closure and capitalization of the replaced water assets. Finance Department Comments: The Finance Department is now utilizing Smartsheet software for tracking project maintenance requests. This includes project set up, project funding, project closure, and fixed asset capitalization in JDE. Finance maintains a database of all completed requests and will be implementing a process to communicate with departments monthly regarding job status. Responsibility: Water Utilities and Finance 8 Establish guidelines for how quickly a replacement project closure request Concur Expected Completion: January 2022 34 Audit of Water System Operations: Distribution July 2021 Audit Project #: 021 P a g e | 27 should be submitted to Finance after completing construction. Water Department Comments: Water Utilities will work with Finance staff on developing guidelines for closing a project in a timely manner. Responsibility: Water Utilities 9 Establish parameters for how quickly leak repair work orders should be created and completed. Concur Expected Completion: July 2022 Water Department Comments: Water Utilities will work on developing an appropriate level of service plan that will establish the parameters and timeframes for minor maintenance activities. Responsibility: Water Utilities 10 Define criteria for general and emergency work orders to help further prioritize repairs. Concur Expected Completion: January 2022 Water Department Comments: Water Utilities will work on developing criteria for defining general and emergency work orders to help prioritize repairs. Responsibility: Water Utilities 11 Finalize and implement draft standard operating procedures for creating work orders and documenting minor maintenance activities. Concur Expected Completion: January 2022 Water Department Comments: Water Utilities will develop and implement standard operating procedures for creating work orders and properly documenting the minor maintenance activities in Cityworks. Responsibility: Water Utilities 12 Develop a water distribution maintenance projects safety manual in consultation with Safety Department for water crews’ guidance. Concur Expected Completion: July 2022 Water Department Comments: Water Utilities will work with Safety staff on developing a safety manual for water distribution maintenance projects. Safety Department Comments: The Safety Department will work with Water Utilities to develop a safety manual that defines safe work practices and standards to be used during work activities. Responsibility: Water Utilities and Safety 35 Audit of Water System Operations: Distribution Madison Rorschach City Auditor Internal Audit Department July 27, 2021 136 Purpose of the Audit 2 •Audit evaluated water distribution maintenance activities, including: •Small water line replacement; and •Water line leak repairs. •Water lines must be adequately maintained, replaced, & repaired to minimize losses & ensure continual service. Water Distribution Maintenance Activities Major Maintenance In-house replacement of six to 12 inch water distribution lines Minor Maintenance Water line and fire hydrant break repairs, water main and service taps, valve repair ID 21-982 37 3 •Current asset management program generally aligns with best practices; however, long-term financial or strategic goals are not defined. •Safety assurance activities including training, meetings, and site inspections, for water distribution projects generally seem effective. •Development of a comprehensive safety manual would provide clear guidance to staff on safety standards. Additional Formal Guidance would Improve Operations ID 21-982 38 4 Water Line Replacement Project Critical Steps•Small water line replacement project process follows best practices. •Some project step docs. missing including: •30-60-90 design documents; •Walkthrough & punch list reports. •Process for checking street moratoriums & obtaining right of way permits not well defined. Some Critical Replacement Project Documentation Not Maintained ID 21-982 Plan •Field Assessments •Work Orders •Asset Management Committee Review Revise •Project Scope •Asset Management Committee Review Schedule •Moratorium Check •Assess OPCC •Design Request •Project Construction Schedule Design •30-60-90 Design Process •Finalized Design Construct •Material List •Call Line Locate •Traffic Planning Record •Walkthrough and Punch List Items •Bacteriological Reports •Request Capitalization 39 5 •Practices to record project material costs don’t completely ensure all collected materials are used for each project. •Project labor hours are not effectively reconciled between Water’s work order system and the City’s timekeeping system by Water staff, which may lead to inaccurate project cost allocation. •Capitalization of project infrastructure may be delayed due to interdepartmental coordination issues & lack of project closure guidance for Water project managers. Replacement Project Administrative Practices Not Entirely Effective ID 21-982 40 6 Time Between Repair Completion & WO Creation•No formal guidelines have been developed for how quickly leaks should be repaired or how repairs should be prioritized. •Data limitations hinder determination of leak repair timeliness. Leak Repair Timeliness Can’t be Determined due to Data Limitations, Lack of Parameters ID 21-982 Repair Completed Before 24%Repair Completed on Same Day 45% < 3 Days 11% > 3 Days 20% •The Department has developed some standard operating procedures; however, they do not address the work order creation & closure process, work order supporting documentation, or utility line locate steps. 41 7 Management Response Summary Rec.Recommendations*Response Implementation Actions* 1 Adopt a formal asset management plan.Concur Will develop & adopt a comprehensive asset management plan. 2 Execute and maintain critical replacement project documents.Concur In process of implementing a project management software. 3 Clarify if Water must obtain ROW permits for replacement projects.Concur Will consult with Public Works & Legal staff. 4 Document formal approval from Streets to perform projects on moratorium streets.Concur In process of implementing a project management software, which will be able to track clearance of street moratoriums. 5 Consider implementing a reconciliation process for project materials.Concur Will develop process to confirm materials are allocated to the appropriate project. 6 Evaluate opportunities to streamline the recording of water crew labor hours.Concur Will evaluate opportunities to streamline allocation of labor. 7 Streamline the communication process for closing & capitalizing water projects.Concur Will work with Finance to streamline closure & capitalization of assets. 8 Establish guidelines for how quickly replacement projects should be closed.Concur Will work with Finance to develop guidelines for closing projects timely. 9 Define criteria for general & emergency work orders.Concur Will develop criteria to define general & emergency work orders. 10 Establish parameters for how quickly minor maintenance work orders should be created & completed.Concur Will develop level of service plan that establishes parameters & timeframes for minor maintenance activities. 11 Implement standard operating procedures.Concur Will develop SOPs for creating & documenting minor maintenance. 12 Develop a water distribution maintenance project safety manual.Concur Will work with Safety to develop safety manual. *Detailed recommendations and implementation actions can be seen in the full audit report. ID 21-982 42 Questions? 8 Madison Rorschach City Auditor Internal Audit Department ID 21-982 43 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-456,Version:1 AGENDA CAPTION Receive a report, hold a discussion, and give staff direction regarding FY 2021-22 departmental budget presentations for Fleet, Capital Projects/Engineering, Development Services/Real Estate, Solid Waste, Water, Wastewater/Drainage, Environmental Services and Streets. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™44 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Finance ACM/CFO: David Gaines DATE: July 27, 2021 SUBJECT Receive a report, hold a discussion, and give staff direction regarding FY 2021-22 departmental budget presentations for Fleet, Capital Projects/Engineering, Development Services/Real Estate, Solid Waste, Water, Wastewater/Drainage, Environmental Services and Streets. BACKGROUND The purpose of this work session and the work sessions scheduled through June and July 2021 is to have each City Department give a brief presentation to City Council. Each presentation will cover the prior year accomplishments, future goals, supplemental package requests, if applicable, and the proposed FY 2021-22 Budget. The planned presentations for this meeting are from Fleet, Capital Projects/Engineering, Development Services/Real Estate, Solid Waste, Water, Wastewater/Drainage, Environmental Services and Streets. The City Manager’s proposed budget is scheduled to be presented to City Council on August 2, 2021. The department presentations are attached to this item. EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Fleet Presentation Exhibit 3 – Capital Projects/Engineering Presentation Exhibit 4 – Environmental Services Presentation Exhibit 5 – Streets Presentation Exhibit 6 – Development Services/Real Estate Presentation Exhibit 7 – Solid Waste Presentation Exhibit 8 – Solid Waste Rate Presentation Exhibit 9 – Water Presentation Exhibit 10 – Water Rate Presentation Exhibit 11 – Wastewater Presentation Exhibit 12 – Water Rate Audit Follow-up Memo Respectfully submitted: Cassandra Ogden (940) 349-7195 Director of Finance Prepared by: Nick Vincent; Assistant Finance Director 940-349-8063 City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 45 FY 2021-22 Budget Presentation Fleet Services Department July 27, 2021 ID21-456 46 Fleet ServicesOrganizational Chart 2 General Manager of Public Works Fleet Superintendent Administrative Supervisor Fleet Administrator Administrative Assistant IV Fleet Supervisor Assistant Fleet Supervisor 2nd Shift Technicians -4 Assistant Fleet Supervisor Solid Waste Technicians -5 Emergency Vehicle Supervisor/Technician -1 Emergency Vehicle Technicians -2 Fleet Technicians -7 Contracted Parts NAPA –4 July 27, 2021 ID21-456 47 Fleet ServicesFTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 Fleet 820100 26 26 26 3July 27, 2021 ID21-456 48 Budget Overview 4July 27, 2021 ID21-456 49 Fleet ServicesFY 2020-21 Accomplishments ▸Gained approval for Fleet Services shop expansion ▸Implemented COVID safety protocols for on-site staff ▸Disinfected over 400 fleet vehicles ▸Sustained normal operations throughout winter event ▸Installed GPS systems on all new fleet vehicles ▸Added vehicle procurement and repair contracts 5July 27, 2021 ID21-456 50 Fleet ServicesFY 2021-22 Goals ▸Improve Fleet response and repair turn-around time ▸Improve vehicle & equipment repair processes ▸12 bay Fleet Services shop expansion ▸6 bay Fleet Services (Landfill) shop construction ▸Expand vehicle sharing program & utilization ▸Upgrade current diagnostic hardware and software ▸Complete fueling infrastructure mandates -TCEQ 6July 27, 2021 ID21-456 51 Budget Highlights 7July 27, 2021 ID21-456 52 8 Fleet Sevices Budget Highlights Revenues FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Fuel Sales (Internal)$1,728,038 $2,076,200 $2,013,900 $3,007,900 Fuel Sales (External)580,000 580,000 580,000 824,000 Parts & Maintenance 6,650,324 6,890,000 6,974,668 7,085,108 Fleet Rental 20,675 30,000 30,070 20,000 Sublet Repair 1,190,220 1,250,000 1,252,929 1,375,000 Miscellaneous 136,004 10,000 10,023 10,000 Interest 4,747 5,000 5,012 4,700 Uses of Reserves 113,928 --- Total $10,423,936 $10,841,200 $10,866,602 $12,326,708 July 27, 2021 ID21-456 53 9 Fleet Services Budget Highlights Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Personnel Services $2,521,878 $2,469,692 $2,568,000 $2,604,907 Materials and shop supplies 109,069 99,100 100,000 124,600 Fuel (Internal)1,756,120 2,076,200 2,013,900 3,007,900 Fuel (External)580,000 580,000 580,000 824,000 Maintenance 26,463 70,000 70,000 90,000 Insurance 40,929 47,084 47,000 48,497 Miscellaneous Expense ---1,105 Operations 4,760,652 4,730,980 4,730,080 4,747,930 Cost of Service 628,825 757,622 757,622 877,769 Total $10,423,936 $10,830,678 $10,866,602 $12,326,708 July 27, 2021 ID21-456 54 Questions? 10July 27, 2021 ID21-456 55 FY 2021-22 Budget Presentation Capital Projects/EngineeringDepartment ID#21-455, July 27, 2021 56 Presentation Team 2 Rebecca Diviney, PE City Engineer Director of Capital Projects Rachel Wood Deputy Director of Capital Projects Trevor Crain Public Works Inspections Manager ID#21-455, July 27, 2021 57 Capital Projects/EngineeringOrganizational Chart 3ID#21-455, July 27, 2021 Development Review Engineering Services Real Estate Engineering Design Capital Project Delivery Public Works Inspection 58 Capital Projects/EngineeringOrganizational Chart 4 Key Hires: Trevor Crain: Public Works Inspections Manager Nathan George: Senior Planner –Bicycle, Pedestrian ADA ID#21-455, July 27, 2021 *Includes Floodplain Administrator (reports to Deputy City Engineer) **Includes Senior Planner –Bicycle, Pedestrian, ADA Coordinator (reports to Deputy City Engineer) 59 Budget Overview 5ID#21-455, July 27, 2021 60 Capital Projects/EngineeringFY 2020-21 Accomplishments▸New Construction Specifications and Standard Details for City Construction Projects Effective January 15, 2021 ▸Implementation of Alternative Delivery Methods –Construction Manager at Risk (Southeast Denton Phase II is the first project using this methodology) ▸External Review of Estimates at Completion –Outside consultant is reviewing active construction projects to improve the accuracy of project cost estimates ▸Procore -Project Management Software Implementation underway with a goal to have system fully operational by October 2021 ▸Implementation of new Cross-Departmental Change Board to enhance the level of internal review for proposed design amendments and contract change orders ▸Enhanced Stakeholder Engagement: ▹Increased volume of community meetings and website enhancements such as Discuss Denton and the new Interactive CIP Map ▹Recurring Stakeholder Meetings Established :•Internal Stakeholders: Finance, Purchasing, Real Estate, Fire, Parks, DME, Water and Wastewater Utilities, Streets, Drainage, Traffic Operations •External Stakeholders: TXDOT, UNT, TWU, DISD, NCTCOG 6ID#21-455, July 27, 2021 61 Capital Projects/EngineeringFY 2021-22 Goals ▸Development of Comprehensive Five-Year Capital Improvement Program ▸Enhanced Focus on Bicycle and Pedestrian Mobility and Improved Integration with Existing Capital Projects ▸Finalize Schedule and Implementation Plan for the 2019 Street Reconstruction Bond Program ▸Finalize Project Management Manual Completion and Organization-wide Training ▸Right-of-Way Permitting Process Automation ▸Utility Coordinator Position Hired and Improved Project Coordination with Franchise and Internal Utilities ▸Construction Specifications and Standard Details Implemented for Private Development Projects ▸Significant Completion of the 2012 and 2014 Bond Program, Currently Projecting December 2022 Completion 7ID#21-455, July 27, 2021 62 Budget Highlights 8ID#21-455, July 27, 2021 63 9 ENGINEERING 5 Year Forecast ID#21-455, July 27, 2021 64 ENGINEERINGFTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 840001 Engineering Administration -4 4 840100 Capital Projects Division 22 17 9 840200 Public Works Inspections Division 14 14 15 840300 Development Review 2 -- 840400 Real Estate 6 6 6 840500 Engineering Division 6 5 12 Total 50 46 46 10ID#21-455, July 27, 2021 65 Questions? 11ID#21-455, July 27, 2021 66 FY 2021-22 Budget Presentation Environmental Services ID21-456, July 27, 2021 67 Budget Overview 2ID21-456, July 27, 2021 68 Org Chart Env Servs & Sustainability Dir Vacant Sustainability Mgr. K. Barnett Admin Asst. 1 O. Smith Sustainability Coord. R. Siebert Conservation Prog. Coord. J. Douglas Sustainability Intern (.5) Waste Reduction Prog Coord. Residential J. Amador Waste Reduction Prog. Coord. Schools Vacant Recycling Interns (1) Env. Servs Assist. Dir D.Viera Watershed Protection Mgr J. Dailey Watershed Protection Coord Z. Peterson Stormwater Specialist Z. Rowen Stormwater Inspector A. Landers Stormwater Inspector A. Parsons Interns (4) Laboratory Mgr F. Schwalm Microbiologist A. Barker LIMS Specialist T. Burton Senior Chemist J. Gomez Wet Chemist G. Meeker Qual Control Supr M. Diosdado Lab Tech C. Hastings Lab Tech C. Phillips Lab Tech D. Such Industrial Pretreatment J. Wilson Pretreat. Spec. II R. Celan Pretreat. Spec. I M. Davidson Pretreat. Spec. I S. Robertson Pollution Prevention Supr E. Garcia Env. Monitoring Tech. Vacant Env. Monitoring Tech P. Tay Transportation Permit Spec S. White Gas Well Inspections Env. Compl Coord C. Upton Landfill Compliance ID21-456, July 27, 2021 69 FTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 Sustainability*-5.5 4.5 Watershed Protection 8 8 9 Laboratory 9 9 9 Industrial Pretreatment 7.5 7.5 7.5 Public Outreach 3 3 3 Total 27.5 33 33 4 •New FTEs 1 FTE Stormwater Inspector in Watershed Protection *New HBU 20-21, 1 FTE transferred to Parks with Clear Creek 21-22 ID21-456, July 27, 2021 70 FY 2020-21 Accomplishments 5 Sustainability •Adopted Simply Sustainable Framework •Established Sustainability Framework Implementation Advisory Committee •2019 Community Greenhouse Gas Emissions reduced 36.5% compared to 2006 baseline •Modified SW&R community and school engagement (COVID- 19) •Apartment Recycling Audit and Education Program •Comprehensive Solid Waste Management Strategy Environmental Services •Approval of TCEQ Industrial Pretreatment Streamlining Permit •Obtained grant for abating illegal dumping •Updated the Mosquito Surveillance Response Plan ID21-456, July 27, 2021 71 FY 2021-22 Goals 6 Sustainability •Implementation of Sustainability Framework •Assess Community Hazards and Vulnerabilities •Municipal and Community Resiliency Planning •Greenhouse Gas Mitigation Planning and Air Quality Attainment strategies •Reduce Recycling Contamination •Expand Residential Community Engagement (post COVID-19) •Increase efforts with Denton ISD to reduce recycling contamination Environmental Services •Expanding offer of environmental programs. •Full implementation of the Laboratory Information Management System (LIMS) for integrating online results reporting with all municipal lab customers. •Work with Solid Waste to obtain TCEQ final approval for the permit amendment replacing the current landfill municipal solid waste permit. •Continue using outside contracting services to complete enhanced gas well inspections, greatly increasing monitoring and inspection capabilities at a cost substantially below estimated costs to perform these inspections in house. •Continue cross-training between Watershed Protection, Industrial Pretreatment, and Gas Well Inspections staff.ID21-456, July 27, 2021 72 Budget Highlights 7ID21-456, July 27, 2021 73 8 Environmental Services Expense Detail By Division Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Sustainability -883,592 883,592 793,490 Industrial Pretreatment 743,932 823,762 823,762 823,854 Watershed Protection 961,154 1,034,605 1,034,605 1,033,633 Laboratory 1,051,678 1,181,671 1,181,671 1,214,784 Public Outreach 143,631 307,921 307,921 322,855 Total $2,900,395 $3,961,551 $3,961,551 $4,188,616 *New HBU 20-21, 1 FTE transferred to Parks with Clear Creek 21-22 ID21-456, July 27, 2021 74 Budget Requests 9ID21-456, July 27, 2021 75 10 Supplemental Package Summary Package Title Requested By One-time Cost Recurring Cost FY 2021-22 Total New FTE Notes Stormwater Inspector Watershed -$79,105 $79,105 1 Meet 3-week Inspection Goals Total -$79,105 $79,105 1 ID21-456, July 27, 2021 76 Questions? 11ID21-456, July 27, 2021 77 FY 2021-22 Budget Presentation Streets Department ID#21-456, July 27, 2021 78 Street DepartmentOrganizational Chart 2 Deputy Director of Operations Danny Kremer Major Maintenance Street Operations Manager Robbin Webber Major Maintenance 4 Crew Members Major Maintenance 4 Crew Members Major Maintenance 5 Crew Members Minor Maintenance Field Service Supervisor Rogelio San Miguel Maintenance 5 Crew Members Maintenance 5 Crew Members Maintenance/ Citizen Request 4 Crew Members ID#21-456, July 27, 2021 79 StreetsFTE Summary FTEs FY 19-20 FY 20-21 FY 21-22* 285801 Street Improvement Fund 43 39 40 Total 43 39 40 3 •1 new FTE requested for FY 21-22 Field Service Supervisor *Includes (1) requested supplemental FTE ID#21-456, July 27, 2021 80 4 STREETS Supplemental Package Summary Package Title Ranking One-time Cost Recurring Cost FY 2021-22 Total New FTE Field Service Supervisor 1 -72,056 72,056 1 Total -72,056 72,056 1 ID#21-456, July 27, 2021 81 5 Street DepartmentFY 2020-21 Accomplishments ▸Reviewed, updated, and rebid maintenance contracts for crack seal, micro seal and asphalt overlay ▸Community Responsiveness Improvements ▹Decreased overall response time by 1.6 days to an average of 4 days per request ▹Requests increased by 28% from 239 in FY 19-20 to 545 YTD ▸Completion of citywide Pavement study ▹Overall Condition Index (OCI) of the city network increased from 64 to 68 ▹Backlog decreased to 14%ID#21-456, July 27, 2021 82 6 Street DepartmentFY 2021-22 Goals ▸Using asset management software and pavement assessment data to formalize a 5-year maintenance plan by performing maintenance at the correct intervals. ▸Enhance asset and performance data visualization using asset management software and Scenario Builder ▸Continue improved coordination between Streets, Utilities, and Capital Projects ID#21-456, July 27, 2021 83 7 Streets 5 Year Forecast FY 2019-20 Actual FY 2020-21 Adopted FY 2020-21 Estimate FY 2021-22 Preliminary FY 2022-23 Projected FY 2023-2024 Projected FY 2024-25 Projected FY 2025-2026 Projected Beginning Fund Balance $ 3,441,734 $ 4,503,638 $ 4,503,638 $ 3,928,623 $ 3,703,506 $ 3,405,075 $ 3,151,319 $ 2,882,925 Revenues Bond Sale Savings 1,323,205 1,243,811 1,243,811 1,306,002 1,320,078 1,468,519 1,577,980 1,655,517 Interest Income & Misc.69,958 45,000 41,000 42,000 42,840 43,697 44,571 45,462 Street Cuts 369,549 378,851 33,164 33,827 34,504 35,194 35,898 36,616 Franchise Fees 13,306,582 13,634,688 13,634,688 14,216,773 14,809,633 15,413,777 16,029,722 16,658,005 Total Revenues 15,069,294 15,302,350 14,952,663 15,598,602 16,207,055 16,961,187 17,688,171 18,395,600 Use Of Reserves -591,407 575,015 225,117 298,431 253,756 268,394 336,262 Total Resources 15,069,294 15,893,757 15,527,678 15,823,719 16,505,486 17,214,943 17,956,565 18,731,862 Expenditures Personnel Services 3,250,039 3,313,812 3,313,812 3,548,910 3,655,377 3,765,038 3,877,989 3,994,329 Materials & Supplies 75,507 202,600 99,881 101,200 104,236 104,236 104,236 104,236 Maintenance and Repair 5,781,284 10,325,000 6,500,000 5,163,457 5,421,630 5,692,711 5,977,347 6,276,214 Insurance 97,312 87,078 87,078 89,690 92,381 95,152 98,007 100,947 Miscellaneous 3,023 7,100 4,500 7,100 7,100 7,100 7,100 7,100 Operations 653,012 1,008,847 748,087 810,047 834,348 859,379 885,160 911,715 Debt Service 128,125 128,125 128,125 ----- Transfers -Cost of Service 1,134,573 821,195 821,195 903,315 930,414 958,326 987,076 1,016,688 Streets Reconstruction Program 2,884,515 -3,825,000 5,200,000 5,460,000 5,733,000 6,019,650 6,320,633 Total Expenditures 14,007,390 15,893,757 15,527,678 15,823,719 16,505,486 17,214,943 17,956,565 18,731,862 - Ending Fund Balance 4,503,638 3,912,231 3,928,623 3,703,506 3,405,075 3,151,319 2,882,925 2,546,663 ID#21-456, July 27, 2021 84 Streets Improvement Fund 8 Established per Ordinance 2011-154, Ordinance 2013-219 Effective October 1, 2012 Purpose of the Street Improvement Fund was to create dedicated revenue for street maintenance and improvement activities from: •Dedicated portion of Franchise Fees (current year 77%) •Interest income •Interest savings from Utilities for issuing Certificates of Obligation instead of Revenue Bonds Maintenance –Patching, crack seal, micro-surfacing, panel replacements Rehabilitation –Base repairs and reconstruction Current practice is to use excess funding toward rehab program Formalize process current practice through ordinance Create two distinct funds: 1. Street Maintenance Fund (formerly Street Improvement Fund) 2. Streets Capital Fund -Budget workshop discussion ID#21-456, July 27, 2021 85 Recommendation –FY 21/22 9 Franchise Fee Revenue Streets General Fund 80%20% Streets Maintenance Fund Streets Capital Fund FY 2021 Franchise Fee Revenue is 77% 60%40% ID#21-456, July 27, 2021 86 Next Steps 10 August 2 –Budget Workshop including Streets Fund discussion September 14 –Budget and Tax Rate Public Hearing September 21 –Budget Adoption ID#21-456, July 27, 2021 87 Questions? 11ID#21-456, July 27, 2021 88 FY 2021-22 Budget Presentation Development Services/ Real Estate ID#21-455, July 27, 2021 89 Development Services Organizational Chart 2 Scott McDonald Director Planning Historic Preservation Long Range Planning Development Review Building Inspection Plan Review Food and Health Safety Transporation Planning Building Safety Administrative Services Development Facilitation Real Estate ID#21-456, July 27, 2021 90 Budget Overview 3ID#21-456, July 27, 2021 91 Development Services FY 2020-21 Accomplishments ▸Completed construction of the Development Service Center, the City’s “One-Stop-Shop” for Development. ▸Staff surveyed recent developers in the City to gauge satisfaction and identify areas for improvement. ▸Modified the DCRC to a standing committee for continuous improvement to the DDC. ▸Created the Discover Denton Landmarks page and started preservation media campaign. ▸Implemented a single software solution for applicants in Denton. 4ID#21-456, July 27, 2021 92 Development Services FY 2021-22 Goals ▸Complete updates to the Comprehensive Plan to guide Denton into the future and improved integration with other City master plans. ▸Adoption of the 2021 Building, Fire, and Health Codes. ▸Finalize a Development Fiscal Impact Model to provide more insight into the financial impacts of development proposals. ▸Complete future enhancements to the Land Management System to gain efficiencies and standardize work.5ID#21-456, July 27, 2021 93 Real Estate FY 2020-21 Accomplishments ▸Developed a list of Approved Appraisers to provide services for the City’s CIP projects and other public initiatives. (RFQ 7280). ▸Increased capacity to acquire land rights by establishing a list of firms to provide supplemental real estate acquisition and relocation services. (RFQ 7480). ▸Acquired over 60 land rights to date for utility easements and right of way improvement projects. ▸Reduced Mayhill Bridge project costs by returning ~$500k to the project through creative negotiations. ▸Began process to centralize the City’s Leasing program. ▸Hosted a virtual Real Estate Forum for Capital Projects Team. 6ID#21-456, July 27, 2021 94 Real Estate FY 2021-22 Goals ▸Increase collaboration with partner departments to identify and secure needed property rights. ▸Update GIS Mapping of existing City-owned assets (land, easements, leases, licenses, etc.). ▸Audit City-owned property to identify potential assets for disposition. ▸Establish Surplus Property Sale process and conduct sale by Q4 2022. ▸Host another Real Estate Forum for partner departments. 7ID#21-456, July 27, 2021 95 Performance 8ID#21-456, July 27, 2021 96 Budget Highlights 9ID#21-456, July 27, 2021 97 10 Development Services Budget Revenue FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Planning $1,211,575 $1,250,907 $1,402,242 $1,401,016 Building Safety $6,157,716 $6,949,946 $6,830,996 $7,780,580 Total $7,369,291 $8,200,853 $8,233,238 $9,181,596 ID#21-456, July 27, 2021 Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Personnel $5,443,631 $5,635,909 $5,566,950 $6,442,524 Materials & Supplies $44,893 $91,890 $19,212 $73,890 Insurance $72,615 $89,121 $89,121 $91,765 Miscellaneous $1,328 $43,181 $14,198 $43,181 Operations $686,057 $422,167 $437,512 $443,781 Transfers $549,438 $510,452 $553,951 $570,570 Debt Service $354,180 $674,969 $674,969 $674,969 Cost of Service $973,946 $1,592,827 $1,592,827 $1,640,612 Total $8,126,088 $9,060,516 $8,948,740 $9,981,292 Variance ($756,797)($859,663)($715,502)($799,696) Cost Recovery 91%91%92%92% 98 11 Real Estate Budget Highlights* Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Personnel $793,304 $811,807 $659,732 $833,124 Materials & Supplies $6,771 $18,100 $1,027 $9,900 Insurance $10,338 $9,946 $9,946 $10,244 Operations $33,269 $39,100 $7,251 $21,400 Transfers $109,435 $142,326 $142,326 $146,596 Total $953,117 $1,021,279 $820,282 $1,021,264 *HBU is part of Engineering ID#21-456, July 27, 2021 99 Development Services FTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 Planning 23 14 14 Building Inspections 32 31 31 Development Services Admin 0 10 10 Real Estate 6 6 6 Transportation Planning 2 2 2 Total 63 63 63 12ID#21-456, July 27, 2021 100 Questions? 13ID#21-456, July 27, 2021 101 FY 2021-22 Budget Presentation Solid Waste Department July 27, 2021 ID21-456 102 Solid Waste Leadership Team 2 Brian Boerner Director of Solid Waste Eugene McKinnie Deputy Director of Solid Waste Tammy Clausing Business Services Manager James Tips Administration Manager Katherine Barnett Sustainability Manager July 27, 2021 ID21-456 103 Solid WasteOrganizational Chart 3July 27, 2021 ID21-456 104 Solid Waste FTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 660001 –SW Administration 23 24 25 660100 –SW Residential 40 40 41 660200 -Commercial 27 29 31 660250 –Collection Special Projects 7 7 7 660300 –Disposal (Landfill)18 18 18 660302 –SW HCC 3 3 3 660402 –SW Public Outreach 3 3 - 660800 –SW Site Operations 2 2 3 Total 123 126*128 4 *Mid Year Adds (3) FTE’s July 27, 2021 ID21-456 105 OPERATIONAL METRICS 5July 27, 2021 ID21-456 106 SAFETY 6 35% Reduction in Accidents 60% Reduction in Injuries July 27, 2021 ID21-456 107 GROWTH RESIDENTIAL SERVICES 7July 27, 2021 ID21-456 108 GROWTH COMMERCIAL SERVICES 8 Net Growth 419 yards 71% July 27, 2021 ID21-456 109 GROWTH IN ROLL-OFF SERVICES 9 5%10%9% 13% 8% 40% 30% 0% 5% 10% 15% 20% 25% 30% 35% 40% 45% Roll Off Growth 2020 to 2021 Growth YoY YTD Growth •16% •Trending at 35% July 27, 2021 ID21-456 110 Waste Diversion 10July 27, 2021 ID21-456 111 RESIDENTIAL AND COMMERCIAL RECYCLING CONTAMINATION 11 Contaminants include: •Wet Material •Non-Program Material •Metal •Textiles •Garbage •Bagged Material July 27, 2021 ID21-456 112 Budget Overview 12July 27, 2021 ID21-456 113 Solid WasteFY 2020-21 Accomplishments ▸Continued operations during COVID slow-down/shutdown ▸Rubicon smart routing system Implementation ▸Strong Data scale house software systems acquisition ▸Landfill expansion permit 1590B process continues 13July 27, 2021 ID21-456 114 Solid WasteFY 2021-22 Goals ▸Landfill expansion permit 1590B finalization ▸Comprehensive Solid Waste Management Strategy completion ▸Strong Data scale house software system implementation ▸Recycling contamination reduction efforts ▸Fleet performance and uptime optimization ▸Moseley Rd landfill long term management plans ▸Continuous Improvements to service delivery, reduce costs, and safety 14July 27, 2021 ID21-456 115 Budget Highlights 15July 27, 2021 ID21-456 116 Financial Assumptions Revenue •2% growth forecasted in out years •Anticipate wholesale agreements ending in FY 2022-2023 •Hunter/Cole Rate Revenue included to start in 2023 Expense •Cell construction moved from FY 2022 to FY 2021 July 27, 2021 ID21-456 117 17 Solid Waste Revenue Detail Revenues FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Interest Operating $89,406 $169,000 $127,000 $58,000 Residential $4,860,556 $4,749,273 $4,618,273 $4,740,486 Residential Recycling $5,417,212 $5,100,884 $5,148,750 $5,285,001 Front /Side Load $8,907,156 $9,348,831 $9,077,605 $9,058,608 Roll Off Open Top $4,948,548 $7,170,199 $5,300,000 $5,942,393 Commercial Cart Revenues --$85,488 $87,837 Commercial Recycling $1,410,673 $998,449 $1,358,532 $1,389,027 Landfill Gate $5,019,048 $4,781,749 $5,763,018 $5,493,132 Landfill Wholesale $4,003,566 $5,621,818 $5,838,850 $6,238,067 Other Solid Waste $2,002,337 $1,651,568 $1,001,968 $1,358,973 Transfers In $222,959 $226,380 $226,099 $229,869 Total $36,881,461 $39,818,151 $38,545,583 $39,881,393 July 27, 2021 ID21-456 118 18 Solid Waste Expense By Category Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Personnel Services $10,443,976 $10,719,636 $11,085,074 $11,270,007 Materials & Supplies $182,559 $429,412 $429,412 $412,212 Maintenance and Repair $208,421 $226,516 $226,516 $226,516 Insurance $259,650 $291,624 $291,624 $295,935 Miscellaneous Expense $68,433 $74,120 $74,120 $66,320 Operations $5,676,246 $6,656,660 $5,759,659 $7,754,807 Transfers $4,372,373 $5,250,784 $5,250,784 $5,974,265 Fixed Assets $844,709 $1,126,033 $900,000 $1,126,033 Franchise Fees/ Administrative Cost $1,781,445 $1,971,139 $1,850,000 $1,911,728 Revenue Funded Capital $1,128,421 $6,380,000 $6,380,000 $40,031 Vehicle Replacement $2,437,488 $3,327,000 $3,477,000 $1,397,000 Debt Service $8,449,482 $6,968,199 $6,968,199 $5,690,617 Closure/Post Closure -$702,648 $702,648 $719,000 Supplemental Request ---$282,234 Total $35,853,204 $44,123,771 $43,395,036 $37,166,704 July 27, 2021 ID21-456 119 19 Solid Waste Expense By Division Expenditures by Division FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Solid Waste Administration $2,732,956 $3,172,905 $3,037,653 $3,334,101 Residential Collection $6,698,528 $5,860,546 $5,641,355 $5,998,965 Commercial Collection $5,732,282 $4,705,228 $4,773,454 $4,980,090 Collection Special Projects -$456,427 $433,950 $596,465 Solid Waste Disposal $4,839,647 $11,485,489 $11,282,709 $5,575,589 HCC $305,621 $492,468 $433,950 $520,657 Diversion Processing/BMR $5,687 --- Public Outreach $299,804 $307,921 $433,950 - Keep Denton Beautiful (KDB)$289,302 --- Site Operations $963,306 $980,670 $867,901 $999,627 Miscellaneous $13,986,071 $16,662,117 $16,490,114 $14,878,976 Supplemental Request ---$282,234 Total $35,853,204 $44,123,771 $43,395,036 $37,166,704 July 27, 2021 ID21-456 120 20 Soild Waste 5 Year Forcast July 27, 2021 ID21-456 121 21 CIP Budget July 27, 2021 ID21-456 122 Budget Requests 22July 27, 2021 ID21-456 123 23 Solid Waste Supplemental Package Summary Package Title One-time Cost Recurring Cost FY 2021-22 Total New FTE FSW -II Job Code GL0404 -$50,731 $50,731 1 HEO-II GL0711 -$59,134 $59,134 1 Roll-off Truck Drivers GL0722 -$59,134 $59,134 1 Field Services Supervisor GS3310 -$82,035 $82,035 1 Intern -$31,200 $31,200 1 Total -$282,234 $282,234 5 July 27, 2021 ID21-456 124 Questions? 24July 27, 2021 ID21-456 125 FY 2021-22 Solid Waste Rate Presentation Finance Department July 27, 2021; ID21-456 126 Presentation Overview •Operations and Rate Discussion Residential Commercial Landfill Outside City of Denton Rates Contract Agreements •Next Steps •Questions July 27, 2021; ID21-456 127 Operation and Rate Recommendations -Residential Proposed Rate Changes ▸Residential Refuse and Recycling Rate will not change ▸Discontinue Subscription fee and requirement to call in Yard Waste and Brush ▹Discontinue Monthly Fee $1.00 Kraft bags, $0.50 cart ■Annual Revenue decrease estimate ($80,000)▹ALL Yard Waste must be contained in a Kraft bag or cart –NO plastic bags▹Brush cut to length▹Overage volume charges automatically applied to resident▹Reduce ~600 calls per week to customer service▹Pick up everything set at the curb each week ▸Initiate “Bag outside of Cart”fee -$5.00/bag ▹Volume charges automatically applied to resident Operational Changes ▸Bulk Waste ▹Must still be called in, all material will be collected from curb ▹Bulk rates for called in material, construction waste rates for anything extra at the curb at the time of collection 3July 27, 2021; ID21-456 128 Operation and Rate Recommendations -Commercial ▸Change pricing structure for front and side load service ▹No rate increase ▹Establishes rates closer to cost of service ▹Meets billing requirements of Paradigm Software and shift to Northstar Dispatch/Billing Module ■2,700 weekly commercial dumpsters●104 dumpsters would see a decrease in monthly rates○34% Retail/Service, ○33% School, ○19% Restaurant/Bar, ○9% Multifamily, ○5% Hospital ▹Rate matrix reduced from 16 rates to 4 rates 4 Proposed Rate Changes July 27, 2021; ID21-456 129 5 Current Rates Size 1x 2x 3x 4x 5x 6x 3 CY $ 74.16 $ 148.32 $ 222.48 $ 311.52 $ 408.75 $ 515.16 4 CY $ 98.88 $ 197.76 $ 296.64 $ 415.36 $ 545.00 $ 686.88 6 CY $ 148.32 $ 296.64 $ 444.96 $ 623.04 $ 817.50 $ 1,030.32 8 CY $ 197.76 $ 395.52 $ 593.28 $ 830.72 $ 1,090.00 $ 1,373.76 Proposed Rates Size 1x 2x 3x 4x 5x 6x 3 CY $ 74.16 $ 148.32 $ 222.48 $ 296.64 $ 370.80 $ 444.96 4 CY $ 98.88 $ 197.76 $ 296.64 $ 395.52 $ 494.40 $ 593.28 6 CY $ 148.32 $ 296.64 $ 444.96 $ 593.28 $ 741.60 $ 889.92 8 CY $ 197.76 $ 395.52 $ 593.28 $ 791.04 $ 988.80 $ 1,186.56 $ Change Size 1x 2x 3x 4x 5x 6x 3 CY $ -$ -$ -$ (14.88)$ (37.95)$ (70.20) 4 CY $ -$ -$ -$ (19.84)$ (50.60)$ (93.60) 6 CY $ -$ -$ -$ (29.76)$ (75.90)$ (140.40) 8 CY $ -$ -$ -$ (39.68)$ (101.20)$ (187.20) Front Load & Side Load Refuse Service Rates •Currently, an inconsistent multiplier is used for frequency >= 4X •Example: $74.16 X 3 = $222.48 $74.16 X 4 = $296.64 July 27, 2021; ID21-456 130 6 Front Load & Side Load Recycling Service Rates Current Size 1x 2x 3x 4x 5x 6x 3 CY $ 63.78 $ 127.56 $ 191.33 $ 267.91 $ 351.53 $ 443.04 4 CY $ 85.04 $ 170.07 $ 255.11 $ 357.21 $ 468.70 $ 590.72 6 CY $ 127.56 $ 255.11 $ 382.67 $ 535.81 $ 703.05 $ 886.08 8 CY $ 170.07 $ 340.15 $ 510.22 $ 714.42 $ 937.40 $ 1,181.43 Proposed Size 1x 2x 3x 4x 5x 6x 3 CY $ 63.78 $ 127.56 $ 191.34 $ 255.12 $ 318.90 $ 382.68 4 CY $ 85.04 $ 170.08 $ 255.12 $ 340.16 $ 425.20 $ 510.24 6 CY $ 127.56 $ 255.12 $ 382.68 $ 510.24 $ 637.80 $ 765.36 8 CY $ 170.07 $ 340.14 $ 510.21 $ 680.28 $ 850.35 $ 1,020.42 $ Change Size 1x 2x 3x 4x 5x 6x 3 CY $ -$ -$ 0.01 $ (12.79)$ (32.63)$ (60.36) 4 CY $ -$ 0.01 $ 0.01 $ (17.05)$ (43.50)$ (80.48) 6 CY $ -$ 0.01 $ 0.01 $ (25.57)$ (65.25)$ (120.72) 8 CY $ -$ (0.01)$ (0.01)$ (34.14)$ (87.05)$ (161.01) July 27, 2021; ID21-456 131 Proposed Rate Changes ▸Increase Sludge Disposal rate from $50/ton to $60/ton ▹Annual revenue increase of $82,000 ▸Establish a new brush rate of $35.00/ton for non-City of Denton customers ▸Change un-bagged brush rate from $20.00 to $25.00 to match minimum load rate Operational Changes ▸Residential Gate Rate Verification ▹Residents must show proof of residency (utility bill) to enjoy residential rate at the landfill and to use the Home chemical Collection Facility ▹No new rate requested, but implement a resident verification program showing proof that they are a resident of the City of Denton 7 Rate Recommendations -Landfill July 27, 2021; ID21-456 132 •Establish new residential rates for customers outside the City limits •Proposed rates are based on cost of service 8 Rate Recommendations –Outside City Limits Cart Type Inside City Limits Outside City Limits 64 Gallon Cart $20.51 $30.69 96 Gallon Cart $25.04 $32.00 Additional 96 Gallon Cart $16.57 $16.57 July 27, 2021; ID21-456 133 •Change wholesale agreements based on contracts •Currently, all wholesale agreements will end in FY 2023 •Contract renewals will be discussed during FY 2021-22 •FY 2021-22 revenue forecast totals $6.5 million. •Forecasting a 4.5% Consumer Price Index adjustment 9 Rate Recommendations –Contracts Company Contracted Tons FY 2020-21 Rate FY 2021-22 Rate Wise County 3,500 $34.00 $35.53 Frontier Waste 40,000 $29.50 $30.83 Little Elm 1,900 $27.00 $28.22 Waste Connections 65,000 $27.00 $28.22 Republic 7,680 $27.00 $28.22 CWD 87,000 $27.95 $29.21 July 27, 2021; ID21-456 134 10 Next Steps •August 2, 2021 –City Council Budget Workshop •August 23, 2021-PUB Rate Approval •September 21, 2021 –City Council Adopts Budget, Tax Rate, Rates and Capital Improvement Plan July 27, 2021; ID21-456 135 Questions? 11July 27, 2021; ID21-456 136 FY 2021-22 Budget Presentation Water Utilities Department Water Business Unit ID21-456, July 27, 2021 137 Overview 2ID21-456, July 27, 2021 138 Introduction History Leadership Education Associations City of North Las Vegas - Started as a Meter Reader in 1993, left in 2010 as Water Systems Supervisor Servant leader –passionate about serving my community, my team and the organization Executive Master of Science in Crisis and Emergency Management California Nevada Section AWWA Chair Water Distribution City of Long Beach – Manager Security and Emergency Preparedness 2010 to 2013 Build collaborative partnerships and teams through honest communication Bachelor of Science in Business Administration Rocky Mountain Section AWWA Chair 2019 to 2021 City of Westminster – Utilities Operations Manager 2013 to 2021 Hold myself and others accountable for following up and following through Colorado -Grade IV Distribution Certification Nevada –Grade III Distribution Certification AWWA National Chair – Security and Emergency Preparedness Programs Committee 2013 to present City of Denton –Director, Water Utilities 2021 to present Challenge my team to look beyond the status quo and embrace emerging technologies to better serve our community Various certification through the Federal Emergency Management Institute AWWA Board of Directors Class of 2024 ID21-456, July 27, 2021 139 Leadership Team 4 Stephen D. Gay DIRECTOR Water Utilites Vacant ASSISTANT DIRECTOR Operations Kim Mankin Administration Manager Pritam Deshmukh ASSISTANT DIRECTOR Asset Management and Infrastructure ID21-456, July 27, 2021 140 Organizational Chart 5 Director of Water Utilities Stephen Gay Asst Director Water Utilities – OperationsVacant Superintendent Field Operations Casey Bowles Superintendent Water ProductionHector Ortiz Superintendent Water ReclamationRusty Willard Water Utilities Administration Mgr Kim Mankin Asst Director Water Utilities - Asset Mgmt and Infrastructure Pritam Deshmukh Superintendent Vertical Infrastructure Chris Campbell Water Utilities Asset MgmtTyler Dawson Senior EngineerStephen Moore ID21-456, July 27, 2021 141 FTE Summary FTEs FY 19-20 FY 20-21 FY 21-22 Water Administration 10 11 12 Utilities Administration 9.5 -- Production 39 38 38 Distribution 29 27 26 Metering 18 18 18 Laboratory 5 5 5 Sustainability -5.5 7.5 Total 110.5 104.5 106.5 6 •Net increase of 2 FTEs from Solid Waste Public Outreach to Sustainability ID21-456, July 27, 2021 142 FY 2020-21 Focus Areas and Status Updates ▹Major Maintenance •Upgrades to Lake Lewisville Water Treatment Plant -To be completed FY 2021 •Raw Waterline Condition Assessment -Completed ▹Infrastructure Improvements •Lake Ray Roberts Water Treatment Plant Capacity Re-Rate and Performance Upgrades (20 MGD to 26 MGD) -Under design •Northwest Booster Pump Station and Transmission Line Design - Completed •North/South Water Pipeline I35 E to Scripture -Under construction ▹New Technology –Improve Efficiency •Advanced Metering Infrastructure (AMI) Assessment –In process 7ID21-456, July 27, 2021 143 FY 2021-22 Goals ▸Complete –Lake Ray Roberts Water Treatment Plant Capacity Re- Rate and Performance Upgrades (20 MGD to 26 MGD) ▸Complete -Construction of the Northwest Booster Pump Station and Transmission Line▸Complete -Construction of North/South Water Pipeline I35 E to Scripture ▸Relocate -Waterlines along I-35 corridor as part of the TXDOT’s I35E widening project ▸Revise -Emergency Response and Recovery Plan▸Survey -Distribution system to identify lead service lines in compliance with the Lead and Copper Rule requirements▸Implement -Recommendations/if any from AMI study▸Develop -Asset Management Program for vertical infrastructure 8ID21-456, July 27, 2021 144 0 200,000 400,000 600,000 800,000 1,000,000 1,200,000 October November December January February March April May June July August SeptemberGallons X1000Axis Title FY2021 Water Production 5 Year Average FY20 FY21 FY21 Budget FY 2020-21 Operational Data 9 Storm Uri Impact – Approx. 31 MG FY20 ID21-456, July 27, 2021 145 Water Volume Forecast ID21-456, July 27, 2021 146 Water -Operational Data 11 Minor Maintenance Activity FY18-19 FY19-20 FY20-21 YTD FY20-21 Projected FY 21-22 Goal Flushing Hydrants 10,831 8,578 5,924 9,000 9,000 Replacing Meters 2,878 3,972 945 1,500 * *AMI/AMR study will help define goal for next year ID21-456, July 27, 2021 147 Water -Operational Data 12 Major Maintenance (in linear feet) Horizontal Project Delivery Improvements •Resource Allocation: Utilizing the Capital Projects Team to Deliver Major Maintenance (Horizontal Infrastructure) projects throughout the City. •Aligning Utility Replacements with Streets Rehabilitation Program (part of the new bond program) Infrastructure Replacement FY18-19 FY19-20 FY20-21 YTD FY20-21 Projected FY 21-22 Goal In House –W Crews 16,860 10,622 14,622 16,000 16,000 Delivered by Capital Projects 382 19,823 13,368 24,632 25,000 Total 17,242 30,445 27,990 40,632 41,000 ID21-456, July 27, 2021 148 Budget Highlights 13ID21-456, July 27, 2021 149 14 Water Financial Assumptions Volume Forecast •2% growth forecasted in out years •Hunter/Cole rate revenue included starting in FY 2023 Revenue •2% growth forecasted in out years •Continue to utilize impact fee funding to revenue fund projects •Forecast includes Hunter/Cole rate revenue Expense •3% growth forecasted in out years •Hunter/Cole expenses included ID21-456, July 27, 2021 150 15 Water Revenue Detail Revenues FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Water Sales Residential $20,375,255 $20,563,184 $20,160,324 $21,519,009 Water Sales Commercial 17,090,211 17,655,278 17,309,387 18,475,937 Water For Resale 1,612,230 1,360,648 2,258,977 1,423,894 Other Water 1,208,423 865,090 654,048 1,892,392 Cost of Service 1,149,991 1,676,882 1,676,882 2,033,275 Interest Operating 302,800 294,000 106,994 300,000 Impact Fee Transfer In 6,605,655 6,605,000 6,605,000 6,605,000 Total Revenue $48,344,565 $49,020,082 $48,771,612 $52,249,507 ID21-456, July 27, 2021 151 16 Water Expense Detail Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Personnel Services $8,139,916 $8,652,990 $8,038,035 $8,798,948 Materials & Supplies 1,472,974 1,747,819 1,623,604 1,776,571 Maintenance & Repair 1,477,259 1,804,365 1,676,132 2,203,508 Insurance & Miscellaneous 418,454 575,574 575,574 576,253 ROI & Franchise Fees 3,301,557 3,364,225 3,125,135 3,520,601 Operations & Purchased Power 3,112,141 3,763,059 3,495,624 3,806,885 Debt Service 12,879,020 11,064,205 11,064,205 10,835,105 Cost of Service 4,896,659 5,262,865 5,262,865 5,709,734 Capital Outlay 13,838,194 16,709,105 16,709,105 13,700,759 Total $49,536,174 $52,944,207 $51,570,279 $50,928,364 ID21-456, July 27, 2021 152 17 Water Expense Detail By Division Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Preliminary Admin $2,166,108 $3,072,695 $2,952,203 $2,841,323 Utility Admin 1,059,645 --- Sustainability -883,592 848,943 975,603 Production 11,982,259 12,616,442 12,121,701 12,679,235 Distribution 6,835,289 11,186,324 10,747,664 7,620,776 Metering 2,407,953 3,293,464 3,164,314 3,222,630 Lab 531,164 619,962 595,651 647,092 Debt Service 12,879,020 11,064,205 11,064,205 10,835,105 Transfers/ROI/Franchise Fees 11,557,418 10,207,523 10,075,598 12,106,600 Total $49,418,856 $52,944,207 $51,570,279 $50,928,364 ID21-456, July 27, 2021 153 18 Water Ten-Year Forecast *No forecasted rate increasesID21-456, July 27, 2021 Water FY 2020 FY 2021 FY 2021 FY 2022 FY 2023 FY 2024 FY 2025 FY 2026 FY 2027 FY 2028 FY 2029 FY 2030 FY 2031 Actual Budget Estimate Preliminary Projected Projected Projected Projected Projected Projected Projected Projected Projected Beginning Water Fund Balance 21,153,243$ 22,344,852$ 22,344,852$ 19,546,185$ 20,867,329$ 20,611,272$ 20,733,942$ 26,094,431$ 30,247,925$ 31,900,494$ 28,654,783$ 24,989,412$ 21,824,127$ Water Revenues User Charge Revenue Minimum Charge 9,960,334$ 9,067,166$ 9,067,166$ 9,929,253$ 10,115,638$ 10,305,751$ 11,040,656$ 11,249,270$ 11,462,056$ 11,679,097$ 11,900,480$ 12,126,290$ 12,356,616$ Volumetric Charge 29,099,520 29,938,774 29,190,305 31,489,588 33,469,287 34,138,673 34,821,446 35,517,875 36,583,412 37,315,080 38,061,381 38,822,609 39,599,061 Water Miscellaneous Revenue 2,679,711 3,409,142 3,909,142 4,225,667 4,313,066 4,397,487 4,483,466 4,571,295 4,568,998 4,660,378 4,753,586 4,848,657 4,945,631 Impact Fee Transfer 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 6,605,000 Total: Revenues 48,344,565$ 49,020,082$ 48,771,612$ 52,249,507$ 54,502,991$ 55,446,912$ 56,950,569$ 57,943,440$ 59,219,465$ 60,259,555$ 61,320,447$ 62,402,556$ 63,506,308$ Use of Reserves 1,191,609$ 3,924,125$ 2,798,667$ -$ 256,058$ -$ -$ -$ -$ 3,245,711$ 3,665,371$ 3,165,286$ 3,007,911$ Total Resources 49,536,174$ 52,944,207$ 51,570,279$ 52,249,507$ 54,759,049$ 55,446,912$ 56,950,569$ 57,943,440$ 59,219,465$ 63,505,266$ 64,985,817$ 65,567,842$ 66,514,218$ Revenue Requirements Operating Expenditures 14,749,532$ 16,543,807$ 14,913,310$ 16,798,128$ 17,302,072$ 17,821,134$ 18,355,768$ 18,906,441$ 19,473,634$ 20,057,843$ 20,659,578$ 21,279,366$ 21,917,747$ Transfers 4,896,659 5,262,865 5,519,434 5,709,734 5,881,026 6,057,456 6,239,180 6,426,356 6,619,146 6,817,721 7,022,252 7,232,920 7,449,907 Franchise Fee 1,942,028 1,978,956 1,978,956 2,070,942 2,179,246 2,222,221 2,293,105 2,338,357 2,402,273 2,449,709 2,498,093 2,547,445 2,597,784 Return on Investment Fee 1,359,420 1,385,269 1,385,269 1,449,659 1,525,472 1,555,555 1,605,174 1,636,850 1,681,591 1,714,796 1,748,665 1,783,211 1,818,449 Capital Projects (Rate Funded)9,870,305 13,984,105 13,984,105 10,033,768 10,319,345 8,997,791 4,684,190 4,808,631 7,250,000 7,467,500 7,691,525 7,922,271 8,159,939 Impact Fee Project Revenue Funding 3,839,210 2,725,000 2,725,000 3,500,000 3,000,000 2,725,000 2,725,000 3,500,000 3,500,000 3,500,000 3,500,000 3,500,000 3,500,000 Debt Service 12,879,020 11,064,205 11,064,205 10,835,105 14,120,220 15,513,415 15,255,995 15,741,643 16,208,584 21,066,029 21,434,036 20,870,961 20,638,725 Supplemental Packages - - - 531,028 431,668 431,668 431,668 431,668 431,668 431,668 431,668 431,668 431,668 Total: Revenue Requirements 49,536,174$ 52,944,207$ 51,570,279$ 50,928,363$ 54,759,049$ 55,324,241$ 51,590,080$ 53,789,946$ 57,566,897$ 63,505,266$ 64,985,817$ 65,567,842$ 66,514,218$ Current Revenue Surplus/(Deficit)-$ -$ -$ 1,321,144$ -$ 122,671$ 5,360,488$ 4,153,495$ 1,652,569$ -$ -$ -$ -$ Ending Water Fund Balance 22,344,852$ 18,420,727$ 19,546,185$ 20,867,329$ 20,611,272$ 20,733,942$ 26,094,431$ 30,247,925$ 31,900,494$ 28,654,783$ 24,989,412$ 21,824,127$ 18,816,216$ Capital Project Reserve -$ -$ -$ -$ -$ -$ 5,000,000$ 9,000,000$ 10,000,000$ -$ -$ -$ -$ Rate Increase 0%-2%-2%0%0%0%0%0%0%0%0%0%0% Reserves Minimum Target Fund Balance (120 days)16,285,865$ 17,406,315$ 16,954,612$ 16,494,116$ 18,599,496$ 19,451,354$ 18,539,206$ 18,877,649$ 19,249,791$ 19,001,945$ 19,379,340$ 19,548,957$ 19,836,279$ Maximum Target Fund Balance (180 days)24,428,798$ 26,109,472$ 25,431,918$ 24,741,175$ 27,899,244$ 29,177,031$ 27,808,809$ 28,316,474$ 28,874,687$ 28,502,918$ 29,069,010$ 29,323,435$ 29,754,419$ Impact Fee Capital Reserve 9,000,000$ 9,000,000$ 9,000,000$ 9,000,000$ 9,000,000$ -$ -$ -$ -$ -$ -$ -$ -$ Impact Fee Reserve 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ 4,076,000$ Development Plan Lines 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 154 19 Water 5-Year Capital Plan FY 2022 FY 2023 FY 2024 FY 2025 FY 2026 Debt Funded Capital 34,491,460$ 42,362,363$ 33,013,181$ 5,910,987$ 6,700,796$ Revenue Funded Capital 9,310,943 9,596,520 8,274,966 3,961,365 4,085,806 Aid in Construction 265,788 265,788 265,788 265,788 265,788 Impact Fee Funding 3,500,000 3,000,000 2,725,000 2,725,000 3,500,000 Vehicle Replacement Fund 309,855 480,170 454,509 248,506 659,434 Total 47,878,046$ 55,704,841$ 44,733,444$ 13,111,646$ 15,211,825$ Water CIP Summary ID21-456, July 27, 2021 155 20 Water 5-Year Capital Plan (cont.) Major Projects FY 21-22 Amount Funding Type Project Status Northwest Transmission Lines & Booster Pump Station $14,900,000 Debt Design Completed Bid -October 2021 Ray Roberts Capacity Re-Rate and Performance Upgrades $11,000,000 Debt Under Design (30%) Bid –January 2022 2019 Bond Election Projects $4,095,338 Debt Under Design Annual Field Service Replacements $2,847,693 Revenue Under Design Lake Lewisville Treatment Plant Administration Building $2,500,000 Revenue Design (90%) Bid –October 2021 Total $35,343,031 ID21-456, July 27, 2021 156 21 Water 5-Year Capital Plan (cont.) Major Projects FY 20-21 Amount FY 21-22 Amount FY 22-23 Amount Project Status (Design) Project Status (Construction) Northwest Transmission Lines & Booster Pump Station $1,635,000 $14,900,000 Booster Pump Station $1,000,000 $9,450,000 Design Completed Bid -October 21 Dec 21 –Aug 23 Transmission Main $635,000 $5,450,000 Design Completed Bid -October 21 Dec 21 –Dec 22 Ray Roberts Capacity Re-Rate and Performance Upgrades $1,700,000 $11,000,000 $11,000,000 Disinfection System Upgrades $560,000 $5,275,500 Design Completion December 21 Bid -January 22 Backwash Supply Improvements $545,000 $5,219,500 Design Completion December 21 Bid -January 22 Performance Upgrades $595,000 $505,000 $11,000,000 Design Completion October 22 Bid -October 22 ID21-456, July 27, 2021 157 Budget Requests 22ID21-456, July 27, 2021 158 23 Supplemental Package Summary Package Title Requested By One-time Cost Recurring Cost FY 2021-22 Total Notes System Repair Materials Distribution -$25,000 $25,000 Increased Materials Costs License Incentives Multiple -$8,500 $8,500 Employee Retention Fire Hydrant Maint.Distribution -$30,000 $30,000 Increased Effort Impacting Maintenance Workload Line Locating Distribution -$150,000 $150,000 Increased Effort Impacting Maintenance Workload Street Rehab Distribution -$200,000 $200,000 Streets Workload Total $413,500 $413,500 ID21-456, July 27, 2021 159 24 Next Steps •August 3, 2021 –City Council Budget Workshop •September 21, 2021 –City Council Adopts Budget, Tax Rate, Rates and Capital Improvement Plan ID21-456, July 27, 2021 160 Questions? 25ID21-456, July 27, 2021 161 FY 2021-22 Water Rate Presentation Finance Department ID21-456, July 27, 2021 162 Water Rate Terms Facility Charge Fixed monthly fee charged to customers based on meter size Volume Charge Monthly rate charged to customers based on volume of water used WR Residential Water Service WC Commercial/Industrial Water Service WFH Metered Water From Fire Hydrant WW Wholesale Treated Water Service to Upper Trinity Regional Water District WRW Wholesale Raw Water Service to Upper Trinity Regional Water District WCL Wholesale Raw Water Pass-Through to Upper Trinity Regional Water District from Lake Chapman into Lake Lewisville 2 ID21-456, July 27, 2021 163 Cost of Service (COS) Results -Water 3 History •Last study completed in 2014 •City contracted with Raftelis in 2019 to update the City’s Cost of Service Study. (Study period FY 2021-2025) •Studies are updated approximately every 5-years •Equitably allocates expenses between the various customer classes of service Goal •Establish cost of service-based rates •Ensure revenue stability •Establish fair and equitable rates Revenue Requirements Water Water COS by Class Sewer Sewer COS by Class ID21-456, July 27, 2021 164 Cost of Service (COS) Results -Water Class COS Current Revenue Difference % Difference Retail Residential 22,748,248$ 21,248,894$ (1,499,353)$ -6.6% Commercial 10,073,359$ 12,709,815$ 2,636,457$ 26.2% Irrigation 4,623,122$ 3,538,544$ (1,084,578)$ -23.5% Fire Hydrant 513,312$ 481,774$ (31,538)$ -6.1% Total Retail 37,958,040$ 37,979,027$ 20,987$ 0% Wholesale 543,750$ 522,763$ (20,987)$ -3.9% 4 ID21-456, July 27, 2021 165 How Much Does My Water Cost? An 8 oz. Glass of Water Costs: 0.025 cents Flushing a Toilet Costs: 0.65 cents On Average an 8 Minute Shower Costs: 7 cents 5 ID21-456, July 27, 2021 166 Current Residential Rate Structure Current Residential Rate Structure Winter Summer Facility Charge $15.84 $15.84 Volume Charge (x1,000) 0-15,000 $4.05 $4.05 15,001-30,000 $4.05 $5.76 30,001-50,000 $4.05 $7.95 Over 50,000 $4.05 $10.64 Current Rate Structure •A residential bill is made up of two components; Facility Charge, Volume Charge •Currently, rates are divided into five tiers and are seasonal (i.e. winter, summer) •Average residential consumption volume reduced from 9,200 gallons to 7,600 gallons •Currently, the average residential customer fits into the 1st tier (0-15,000) •Seasonal rates result in a customer’s rate changing twice a year. 6 ID21-456, July 27, 2021 167 Residential Distributions - 10,000 20,000 30,000 40,000 50,000 60,000 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51Number of Bills1,000 Gallons Bills Meter Size Number of Meters 3/4"31,831 1"677 1.5"217 2"81 Total 32,806 7 ID21-456, July 27, 2021 168 8 Residential Rate Recommendation Option 1 Winter Summer Facility Charge $15.84 $15.84 Volume Charge 0-15,000 $4.05 $4.05 15,001-30,000 $4.05 $5.76 30,001-50,000 $4.05 $7.95 50,000+$4.05 $10.64 Option 1 Current Structure–No rate change Option 2 0-7,500 Gallons–Combine seasonal residential rates into one annual volume rate based on current revenues. Creates a new tier from 0-7,500 gallons. The average residential customer will see a decrease of $3.15 per month. Option 3 0-5,000 Gallons –Combine seasonal residential rates into one annual volume rate based on current revenues. Creates a new tier from 0-5,000 gallons. The average residential customer will see a decrease of $2.10 per month. Option 2 Combined Facility Charge $15.84 Volume Charge 0-7,500 $3.63 7,501-15,000 $4.05 15,001-30,000 $7.61 30,001-50,000 $9.68 50,000+$12.04 Option 3 Combined Facility Charge $15.84 Volume Charge 0-5,000 $3.63 5,001-15,000 $4.05 15,001-30,000 $7.12 30,001-50,000 $9.53 50,000+$11.79 ID21-456, July 27, 2021 169 Residential Irrigation Rate Recommendation Option 1 Winter Summer Facility Charge $15.84 $15.84 Volume Charge 0-15,000 $4.05 $5.76 15,001-30,000 $4.05 $7.95 30,000+$4.05 $10.64 Option 1–No rate change Option 2 –This option will maintain the existing facility charge and combine the seasonal volume rates. In addition, this options creates two new tiers for consumption of 0-7,500 gallons and over 50,000 gallons. The average irrigation customer will see a decrease in the monthly bill. Option 3 –This option will maintain the existing facility charge and combine the seasonal volume rates. In addition, this options creates two new tiers for consumption of 0-5,000 gallons and over 50,000 gallons. The average irrigation customer will see a decrease in the monthly bill. 9 Option 2 Combined Facility Charge $15.84 Volume Charge 0-7,500 $3.63 7,501-15,000 $4.05 15,001-30,000 $7.61 30,001-50,000 $9.68 50,000+$12.04 Option 3 Combined Facility Charge $15.84 Volume Charge 0-5,000 $3.63 5,001-15,000 $4.05 15,001-30,000 $7.12 30,001-50,000 $9.53 50,000+$11.79 ID21-456, July 27, 2021 170 Residential Rate Recommendation (cont.) Option 1 Status Quo Option 2 0-7,500 Gal Option 3 0-5,000 Gal Facility Charge*$15.84 $15.84 $15.84 Volume Charge** (x1000) $30.78 $27.63 $28.68 Total Average Residential Bill $46.62 $43.47 $44.52 Increase/(Decrease)$0 ($3.15)($2.10) *Based on 7,600 gallons **3/4-inch meter •89%of the 32,806 residential customers will see a rate decrease •11% of customers with consumption above 15,000 gallons will see a rate increase 10 ID21-456, July 27, 2021 171 Commercial Rate Recommendation Current Rate Structure Facility Charge $50.99 Volume Charge (x1,000)$4.34 Average Customer’s Bill**$246.29 ** Based on 45,000 gallons •No change •Based on the recently completed Cost of Service Study, staff doesn’t recommend a change to the current commercial water rates. Average commercial consumption volume reduced from 50,000 gallons to 45,000 gallons. 11 ID21-456, July 27, 2021 172 Commercial Irrigation Rates *Based on 2” commercial meter **Based on 42,000 gallons Option 1 Current Structure –No rate change Option 2 Combined Seasonal Rates –This option will maintain the existing facility charge and combine seasonal volume rates into one annual rate at the current revenue level. The average irrigation customer will see a decrease in the monthly bill of $10.65. Option 1 Option 2 Winter Summer Combined Facility Charge*$50.99 $50.99 $50.99 Volume Charge (x1,000) $4.34 $6.00 $5.75 12 ID21-456, July 27, 2021 173 Wholesale rates Current FY 2020-21 Proposed FY 2021-22 Wholesale -WW2 Facility Charge / 30 days $288.72 $288.72 Demand Charge / per MGD $667,879 $667,879 Volume Charge / 1,000 Gallons $0.61 $0.61 Wholesale -Raw -WRW Volume Charge / 1,000 Gallons (85% of Dallas)$0.7578 $0.7578 Wholesale Raw Wtr Pass Through -WCL Volume Charge / 1,000 Gallons $0.0270 $0.0282* *Will change when data becomes available.13 ID21-456, July 27, 2021 174 Wastewater Rate Changes Dyno Dirt Current FY 2020-21 Proposed FY 2021-22 Dyno Soil –per Cubic Yard $30.00 $35.00 Dyno Soil –per Cubic Yard 10-99 Yards 20% off $24.00 $28.00 Dyno Soil –per Cubic Yard 100 + Yards 40% off $18.00 $21.00 14 ID21-456, July 27, 2021 175 Utility Rate Change History Since FY 2018, the City’s continued emphasis on financial transparency and cost containment has resulted in no rate increases for City of Denton Utilities. Rate Increases/(Decreases) Utility FY 2015 FY 2016 FY 2017 FY 2018 FY 2019 FY 2020 FY 2021 FY 2022 Electric 4.7%4.5%4.5%(1.2%)(3.5%)0 0 0 Water 3.0%6.3%4.3%0 0 0 (2.0%)0 Wastewater 6.0%2.7%1.8%0 (5.0%)0 0 0 Solid Waste 2.9%2.4%4.0%0 (12.0%)(12.0%)(5.0%)0 15 ID21-456, July 27, 2021 176 Rate Recommendations Water Residential •Regular and Irrigation Rate •Option 2 -Combined seasonal rates and establish a new tier from 0-7,500 gallons Commercial •Regular Rate •Option 1 -Maintain current rate structure •Irrigation Rate •Option 2 -Combine seasonal rates Wholesale •Adjustments in accordance with Contracts 16 Wastewater •Increase Dyno Soil rate ID21-456, July 27, 2021 177 Next Steps •August 2, 2021 –City Council Budget Workshop •August 23, 2021-PUB Rate Approval •September 21, 2021 –City Council Adopts Budget, Tax Rate, Rates and Capital Improvement Plan 17 ID21-456, July 27, 2021 178 Questions? 18 ID21-456, July 27, 2021 179 FY 2021-22 Budget Presentation Water Utilities Department Wastewater Business Unit ID21-456, July 27, 2021180 Budget Overview 2ID21-456, July 27, 2021181 Organizational Chart 3 Director of Water Utilities Stephen Gay Asst Director Water Utilities – OperationsVacant Superintendent Field OperationsCasey Bowles Superintendent Water ProductionHector Ortiz Superintendent Water ReclamationRusty Willard Water Utilities Administration Mgr Kim Mankin Asst Director Water Utilities - Asset Mgmt and Infrastructure Pritam Deshmukh Superintendent Vertical Infrastructure Chris Campbell Water Utilities Asset MgmtTyler Dawson Senior EngineerStephen Moore ID21-456, July 27, 2021182 FTE Summary 4 •New FTEs 1 FTE Stormwater Inspector in Watershed Protection FTEs FY 19-20 FY 20-21 FY 21-22 Wastewater Administration 6 -- Water Reclamation 26 23 23 Wastewater Collection 37 35 35 Field Services 6 9 9 Beneficial Reuse 7 7 7 Laboratory 4 4 4 Industrial Pretreatment 7.5 7.5 7.5 Drainage & Watershed 28 23 24 Total 121.5 108.5 109.5 ID21-456, July 27, 2021183 FY 2020-21 Focus Areas and Status Updates ▸Major Maintenance •Hickory Creek/Old Alton Lift Station replacement –To be completed FY2021 •Lakeview Interceptor Project –Under design ▸Infrastructure Improvements •Pecan Creek Water Reclamation Facility Solids Handling Project (Phase I) –Under design •Hickory Creek Detention Facility –Under Construction •Hickory Creek Interceptor Sewer Phase I and II –Under construction ▸Improvements to planning •Comprehensive Wastewater Master Plan -Underway 5ID21-456, July 27, 2021 184 Wastewater DepartmentFY 2021-22 Goals ▸Bid and Mobilize -Construction of Pecan Creek Plant Expansion Phase I▸Complete -Construction of Hickory Creek Detention Facility▸Complete –Construction of Hickory Creek Interceptor Sewer Phase I and II▸Bid and Mobilize -Construction of Hickory Creek Interceptor Phase III and Dry Fork Interceptor Projects▸Complete -Construction of Robson Ranch Wastewater Main Connection Project ▸Initiate -Decommissioning the Robson Ranch Wastewater Treatment Facility▸Complete -Update to Impact Fee Study 6ID21-456, July 27, 2021185 0 5 10 15 20 25 30 35 202020212022202320242025202620272028202920302031203220332034203520362037203820392040Average Day Flow (mgd)Year2021 TWDB State Water Plan City Growth/Demand Projection Proposed Capacity 100% Capacity - Existing Wastewater Department FY 2021-22 Operational Data 7 Texas Commission on Environmental Quality (TCEQ) Requirement •At 75% of design of expansion must begin •At 90% of design construction must be underway Design for Phase 1 of the Solids Handling/Chemically Enhanced Primary Treatment (CEPT) Project Underway This will add 5 MGD Capacity 75% Capacity = 15.8 mgd 90% Capacity = 18.9 mgd ID21-456, July 27, 2021186 Wastewater DepartmentOperational Data 8 Minor Maintenance (in linear feet) Activity FY18-19 FY19-20 FY20-21 YTD FY20-21 Projected FY 21-22 Goal Inspection 126,760 131,893 78,320 120,000 120,000 Cleaning 771,171 588,288 474,675 675,000 675,000 ID21-456, July 27, 2021187 Wastewater -Operational Data 9 Major Maintenance (linear feet) Infrastructure Replacement FY18-19 FY19-20 FY20-21 YTD FY20-21 Projected FY 21-22 Goal In House –WW Crews 12,778 5,087 9,087 12,000 8,000 Delivered by Capital Projects 2,944 16,739 14,297 19,556 23,000 Total 15,722 21,826 23,384 31,556 31,000 Horizontal Project Delivery Improvements: •Resource Allocation: Utilizing the Capital Projects Team to Deliver Major Maintenance (Horizontal Infrastructure) projects throughout the City. •Aligning Utility Replacements with Streets Rehabilitation Program (part of the new bond program) ID21-456, July 27, 2021188 Budget Highlights 10ID21-456, July 27, 2021189 11 Wastewater Financial Assumptions Volume Forecast •2% growth forecasted in out years •Hunter/Cole rate revenue included starting in FY 2023 Revenue •2% growth forecasted in out years •Continue to utilize impact fee funding to revenue fund projects •Forecast includes Hunter/Cole rate revenue Expense •3% growth forecasted in out years •Hunter/Cole expenses included ID21-456, July 27, 2021190 12 Wastewater Revenue Detail Revenues FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Proposed Wastewater Residential $11,422,482 $11,583,684 $11,351,051 $11,879,945 Wastewater Commercial 11,730,566 13,130,746 12,867,043 13,466,574 Wastewater Wholesale 780,181 695,320 681,356 713,103 Other Water 2,233,124 1,800,692 2,016,064 2,068,050 Cost of Service 587,895 599,652 599,652 611,645 Drainage 5,089,545 5,079,576 5,339,222 5,638,695 Impact Fee Transfer 4,270,000 4,270,000 4,270,000 4,270,000 Total Revenue $36,113,794 $37,159,670 $37,124,388 $38,648,012 ID21-456, July 27, 2021191 13 Wastewater Expense Detail Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Proposed Personnel Services $8,601,780 $8,421,034 $8,416,565 $8,881,839 Materials & Supplies 988,031 1,215,709 1,215,063 1,323,420 Maintenance & Repair 1,090,847 1,694,791 1,693,892 2,295,605 Insurance & Miscellaneous 316,651 302,046 309,894 310,886 ROI & Franchise Fees 2,112,431 2,596,728 2,116,453 2,215,068 Operations & Purchased Power 3,395,352 3,457,376 3,455,541 3,507,212 Debt Service 7,478,576 6,767,023 7,043,462 7,825,131 Cost of Service 4,872,533 5,643,911 5,674,881 5,907,051 Capital Outlay 8,041,230 6,768,567 6,492,128 5,640,309 Total $36,897,431 $36,867,185 $36,417,879 $37,906,521 ID21-456, July 27, 2021192 14 Wastewater Expense By Division Expenses FY 2019-20 Actuals FY 2020-21 Budget FY 2020-21 Estimate FY 2021-22 Proposed Administration $954,055 $-$-$- Water Reclamation 6,156,380 6,120,563 6,098,804 6,617,618 Collection 7,095,756 7,074,984 7,049,833 6,227,832 Field Services 1,009,535 1,563,991 1,558,432 1,390,405 Beneficial Reuse 1,266,682 1,428,864 1,423,785 1,460,406 Laboratory 520,514 561,709 559,712 664,802 Industrial Pretreatment 743,932 823,762 820,833 835,919 Drainage 5,624,782 5,893,435 5,339,222 5,638,695 Debt 7,005,112 6,767,023 7,043,462 7,825,131 Transfers/Franchise Fees/ROI 6,520,683 5,632,854 5,523,796 7,245,713 Total 36,897,431 $36,867,185 $35,417,879 $37,906,521 ID21-456, July 27, 2021 193 15 Wastewater Ten-Year Forecast (includes Drainage) *Includes future rate increases Wastewater & Drainage FY 2020 FY 2021 FY 2021 FY 2022 FY 2023 FY 2024 FY 2025 FY 2026 FY 2027 FY 2028 FY 2029 FY 2030 FY 2031 Actual Budget Estimate Preliminary Projected Projected Projected Projected Projected Projected Projected Projected Projected Beginning Wastewater Fund Balance 17,145,479$ 14,361,842$ 14,361,842$ 15,068,351$ 15,809,842$ 17,407,748$ 16,948,836$ 15,349,056$ 15,115,952$ 13,570,496$ 11,787,438$ 10,108,850$ 8,528,171$ Wastewater Revenues User Charge Revenue Minimum Charge 5,709,250$ 5,726,724$ 5,926,682$ 6,258,334$ 6,605,386$ 6,793,704$ 6,990,764$ 7,192,238$ 7,402,211$ 7,619,726$ 7,922,220$ 8,233,761$ 8,471,500$ Volumetric Charge 18,276,713 18,332,654 18,972,768 19,801,288 21,723,806 23,045,242 23,880,500 25,052,459 25,790,841 26,298,085 27,083,845 27,885,463 28,424,436 Sewer Miscellaneous Revenue 2,233,049 2,936,858 2,615,716 2,679,695 2,916,844 2,971,055 3,026,351 3,085,636 2,960,233 3,018,992 3,078,927 3,140,060 3,202,416 Impact Fee Transfer In 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 4,270,000 Drainage 5,624,782 5,893,434 5,339,222 5,638,695 5,807,856 5,982,091 6,161,554 6,346,401 6,536,793 6,732,897 6,934,883 7,142,930 7,357,218 Total: Revenues 36,113,794$ 37,159,670$ 37,124,388$ 38,648,012$ 41,323,892$ 43,062,093$ 44,329,170$ 45,946,734$ 46,960,078$ 47,939,700$ 49,289,875$ 50,672,213$ 51,725,570$ Use of Reserves 783,637$ -$ -$ -$ -$ 458,912$ 1,599,780$ 233,104$ 1,545,456$ 1,783,058$ 1,678,588$ 1,580,679$ 1,793,504$ Total Resources 36,897,431$ 37,159,670$ 37,124,388$ 38,648,012$ 41,323,892$ 43,521,004$ 45,928,950$ 46,179,838$ 48,505,534$ 49,722,758$ 50,968,464$ 52,252,892$ 53,519,074$ Revenue Requirements Operating Expenditures 14,639,756$ 15,090,955$ 15,090,955$ 15,583,714$ 15,981,769$ 16,461,222$ 16,955,059$ 17,463,710$ 17,987,622$ 18,527,250$ 19,083,068$ 19,655,560$ 20,245,227$ Transfers 4,769,468 5,643,911 5,674,881 5,907,051 6,084,263 6,266,791 6,454,794 6,648,438 6,847,891 7,053,328 7,264,928 7,482,876 7,707,362 Franchise Fee 1,242,607 1,527,487 1,244,973 1,302,981 1,416,460 1,491,947 1,543,563 1,612,235 1,659,653 1,695,891 1,732,974 1,770,922 1,809,758 Return on Investment Fee 869,825 1,069,241 871,481 912,087 991,522 1,044,363 1,080,494 1,128,564 1,161,757 1,187,123 1,213,081 1,239,646 1,266,830 Capital Projects (Rate Funded)7,397,201 5,992,128 5,992,128 5,339,544 3,233,675 3,199,880 3,298,221 3,113,762 3,566,853 3,893,858 4,223,174 4,554,869 4,889,015 Impact Fee Project Revenue Funding 500,000 500,000 500,000 250,000 250,000 250,000 250,000 250,000 250,000 250,000 250,000 250,000 250,000 Debt Service 7,478,576 7,043,462 7,043,462 7,825,131 11,034,893 14,073,396 15,613,413 15,229,723 16,298,354 16,381,903 16,467,834 16,565,614 16,617,477 Supplemental Packages 786,012 733,405 733,405 733,405 733,405 733,405 733,405 733,405 733,405 733,405 Total: Revenue Requirements 36,897,431$ 36,867,184$ 36,417,879$ 37,906,521$ 39,725,986$ 43,521,004$ 45,928,950$ 46,179,838$ 48,505,534$ 49,722,758$ 50,968,464$ 52,252,892$ 53,519,074$ Current Revenue Surplus/(Deficit)-$ 292,486$ 706,509$ 741,491$ 1,597,906$ -$ -$ -$ -$ -$ -$ -$ -$ Ending Wastewater Fund Balance 14,361,842$ 14,654,328$ 15,068,351$ 15,809,842$ 17,407,748$ 16,948,836$ 15,349,056$ 15,115,952$ 13,570,496$ 11,787,438$ 10,108,850$ 8,528,171$ 6,734,668$ Rate Increase 0%0%0%0%0%0%0%0%0%0%1%1%0% Reserves Minimum Target Fund Balance (100 days)10,108,885$ 10,100,598$ 9,977,501$ 11,533,800$ 11,454,075$ 12,059,259$ 12,222,637$ 12,232,366$ 12,479,007$ 12,741,624$ 13,010,932$ 13,289,667$ 13,562,145$ Maximum Target Fund Balance (140 days)14,152,439$ 14,140,838$ 13,968,501$ 16,147,320$ 16,035,705$ 16,882,962$ 17,111,692$ 17,125,312$ 17,470,610$ 17,838,273$ 18,215,305$ 18,605,534$ 18,987,003$ Impact Fee Reserve 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ 9,519,000$ Drainage Reserve 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ Development Plan Line 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ ID21-456, July 27, 2021 194 16 Drainage Ten-Year Forecast Drainage FY 2020 FY 2021 FY 2021 FY 2022 FY 2023 FY 2024 FY 2025 FY 2026 FY 2027 FY 2028 FY 2029 FY 2030 FY 2031 Actual Budget Estimate Preliminary Projected Projected Projected Projected Projected Projected Projected Projected Projected Beginning Drainage Fund Balance 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ Drainage Revenues Drainage Revenue Total 5,624,782$ 5,893,434$ 5,339,222$ 5,638,695$ 5,807,856$ 5,982,091$ 6,161,554$ 6,346,401$ 6,536,793$ 6,732,897$ 6,934,883$ 7,142,930$ 7,357,218$ Revenue Requirements Transfers 625,143$ 684,117$ 657,058$ 673,428$ 693,631$ 714,440$ 735,873$ 757,950$ 780,688$ 804,109$ 828,232$ 853,079$ 878,671$ Operating Expenditures 2,718,514 3,123,800 2,596,647 2,751,077 2,833,609 2,918,617 3,006,176 3,096,361 3,189,252 3,284,930 3,383,477 3,484,982 3,589,531 Debt Service 473,464 276,439 276,439 - - - - - - - - - - Capital Projects 1,807,661 1,809,078 1,809,078 2,059,218 2,125,643 2,194,062 2,264,533 2,337,118 2,411,881 2,488,886 2,568,202 2,649,897 2,734,043 Supplementals - - - 154,972 154,972 154,972 154,972 154,972 154,972 154,972 154,972 154,972 154,972 Total: Revenue Requirements 5,624,782$ 5,893,434$ 5,339,222$ 5,638,695$ 5,807,856$ 5,982,091$ 6,161,554$ 6,346,401$ 6,536,793$ 6,732,897$ 6,934,883$ 7,142,930$ 7,357,218$ Ending Drainage Fund Balance 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ Reserves Target Target Balance 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ 1,000,000$ ID21-456, July 27, 2021195 17 Wastewater 5-Year Capital Plan Category FY 2022 FY 2023 FY 2024 FY 2025 FY 2026 Debt Funded Capital 44,212,652$ 62,170,763$ 44,523,823$ 10,566,361$ 16,679,295$ Revenue Funded Capital 4,777,282 2,671,413 2,637,618 2,735,959 2,551,500 Aid in Construction 82,000 82,000 82,000 82,000 82,000 Impact Fee Funding 250,000 250,000 250,000 250,000 250,000 Vehicle Replacement Fund 1,401,598 1,569,030 1,194,425 1,443,057 434,321 Total 50,723,532$ 66,743,206$ 48,687,866$ 15,077,377$ 19,997,116$ Wastewater CIP Summary ID21-456, July 27, 2021196 18 Wastewater 5-Year Capital Plan (cont.) Major Projects FY 21-22 Amount Funding Type Project Status Solids Handling Improvements $14,000,000 Debt Phase I –Design Completion July 2021 Hickory Creek WWTP Land Acquisition $5,800,000 Debt Expected to Close Hickory Creek Interceptor III $4,000,000 Debt Under Design Milam Creek Basin $4,000,000 Debt Start Design FY 2022 Field Service Replacements $2,684,077 Debt Under Design 2019 Bond Election $2,173,911 Debt Under Design Bonnie Brae Phase 3 $1,500,000 Debt Under Design PCWRP Headworks Reconfiguration $1,500,000 Debt Start Design –Oct 2021 Wastewater Masterplan $1,500,000 Revenue Total $37,157,988 ID21-456, July 27, 2021197 19 Wastewater 5-Year Capital Plan (cont.) Major Projects FY 20-21 Amount FY 21-22 Amount FY 22-23 Amount Project Status (Design) Project Status (Construction) Solids Handling Improvements $2,500,000 $14,000,000 $7,450,000 Phase I –Digester Cover, Valves and Diffuser $565,406 $3,399,994 Completed July 21 Oct 21 –May 22 Phase II -Cloth Effluent Filters $1,296,000 $10,106,213 693,787 Completed Oct 21 Dec 21 –Dec 22 Phase III –Solids Handling Upgrades $638,594 $493,793 $6,783,013 Completed May 22 Aug 22 –Dec 23 Hickory Creek WWTP Land Acquisition $5,800,000 Expected to Close in July 21 ID21-456, July 27, 2021198 Budget Requests 20ID21-456, July 27, 2021199 21 Supplemental Package Summary Package Title Requested By One-time Cost Recurring Cost FY 2021-22 Total New FTE Notes System Repair Materials Collection -$250,000 $250,000 -Increased Materials Costs Street Cuts Collection -$215,000 $215,000 -Streets Workload License Incentive Collection -$7,000 $7,000 -Employee Retention Line Locating Collection -$150,000 $150,000 -Reallocating Resources Inspector Watershed -$79,105 $79,105 1 Meet 3-week Inspection Goals Total -$701,105 $701,105 1 ID21-456, July 27, 2021200 Questions? 22ID21-456, July 27, 2021201 1 MEMORANDUM DATE: July 23, 2021 TO: Honorable Mayor and Members of the City Council FROM: Cassandra Ogden, Director of Finance SUBJECT: City Council Audit of Water System Operations Rate Structure Feedback Information regarding the FY 2021-22 Audit of Water System Operations Rate Structure was presented to the City Council on June 22nd. City Council had questions which are outlined below. Please let me know if you have questions or need additional information. 1. How does Denton compare in terms of consumption level frequency to peer cities? The Conserve North Texas Recommendation for Water Conservation and Reuse in Region C is to achieve a voluntary goal of 140 gallons per capita daily (GPCD) for municipal water use. In 2020 the City of Denton’s GPCD was 140.6. The table below displays a ten-year history of GPCD in Denton. In addition, we have reached out to several municipalities in the area and are waiting to hear back regarding their GPCD data. Year Denton GPCD Denton Residential GPCD 2011 172.8 78.5 2012 158.1 71.9 2013 157.7 67.7 2014 138.5 58.2 2015 140.0 57.0 2016 140.2 56.2 2017 134.5 55.7 2018 148.7 64.2 2019 135.9 53.0 2020 140.6 60.1 Finance Department * 215 E. McKinney * Denton, TX 76201 (940) 349-8224 * DFW Metro (972) 434-2259 * Fax (940) 349-7206 202 2 2. What is the average residential usage for the peer cities? The recommended water conservation and reuse in Region C is 140 gallons per capita daily (GPCD) (see Question 1). In addition, we have reached out to several municipalities in the area and are waiting to hear back about their average residential usage numbers. Water Utility Average Residential Usage (Gal/Month) FY20 Denton 7,600 Dallas 7,950 3. Want to find out if anyone is succeeding at reducing water usage and to what do they attribute that? a. Rate Structure - Rates and rate structure are vitally important. Some agencies have found that tiered rates lose their effect. The upper tiers become ineffective and obsolete. The tiers should be examined and pushed down. b. Development Code – Changing the landscape development code for new development by requiring native landscaping that does not require irrigation. It is easier to stop high water demand landscaping upfront than try to incentivize change after the fact. c. Rebate Program – Offering a rebate program to incentivize customers to convert to native landscaping with a drip watering system. d. Water waste prohibition as a condition of water service – Some utilities issue fees on the water bill for violations of water waste. An example is water runoff into the street. 4. What are we trying to incentivize by having a relatively lower rate per thousand-gallon for commercial usage than residential usage when actual total consumption for each customer class is about the same? Residential rates are applied to normalized water usage patterns. Higher rates are applied to significant amounts of irrigation and does not affect water needs which are considered necessary. Commercial water use varies significantly based on individual operations and lot sizes. Rates are set to irrigation and non-irrigation to best capture use from necessary operations and non- necessary irrigation. 5. Less than two-hour version of why it’s [rates are] being incentivized that way. Rate-based incentives are effective. Inverted block rates also help to address impacts caused by increases to peak demand, which are more costly than increases to average daily demand. 203 3 6. Did you look at relative savings versus cost element of requiring commercial customers to separately meter their irrigation? Doing this cost analysis was the recommendation of Internal Audit. There would be non-financial benefits such as, better data on commercial irrigation usage and additional rate flexibility. This is intended to equitably charge rates based on cost impacts. Rate studies help us understand how effectively our rates meet our equity goals. 7. Is there a mechanism that would allow us to indicate on the bill when customers go from block 1 to block 2 on the bill? Having this kind of indication was the recommendation of Internal Audit. Customer service is going to add this to the bills if it is possible and feasible. There are requirements that are legally required in the customer bills and Customer Service is in the process of updating the bill layout. 8. Want to see staff dig deeper into lowering the block one consumption threshold and also lowering the rate for this block; goal is to reduce usage so are there changes that can be made to the development code that could incentivize zero-scaping, native grasses, etc. Rate options will be discussed on July 27,2021. 9. If average peak is under first block threshold (15,000 gallons), isn’t it doing its job? It depends on the policy you want to set with rate structure; assumed based on inclining block rates that the City wanted to discourage discretionary usage, which is within that peak based on winter usage average of 5,000 gallons. The rate setting policy question involves to what extent we consider irrigation non-discretionary usage or in other words what levels of usage we do not want to discourage. 10. Do we have any idea how many of the residential irrigation customers are operating small sale agriculture? Internal Audit was told by Customer Service that they are mostly HOAs for neighborhood watering, but Internal Audit did not do an analysis to determine an exact amount. The process would be to go into each customer’s account and do research on each specific account owner. 11. Has there been any cost analysis on how requiring separate commercial irrigation meters would impact commercial customers? 204 4 Internal Audit did not do this cost analysis, but the recommendation was to do that; there are non-financial benefits of separately metering including better data and increased rate flexibility. This is a rate decision. See answer to #4. Irrigation meters allow us to apply irrigation rates properly for better cost equity. 12. Is there a specific proposal for altering the residential blocks? Rate options will be discussed on July 27,2021. 13. Has there been discussion of raising the rates for blocks 2, 3, & 4 while lowering the rates for block 1? Rate options will be discussed on July 27,2021. 14. Would like to see a way to normalize the water usage, specifically in regard to property size and how much land a customer is irrigating – there is a beautification element to that if we give credit for “green lawn of the week” Keep Denton Beautiful (KDB) has provided awards for lawns and gardens in the past. 15. Stated that there was an issue with the rate structure where new customers were being billed based on the previous customer’s usage patterns This should only be applicable to Wastewater, where the City cannot reasonably meter volume. Volumes are assessed based on the prior winter’s water use, so new customers may need several months to establish their own usage patterns. For a customer with no billing history, Wastewater is set at 5,400 gallons until the customer establishes an average. 205 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1054,Version:1 AGENDA CAPTION Receive a report, hold a discussion, and give staff direction regarding a follow up of federal American Rescue Plan (ARP) Act of 2021 and proposed uses for ARP funds received by the City of Denton. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™206 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Finance ACM/CFO: David Gaines DATE: July 27, 2021 SUBJECT Receive a report, hold a discussion, and give staff direction regarding a follow up of federal American Rescue Plan (ARP) Act of 2021 and proposed uses for ARP funds received by the City of Denton. BACKGROUND Beginning in December 2019, a novel coronavirus (COVID-19) spread throughout the world and was declared a global pandemic by the World Health Organization. Over the last year, the federal government has approved relief programs aimed at supporting efforts in response to COVID-19. Through the Coronavirus Aid, Relief, and. Economic Security Act (CARES), the City received $7.4 million in funding to address housing support, public safety expenses, and capital needs. An additional $412,869 in relief funding has been received by the Fire, Police, Library, and Airport Departments specific to their operations. On March 11, 2021, the ARP was signed into law providing $1.9 trillion in funding for relief from the COVID-19 public health emergency and its economic impacts. Included is funding for small business and aid to households that will be administered by federal agencies as well as $350 billion for State, local, and Tribal governments. The City of Denton’s allocation under the Act is $23.29 million and Denton County will receive $170.07 million. Eligible uses of funding are outlined in four categories: 1. To respond to the public health emergency or its negative economic impacts, including assistance to households, small businesses, and nonprofits, or aid to impacted industries such as tourism, travel, and hospitality; 2. To respond to workers performing essential work during the COVID-19 public health emergency by providing premium pay to eligible workers; 3. For the provision of government services to the extent of the reduction in revenue due to the COVID–19 public health emergency relative to revenues collected in the most recent full fiscal year prior to the emergency; and 4. To make necessary investments in water, sewer, or broadband infrastructure. The City of Denton will receive $23.29 million in federal aid across two years. Half of this funding ($11.65 million) became available in May 2021, and the remaining half will be available in May 2022. Funds can be used to cover costs incurred beginning March 3, 2021. All cost must be incurred or obligated by December 31, 2024. The period of performance will run until December 31, 2026, at which time all projects City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 207 must be completed. The Treasury Department has released interim guidelines with final guidelines expected Fall 2021. On Tuesday, May 25, the Denton City Council received a presentation and discussed potential uses of the ARPA funding. In that meeting the Council indicated an initial preference to prioritize and use the funding to support public health resources and reduce the negative economic impacts of the pandemic. The Council also supported hearing feedback from the community regarding these funds before deciding upon funding allocations for the first half of this funding. The City launched a survey from Tuesday, June 8 through Friday, June 18, 2021 to gather input from the community on the uses for this funding. The survey was shared on all media platforms to encourage participation. The survey received 243 responses. Approximately 95 percent of the respondents reported to be Denton residents with 51 percent reporting as property owners in the City. Over 70 percent of respondents identified being in the 76209-zip code. Funding to address homelessness, including temporary and permanent shelters, was ranked the highest priority at 62 percent in the use of ARP funds to support public health resources. Grant assistance for behavioral health services was ranked second in high priority at 49 percent. In the category of using ARP funds to address negative economic impacts from the pandemic, grant assistance programs for small businesses was ranked a high priority at 52 percent with financial support to nonprofit organizations ranked highest in medium priority at 47 percent. Additional details on the results are outlined in Exhibit 4. PRIOR ACTION/REVIEW (Council, Boards, Commissions) May 25, 2021 - The City Council received a presentation and discussed potential uses of the American Rescue Plan Act funding. EXHIBITS 1. Agenda Information Sheet 2. Presentation 3. Coronavirus State and Local Fiscal Relief Fund Interim Final Guidance 4. ARPA Survey Results Respectfully submitted: Cassey Ogden ` Finance Director 940-349-7195 208 Work Session American Rescue Plan (ARP) Act July 27, 2021 1ID#21-1054, July 27, 2021 209 Today’s Discussion •Overview of American Rescue Plan (ARP) Act of 2021 •Project Interest •Citizen Survey Results •Proposed Use of ARP Funds •Next Steps 2ID#21-1054, July 27, 2021 210 ARP Act Funding Summary •American Rescue Plan Act of 2021 (ARP) –enacted March 11, 2021 •$1.9 trillion pandemic relief bill •Authorized $350 Billion in state and local government fiscal assistance •City of Denton •Local Fiscal Assistance: $23.29 million in two “tranches” •50% delivered June 2021 •50% delivered no later than 1 year after first tranche •Awaiting release of further program information •HOME Funding: $1,763,622 •Tenant-based rental assistance, housing support, certain shelter activities •Airport Funding: $148,000 •Provide economic relief to airports affected by the COVID-19 pandemic –awaiting release of further program information •Denton County •Local Fiscal Assistance: $172.37 million •Emergency Rental Assistance: $18.25 million 3ID#21-1054, July 27, 2021 211 ARP Funding Parameters 4ID#21-1054, July 27, 2021 •Respond to COVID-19 or its Economic Impacts •Programs and projects must respond to negative impacts of COVID-19 pandemic, per Treasury guidance. •Replace Revenue lost due to COVID-19 •Revenue shortfalls across general revenue streams; excludes utility revenue •Provide Premium Pay to Eligible Essential Workers •Invest in Water, Sewer, Storm water and Broadband Infrastructure Treasury released Interim Guidance, Final Guidance expected Fall 2021 212 Goals for Use of ARP Funding •Prioritize funding for existing and one-time programs •Avoid an ongoing financial commitment beyond available funding Create Sustainable Solutions •Focus on solutions that have immediate impact •Target individuals and/or specific economic sectors Address Immediate Needs •Partner with organizations to leverage funding and expertise •Consider one-time projects with high or ongoing positive impacts Achieve Long-Term Benefits 5ID#21-1054, July 27, 2021 213 Project Interest –Work Session May 25, 2021 Potential Projects*ARP Category Fiscal Year One-time or Reoccurring Costs Estimated Funding Day Center & Overnight Shelter (Loop 288 Building)Support Public Health Resources FY 2022 One-time $5,000,000 Vaccine Clinic Support Support Public Health Resources FY 2022 One-time $500,000 Temporary Alternative Shelter Support Public Health Resources FY 2022 One-time $500,000 Behavioral Healthcare Services (grant program)Support Public Health Resources FY 2022 One-time $500,000 Emergency Management Program Manager Support Public Health Resources FY 2022 Reoccurring $120,000 Public Communication Software (Code Red replacement)Support Public Health Resources FY 2022 Reoccurring $70,000 Non-Profit Capacity Support (grant program)Address Negative Economic Impacts FY 2022 One-time $500,000 Lease & Rent Relief for Small Businesses (grant program)Address Negative Economic Impacts FY 2022 One-time $2,000,000 Business building health improvements (grant program)Address Negative Economic Impacts FY 2022 One-time $500,000 Arts/Music/Cultural Business Grant Program Address Negative Economic Impacts FY 2022 One-time $500,000 HOT Fund Revenue Replacement Address Negative Economic Impacts FY 2022 One-time $1,000,000 Pecan Creek Phase 3 & 4 Water & Sewer Infrastructure FY 2022 & 2023 One-time $20,300,000 Elm & Locust Street (Water/WW/Drainage)Water, Sewer & Storm Water Infrastructure FY 2022 & 2023 One-time $20,200,000 Storm water Master Plan Storm Water Infrastructure FY 2022 One-time $500,000 Sedimentation Basin Improvement (LLWTP)Water & Sewer Infrastructure FY 2022 One-time $2,700,000 Disinfection System Modifications (LRRWTP)Water & Sewer Infrastructure FY 2022 One-time $5,000,000 6 *Subject to project eligibility ID#21-1054, July 27, 2021 214 Citizen Survey 7ID#21-1054, July 27, 2021 •June 8th –June 18th •243 Responses •95% reported Denton residents •51% reported property owners •Over 70% identified living in 76209 I am a resident of the city of Denton I am a business owner in the city of Denton I am a property owner in the city of Denton I am a student in the city of Denton I am a renter in the city of Denton I am an employee working in the city of Denton Other (please specify) 0% 10% 20% 30% 40% 50% 60% 70% 80% 90% 100% About Me: (Select all that apply) Responses 215 Support of Public Health Resources 8ID#21-1054, July 27, 2021 Funding to address homelessness, including temporary and permanent shelters Grant assistance for behavioral healthcare services Funding for vaccine clinic and outreach support Funding an Emergency Management Program Manager 0% 10% 20% 30% 40% 50% 60% 70% Please rank the following opportunities to use ARPA funds to support public health resources: High Priority Medium Priority Low Priority No Priority 216 Opportunities to Address Negative Economic Impacts 9ID#21-1054, July 27, 2021 Financial support to nonprofit organizations Grant assistance programs for small businesses Grant assistance programs supporting local music and arts 0% 10% 20% 30% 40% 50% 60% Please rank the following opportunities to use ARPA funds to address negative economic impacts from the pandemic: High Priority Medium Priority Low Priority No Priority No Response 217 Proposed Projects –Year 1 10 *Subject to project eligibility **50% funded from General Fund ID#21-1054, July 27, 2021 Proposed projects include program administration expenses Potential Projects*ARP Category Fiscal Year One-time or Reoccurring Costs Estimated Funding Day Center & Overnight Shelter (Loop 288 Building)Support Public Health Resources FY 2022 One-time $5,000,000 Vaccine Clinic Support Support Public Health Resources FY 2022 One-time $550,000 Temporary Alternative Shelter Support Public Health Resources FY 2022 One-time $550,000 Behavioral Healthcare Services (grant program)Support Public Health Resources FY 2022 One-time $895,000 Emergency Management Program Manager**Support Public Health Resources FY 2022 Reoccurring $95,000 Public Communication Software (Code Red replacement)Support Public Health Resources FY 2022 Reoccurring $75,000 Street Outreach Expansion (FTE’s)**Support Public Health Resources FY 2022 Reoccurring $250,000 Street Outreach Expansion (Vehicle)Support Public Health Resources FY 2022 One-time $50,000 Non-Profit Capacity Support (grant program)Address Negative Economic Impacts FY 2022 One-time $550,000 Lease & Rent Relief for Small Businesses (grant program)Address Negative Economic Impacts FY 2022 One-time $2,330,000 Arts/Music/Cultural Business Grant Program Address Negative Economic Impacts FY 2022 One-time $550,000 City Facilities -COVID updates Address Negative Economic Impacts FY 2022 One-time $750,000 Total $11,645,000 218 Next Steps •Develop proposed program parameters to implement and administer grant programs. •ARP Funding will be included in Proposed Budget. •Budget Adoption scheduled September 21, 2021. 11 219 Questions? 12ID#21-1054, July 27, 2021 220 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Main Web Site https://home.treasury.gov/policy-issues/coronavirus/assistance-for-state-local-and-tribal- governments/state-and-local-fiscal-recovery-funds Application Portal Local governments that are direct recipients of funding from the program – counties and metropolitan cities (CDBG-entitlement cities) – should submit their application via the Treasury Department application portal as soon as possible to ensure that they receive their first allocation in a timely manner: https://home.treasury.gov/policy-issues/coronavirus/assistance-for-state-local-and-tribal- governments/state-and-local-fiscal-recovery-fund/request-funding. Allocations Treasury has posted allocations for states, counties, and metropolitan cities. Treasury has not yet posted funding amounts for non-entitlement units of local government, which will receive their funds as a sub-allocation from the state. • Treasury expects to provide further guidance on distributions to non-entitlement units in the coming days. • Non-entitlement units of local government should note that the law requires states to sub-allocate funds within 30 days of receipt. Overview The 134-page interim final rule provides detail on the scope of the seven eligible uses for the funds that Congress included in the statute. It also provides details on prohibited uses, outlines reporting requirements, and lists specific questions that Treasury would like stakeholders to address in their comments. • Responses to those specific questions and all other comments will be due 60 days after the interim final rule is published in the Federal Register (probably sometime next week so approximately on July 16, 2021.) 221 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 2 of 10 At the broadest level, the interim final rule aims to provide state, tribal, and local governments with “flexibility to determine how best to use payments from the Fiscal Recovery funds to meet the needs of their communities and populations.” • It goes on to state that “The interim final rule facilitates swift and effective implementation by establishing a framework for determining the types of programs and services that are eligible under the ARPA along with examples that state, tribal, and local governments may consider.” Public Health This category is perhaps the clearest and most flexible of all the eligible uses of Fiscal Recovery Funds, with the interim final rule stating that it “identifies a non-exclusive list of uses that address the COVID-19 public health emergency.” Eligible uses under this category include the following specific items. COVID-19 Containment & Mitigation • Vaccination programs • Medical expenses • Testing and contact tracing • Isolation or quarantine • PPE purchases • Support for vulnerable population to access medical or public health services • Public health surveillance • Enforcement of public health orders • Public communication efforts • Enhancement of healthcare capacity, including alternative care facilities • Support for prevention, mitigation, or other services in congregate facilities and schools • Enhancement of public health data systems • Capital investments in public facilities to meet pandemic operational needs • Ventilation improvements in key settings such as healthcare facilities Behavioral Healthcare Needs Exacerbated by the Pandemic • Mental health treatment • Substance misuse treatment • Other behavioral health services • Hotlines or warmlines • Crisis intervention • Services or outreach to promote access to health and social services Public Health & Safety Staff • Payroll and covered benefit expenses for public health, healthcare, human services, public safety, and similar employees, to the extent that they work on COVID-19 response. (For 222 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 3 of 10 administrative convenience, the interim final rule allows recipients to consider such employees as entirely devoted to responding to the pandemic.) Address Disparities in Public Health Outcomes • In recognition of the disproportionate impact of the pandemic on low-income communities, the interim final rule presumes that certain types of services and programs performed in Qualified Census Tracts are eligible, including community health workers, public benefits navigators, housing services to support healthy living environments, remediation of lead paint or other lead hazards, and evidence based community violence intervention programs to mitigate the increase in violence during the pandemic. Negative Economic Impacts Eligible uses under this category include: • Job training, • Deposits into state unemployment insurance trust funds, • Aid to households, facing negative economic impacts of the pandemic, including cash transfer “proportional to negative economic impact” (food assistance, rent, mortgage, or utility assistance, counseling and legal aid to prevent eviction or homelessness, emergency burial assistance, home repairs, weatherization, internet access or digital literacy assistance. (The interim guidance allows recipients to presume that a household or population that experienced unemployment or food or housing insecurity or is low- or moderate-income experienced negative economic impacts from the pandemic.), • Expenses to improve the efficacy of economic relief programs, • Loans or grants to small businesses and nonprofits to mitigate pandemic-related financial hardship, • Rehiring state, local, and tribal government staff, and • Aid to impacted industries (travel, tourism, and hospitality) to respond to pandemic- related economic impacts, including mitigation and infection prevention measures to enable safe resumption of business. In recognition of the disproportionate negative economic impacts on certain communities and population, Treasury will presume that certain services are eligible uses, including: • Building stronger communities through investments in housing and neighborhoods in lower-income neighborhoods (homeless services, affordable housing development, housing vouchers, housing counseling, housing navigation to assist with moves to higher opportunity neighborhoods), • Addressing educational disparities (enhanced early learning, assistance to high-poverty school districts, evidence-based education services such as tutoring, summer, after school and other extended learning, evidence-based practices to address social, emotional, and mental health needs of students) • Promoting healthy childhood environments (new or expanded childcare, home visiting programs, enhanced child welfare services) 223 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 4 of 10 Premium Pay The statute allows recipients to use funds to provide premium pay to eligible workers performing essential work during the COVID-19 public health emergency or to provide grants to third parties to provide premium pay of up to $13 per hour up to $25,000 to such workers. The interim final rule defines eligible workers to include: • Staff at nursing homes, hospitals, and home care settings, • Workers at farms, food production facilities, grocery stores, and restaurants, • Janitors and sanitation workers, • Truck drivers, transit staff, and warehouse workers, • Public health and safety staff, • Childcare workers, educators, and other school staff, and • Social services and human services staff. The final rule allows the chief executive officer of each recipient to add additional sectors to the above list. In addition, the final rule requires that any premium pay program prioritize lower income workers that perform essential work by limiting premium pay to a threshold of 150% of the state average annual wage for all occupations. Revenue Loss Per the statute, the interim final rule allows recipients to use funds to cover revenue loss due to the pandemic, using the most recent fiscal year completed prior to the pandemic as a baseline. The interim final rule allows recipients to calculate revenue loss by comparing actual revenue to what would have been expected to occur absent the pandemic. Recipients can use their average annual revenue growth rate over the three full years prior to the pandemic or 4.1% (the national average of state and local government revenue growth over the three years prior to the pandemic). For administrative convenience, the interim final rule presumes that any diminution of actual revenue relative to the expected trend is due to the pandemic. Recipients may immediately apply funds upon receipt to any 2020 revenue reduction and will have the opportunity to recalculate revenue loss through the end of the program. Local governments had hoped that Treasury would allow the calculation of revenue loss by specific streams of revenue. However, the interim final rule requires recipients to calculate revenue loss across all streams of revenue. It includes intergovernmental transfers between state and local governments but excludes intergovernmental transfers from the federal government. Water, Sewer & Broadband Infrastructure On water and sewer, the interim final rule aligns use of the funds with those of the Drinking Water and Clean Water State Revolving Loan Funds, including projects on privately owned infrastructure. • In response to local government requests, the interim final rule includes stormwater in the broad definition of water and sewer infrastructure. 224 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 5 of 10 • In addition, the interim final rule specifically encourages investments in lead pipe replacement, consolidation or establishment of water and sewer systems, water and sewer cybersecurity, and projects to address or mitigate climate change, including resilience and green infrastructure. On broadband, the interim final rule allows for investments that are designed to provide services providing speeds of up to 100 Mbps, with a focus on providing or expanding service to unserved and underserved areas, defined as areas that lack access to a wireline connection capable of reliably delivering speeds of 25 Mbps download and 3 Mbps upload. Transfers to Other Entities The statute allows recipients to transfer funds to a private nonprofit organization (as that term is defined in paragraph (17) of section 401 of the McKinney-Vento Homeless Assistance Act (42 USC 11360(17)), a public benefit corporation involved in the transportation of passengers or cargo, or a special purpose unit of state or local government. • The interim final rule clarifies that the statute’s list of transferees is not exclusive. Recipients remain responsible for reporting the use of transferred funds. Non-Entitlement Units of Local Government The statute and interim final rule require the states to sub-allocate funds to non-entitlement units of local governments within 30 days and prohibit the states from imposing any additional requirements on the funds. In addition, the statute and interim final rule require states to limit sub-allocation to more than 75% of a local government’s most recent budget. Timing The statute requires recipients to use funds by December 31, 2024; the interim final rule interprets that to mean that recipients must obligate funds by that date. • The reporting and performance periods for the funds will therefore run through December 31, 2026. Ineligible Uses Per the statute, the interim rule specifically prohibits local governments from using funds to make “extraordinary” contributions to pension funds. • However, the interim rule allows payments into a pension fund as part of regular employee compensation provided with the funds. Other ineligible uses include: • A general, non-broadband, water, sewer, or stormwater infrastructure project unless the project responds to a specific pandemic public health need (such as a vaccine delivery facility), • Contributions to rainy day funds, financial reserves, or similar funds, • Satisfaction of any obligation arising under or pursuant to a settlement agreement, and judgement, consent decree, or judicially confirmed debt restructuring plan except to the 225 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 6 of 10 extent it requires the provision of services that would respond to the COVID-19 public health emergency). Reporting The interim final rule requires recipients to submit an interim outlining uses through July 31, 2021 by August 31, 2021. • Non-entitlement units of local government are not required to submit an interim report. Recipients will subsequently have to submit quarterly report through the end of the performance period on December 31, 2026, with reports due 30 days after the end of each calendar quarter. • Reports will include financial data, information on contracts and subawards over $50,000, types of projects funded, and other information regarding use of the funds. Recipients with over 250,000 population will also have to submit an annual Recovery Plan Performance report. • The Recovery Plan Performance report will provide the public and Treasury information on the projects that recipients are undertaking with program funding and how they are planning to ensure project outcomes are achieved in an effective, efficient, and equitable manner. • Each jurisdiction will have some flexibility in terms of the form and content of the Recovery Plan Performance report, provided it includes the minimum information required by Treasury. • The initial report will be due August 31, 2021 with subsequent reports due 30 days after the end of the year. Specific Questions Treasury is accepting all comments on the interim final rule but is seeking answers to these specific questions. 1) Are there other types of services or costs that Treasury should consider as eligible uses to respond to the public health impacts of COVID-19? Describe how these respond to the COVID-19 public health emergency. 2) The interim final rule permits coverage of payroll and benefits costs of public health and safety staff primarily dedicated to COVID-19 response, as well as rehiring of public sector staff up to pre-pandemic levels. For how long should these measures remain in place? What other measures or presumptions might Treasury consider to assess the extent to which public sector staff are engaged in COVID-19 response, and therefore reimbursable, in an easily-administrable manner? 3) The interim final rule permits rehiring of public sector staff up to the government’s pre- pandemic staffing level, which is measured based on employment as of January 27, 2020. Does this approach adequately measure the pre-pandemic staffing level in a manner that is both accurate and easily administrable? Why or why not? 226 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 7 of 10 4) The interim final rule permits deposits to Unemployment Insurance Trust Funds, or using funds to pay back advances, up to the pre-pandemic balance. What, if any, conditions should be considered to ensure that funds repair economic impacts of the pandemic and strengthen unemployment insurance systems? 5) Are there other types of services or costs that Treasury should consider as eligible uses to respond to the negative economic impacts of COVID-19? Describe how these respond to the COVID-19 public health emergency. 6) What other measures, presumptions, or considerations could be used to assess “impacted industries” affected by the COVID-19 public health emergency? 7) What are the advantages and disadvantages of using Qualified Census Tracts and services provided by Tribal governments to delineate where a broader range of eligible uses are presumed to be responsive to the public health and economic impacts of COVID-19? What other measures might Treasury consider? Are there other populations or geographic areas that were disproportionately impacted by the pandemic that should be explicitly included? 8) Are there other services or costs that Treasury should consider as eligible uses to respond to the disproportionate impacts of COVID-19 on low-income populations and communities? Describe how they respond to the COVID-19 public health emergency or its negative economic impacts, including its exacerbation of pre-existing challenges in these areas. 9) The interim final rule includes eligible uses to support affordable housing and stronger neighborhoods in disproportionately impacted communities. Discuss the advantages and disadvantages of explicitly including other uses to support affordable housing and stronger neighborhoods, including rehabilitation of blighted properties or demolition of abandoned or vacant properties. In what ways does, or does not, this potential use address public health or economic impacts of the pandemic? What considerations, if any, could support use of Fiscal Recovery Funds in ways that do not result in resident displacement or loss of affordable housing units? 10) Are there additional sectors beyond those listed in the interim final rule that should be considered essential critical infrastructure sectors? 11) What, if any, additional criteria should Treasury consider to ensure that premium pay responds to essential workers? 12) What consideration, if any, should be given to the criteria on salary threshold, including measure and level, for requiring written justification? 227 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 8 of 10 13) Are there sources of revenue that either should or should not be included in the interim final rule’s measure of “general revenue” for recipients? If so, discuss why these sources either should or should not be included. 14) In the interim final rule, recipients are expected to calculate the reduction in revenue on an aggregate basis. Discuss the advantages and disadvantages of, and any potential concerns with, this approach, including circumstances in which it could be necessary or appropriate to calculate the reduction in revenue by source. 15) Treasury is considering whether to take into account other factors, including actions taken by the recipient as well as the expiration of the COVID-19 public health emergency, in determining whether to presume that revenue losses are “due to” the COVID-19 public health emergency. Discuss the advantages and disadvantages of this presumption, including when, if ever, during the covered period it would be appropriate to reevaluate the presumption that all losses are attributable to the COVID-19 public health emergency. 16) Do recipients anticipate lagged revenue effects of the public health emergency? If so, when would these lagged effects be expected to occur, and what can Treasury to do support these recipients through its implementation of the program? 17) In the interim final rule, paying interest or principal on government debt is not considered provision of a government service. Discuss the advantages and disadvantages of this approach, including circumstances in which paying interest or principal on government debt could be considered provision of a government service. 18) What are the advantages and disadvantages of aligning eligible uses with the eligible project type requirements of the DWSRF and CWSRF? What other water or sewer project categories, if any, should Treasury consider in addition to DWSRF and CWSRF eligible projects? Should Treasury consider a broader general category of water and sewer projects? 19) What additional water and sewer infrastructure categories, if any, should Treasury consider to address and respond to the needs of unserved, undeserved, or rural communities? How do these projects differ from DWSFR and CWSRF eligible projects? 20) What new categories of water and sewer infrastructure, if any, should Treasury consider to support State, local, and Tribal governments in mitigating the negative impacts of climate change? Discuss emerging technologies and processes that support resiliency of water and sewer infrastructure. Discuss any challenges faced by States and local governments when pursuing or implementing climate resilient infrastructure projects. 21) Infrastructure projects related to dams and reservoirs are generally not eligible under the CWSRF and DWSRF categories. Should Treasury consider expanding eligible infrastructure under the interim final rule to include dam and reservoir projects? Discuss public health, 228 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 9 of 10 environmental, climate, or equity benefits and costs in expanding the eligibility to include these types of projects. 22) What are the advantages and disadvantages of setting minimum symmetrical download and upload speeds of 100 Mbps? What other minimum standards would be appropriate and why? 23) Would setting such a minimum be impractical for particular types of projects? If so, where and on what basis should those projects be identified? How could such a standard be set while also taking into account the practicality of using this standard in particular types of projects? In addition to topography, geography, and financial factors, what other constraints, if any, are relevant to considering whether an investment is impracticable? 24) What are the advantages and disadvantages of setting a minimum level of service at 100 Mbps download and 20 Mbps upload in projects where it is impracticable to set minimum symmetrical download and upload speeds of 100 Mbps? What are the advantages and disadvantages of setting a scalability requirement in these cases? What other minimum standards would be appropriate and why? 25) What are the advantages and disadvantages of focusing these investments on those without access to a wireline connection that reliably delivers 25 Mbps download by 3 Mbps upload? Would another threshold be appropriate and why? 26) What are the advantages and disadvantages of setting any particular threshold for identifying unserved or underserved areas, minimum speed standards or scalability minimum? Are there other standards that should be set (e.g., latency)? If so, why and how? How can such threshold, standards, or minimum be set in a way that balances the public’s interest in making sure that reliable broadband services meeting the daily needs of all Americans are available throughout the country with the providing recipients flexibility to meet the varied needs of their communities? 27) Beyond a “deposit” and a “payroll contribution,” are there other types of payments into a pension fund that Treasury should consider? Questions 28 through 34 address the prohibition on states using funds to offset tax cuts and therefore do not apply to local governments. 35) What are the advantages and disadvantages of treating the list of transferees in sections 602(c)(3) and 603(c)(3) as nonexclusive, allowing States and localities to transfer funds to entities outside of the list? 36) Are there alternative ways of defining “special-purpose unit of State or local government” and “public benefit corporation” that would better further the aims of the Funds? 229 Coronavirus State & Local Fiscal Relief Fund Interim Final Guidance Page 10 of 10 37) What are alternative ways for States and territories to enforce the 75 percent cap while reducing the administrative burden on them? 38) What criteria should Treasury consider in assessing requests for extensions for further time to distribute NEU payments? 230 American Rescue Plan Act (ARPA) Survey 1 / 24 95.06%231 10.70%26 51.44%125 9.47%23 20.58%50 28.81%70 5.35%13 Q1 About Me: (Select all that apply) Answered: 243 Skipped: 0 Total Respondents: 243 #OTHER (PLEASE SPECIFY)DATE 1 I spend almost all my money in denton 6/17/2021 10:12 PM 2 accidentally hit other and can't deselect it 6/16/2021 9:19 AM 3 Retired city employee 6/14/2021 4:25 PM 4 I have children who are students in the city of Denton 6/13/2021 10:16 AM 5 Retired military veteran 6/12/2021 12:04 PM 6 I am a board member of a local non profit 6/11/2021 1:17 PM 7 Board Chairman, Food Pantry (Denton Community Food Center)6/11/2021 12:34 PM 8 Denton bus operator 6/10/2021 9:09 PM I am a resident of ... I am a business own... I am a property own... I am a student in the city ... I am a renter in the city ... I am an employee... Other (please specify) 0%10%20%30%40%50%60%70%80%90%100% ANSWER CHOICES RESPONSES I am a resident of the city of Denton I am a business owner in the city of Denton I am a property owner in the city of Denton I am a student in the city of Denton I am a renter in the city of Denton I am an employee working in the city of Denton Other (please specify) 231 American Rescue Plan Act (ARPA) Survey 2 / 24 9 I am an unpaid volunteer for a local nonprofit that serves the Denton community.6/9/2021 11:23 AM 10 Denton ETJ resident 6/9/2021 9:09 AM 11 Parent of student in school 6/9/2021 8:36 AM 12 Self-employed business owner not directly affected by Covid 6/9/2021 8:24 AM 13 I work part time. I am a Senior Citizen.6/8/2021 4:23 PM 232 American Rescue Plan Act (ARPA) Survey 3 / 24 Q2 What is your zip code? Answered: 243 Skipped: 0 #RESPONSES DATE 1 76208 6/22/2021 10:01 PM 2 7621”6/21/2021 4:46 PM 3 76209 6/21/2021 4:20 PM 4 76201 6/19/2021 9:44 AM 5 76201 6/18/2021 6:05 PM 6 76210 6/18/2021 5:12 PM 7 76201 6/18/2021 5:02 PM 8 76207 6/18/2021 1:13 PM 9 76209 6/18/2021 5:34 AM 10 76209 6/17/2021 11:38 PM 11 76210 6/17/2021 10:18 PM 12 76210 6/17/2021 10:12 PM 13 76209 6/17/2021 8:16 PM 14 76210 6/17/2021 4:39 PM 15 76207 6/17/2021 4:23 PM 16 76209 6/17/2021 3:26 PM 17 76210 6/17/2021 2:30 PM 18 76210 6/17/2021 2:17 PM 19 76210 6/17/2021 2:12 PM 20 76205 6/17/2021 1:36 PM 21 76201 6/17/2021 1:26 PM 22 76205 6/17/2021 12:53 PM 23 76207 6/17/2021 12:46 PM 24 76207 6/17/2021 12:41 PM 25 76201 6/17/2021 1:04 AM 26 76209 6/16/2021 10:32 PM 27 76210 6/16/2021 10:19 PM 28 76205 6/16/2021 8:15 PM 29 76227 6/16/2021 7:15 PM 30 76201 6/16/2021 6:56 PM 31 76208 6/16/2021 4:43 PM 32 75068 6/16/2021 4:41 PM 33 76201 6/16/2021 4:35 PM 233 American Rescue Plan Act (ARPA) Survey 4 / 24 34 76209 6/16/2021 3:31 PM 35 76205 6/16/2021 3:29 PM 36 76205 6/16/2021 9:19 AM 37 76205 6/15/2021 4:01 PM 38 76210 6/15/2021 2:18 PM 39 76209 6/14/2021 9:44 PM 40 76201 6/14/2021 8:02 PM 41 76201 6/14/2021 7:43 PM 42 76209 6/14/2021 4:25 PM 43 76201 6/14/2021 2:15 PM 44 76210 6/14/2021 12:33 PM 45 76201 6/14/2021 11:55 AM 46 76226 6/14/2021 11:20 AM 47 76209 6/14/2021 10:09 AM 48 76205 6/14/2021 12:57 AM 49 76210 6/13/2021 9:57 PM 50 76209 6/13/2021 8:27 PM 51 76201 6/13/2021 7:00 PM 52 76210 6/13/2021 5:53 PM 53 76209 6/13/2021 5:36 PM 54 76209 6/13/2021 5:04 PM 55 76209 6/13/2021 3:28 PM 56 76209 6/13/2021 1:58 PM 57 76209 6/13/2021 1:31 PM 58 76205 6/13/2021 12:57 PM 59 76207 6/13/2021 12:12 PM 60 76208 6/13/2021 12:06 PM 61 76205 6/13/2021 10:16 AM 62 76201 6/13/2021 9:53 AM 63 76201 6/13/2021 9:30 AM 64 76201 6/13/2021 9:11 AM 65 76205 6/13/2021 9:04 AM 66 76209 6/13/2021 8:37 AM 67 76209 6/13/2021 8:36 AM 68 76209 6/13/2021 8:14 AM 69 76209 6/13/2021 8:10 AM 70 76210 6/13/2021 7:48 AM 71 76201 6/13/2021 7:42 AM 234 American Rescue Plan Act (ARPA) Survey 5 / 24 72 76209 6/13/2021 7:36 AM 73 76201 6/13/2021 6:56 AM 74 76207 6/13/2021 6:46 AM 75 76210 6/13/2021 4:28 AM 76 76205 6/12/2021 11:52 PM 77 76207 6/12/2021 10:25 PM 78 76210 6/12/2021 7:42 PM 79 76209 6/12/2021 7:27 PM 80 76201 6/12/2021 6:51 PM 81 76209 6/12/2021 6:29 PM 82 76210 6/12/2021 6:22 PM 83 76210 6/12/2021 4:54 PM 84 76201 6/12/2021 4:36 PM 85 76201 6/12/2021 4:31 PM 86 76201 6/12/2021 2:23 PM 87 76210 6/12/2021 2:18 PM 88 76209 6/12/2021 2:03 PM 89 76207 6/12/2021 1:33 PM 90 76201 6/12/2021 1:29 PM 91 76209 6/12/2021 12:04 PM 92 76201 6/12/2021 12:03 PM 93 76201 6/12/2021 10:37 AM 94 76209 6/12/2021 10:01 AM 95 76208 6/12/2021 9:55 AM 96 76209 6/12/2021 9:44 AM 97 76209 6/12/2021 8:56 AM 98 76210 6/12/2021 8:39 AM 99 76209 6/12/2021 8:23 AM 100 76208 6/12/2021 8:18 AM 101 76207 6/12/2021 8:06 AM 102 76202 6/12/2021 7:44 AM 103 76208 6/12/2021 6:55 AM 104 76201 6/12/2021 6:37 AM 105 76209 6/12/2021 6:23 AM 106 76210 6/11/2021 9:27 PM 107 76205 6/11/2021 8:48 PM 108 76208 6/11/2021 5:56 PM 109 76210 6/11/2021 5:29 PM 235 American Rescue Plan Act (ARPA) Survey 6 / 24 110 76226 6/11/2021 2:27 PM 111 76201 6/11/2021 1:47 PM 112 76226 6/11/2021 1:17 PM 113 76209 6/11/2021 12:34 PM 114 76209 6/11/2021 12:13 PM 115 76209 6/11/2021 11:28 AM 116 76201 6/11/2021 10:15 AM 117 76208 6/11/2021 6:50 AM 118 76205 6/11/2021 6:11 AM 119 76205 6/10/2021 10:53 PM 120 76205 6/10/2021 9:48 PM 121 76205 6/10/2021 9:09 PM 122 76209 6/10/2021 10:39 AM 123 76210 6/10/2021 8:52 AM 124 76210 6/10/2021 8:41 AM 125 76201 6/9/2021 10:17 PM 126 76209 6/9/2021 9:53 PM 127 76201 6/9/2021 9:46 PM 128 76209 6/9/2021 9:46 PM 129 76209 6/9/2021 9:35 PM 130 76208 6/9/2021 9:09 PM 131 76209 6/9/2021 8:43 PM 132 76209 6/9/2021 8:38 PM 133 76208 6/9/2021 8:22 PM 134 76207 6/9/2021 8:15 PM 135 76210 6/9/2021 7:49 PM 136 76209 6/9/2021 7:47 PM 137 76209 6/9/2021 7:29 PM 138 76209 6/9/2021 7:11 PM 139 76201 6/9/2021 7:03 PM 140 76205 6/9/2021 6:10 PM 141 76209 6/9/2021 5:53 PM 142 76209 6/9/2021 5:35 PM 143 76208 6/9/2021 5:29 PM 144 76210 6/9/2021 5:16 PM 145 76209 6/9/2021 5:11 PM 146 76205 6/9/2021 5:03 PM 147 76207 6/9/2021 4:46 PM 236 American Rescue Plan Act (ARPA) Survey 7 / 24 148 76210 6/9/2021 4:14 PM 149 76207 6/9/2021 4:01 PM 150 76201 6/9/2021 2:57 PM 151 76226 6/9/2021 2:23 PM 152 76205 6/9/2021 2:08 PM 153 76205 6/9/2021 1:45 PM 154 76209 6/9/2021 1:31 PM 155 76201 6/9/2021 1:19 PM 156 76210 6/9/2021 1:10 PM 157 76210 6/9/2021 12:59 PM 158 76272 6/9/2021 12:28 PM 159 76205 6/9/2021 12:15 PM 160 76209 6/9/2021 12:12 PM 161 76201 6/9/2021 12:05 PM 162 76209 6/9/2021 11:56 AM 163 76207 6/9/2021 11:37 AM 164 76209 6/9/2021 11:36 AM 165 76207 6/9/2021 11:36 AM 166 76209 6/9/2021 11:23 AM 167 76207 6/9/2021 11:16 AM 168 76201 6/9/2021 11:11 AM 169 76209 6/9/2021 11:06 AM 170 76207 6/9/2021 11:04 AM 171 76207 6/9/2021 11:01 AM 172 76207 6/9/2021 11:00 AM 173 76207 6/9/2021 11:00 AM 174 76209 6/9/2021 10:47 AM 175 76209 6/9/2021 9:54 AM 176 76209 6/9/2021 9:23 AM 177 76208 6/9/2021 9:09 AM 178 76209 6/9/2021 8:56 AM 179 76209 6/9/2021 8:36 AM 180 76209 6/9/2021 8:24 AM 181 76210 6/9/2021 8:21 AM 182 76205 6/9/2021 8:16 AM 183 76201 6/9/2021 8:15 AM 184 76209 6/9/2021 7:57 AM 185 76209 6/9/2021 7:45 AM 237 American Rescue Plan Act (ARPA) Survey 8 / 24 186 76226 6/9/2021 7:40 AM 187 76201 6/9/2021 7:39 AM 188 76205 6/9/2021 7:26 AM 189 76209 6/9/2021 6:59 AM 190 76209 6/9/2021 6:11 AM 191 76205 6/9/2021 5:53 AM 192 76209 6/9/2021 2:11 AM 193 76207 6/9/2021 12:40 AM 194 76201 6/8/2021 11:54 PM 195 76201 6/8/2021 11:16 PM 196 76209 6/8/2021 10:57 PM 197 76209 6/8/2021 10:50 PM 198 76209 6/8/2021 10:43 PM 199 76209 6/8/2021 10:37 PM 200 76208 6/8/2021 10:23 PM 201 76201 6/8/2021 10:04 PM 202 76210 6/8/2021 9:13 PM 203 76205 6/8/2021 8:39 PM 204 76201 6/8/2021 8:34 PM 205 76226 6/8/2021 7:42 PM 206 76207 6/8/2021 7:30 PM 207 76207 6/8/2021 7:13 PM 208 76201 6/8/2021 6:59 PM 209 76201 6/8/2021 6:55 PM 210 76208 6/8/2021 6:41 PM 211 76207 6/8/2021 6:32 PM 212 76209 6/8/2021 6:08 PM 213 76205 6/8/2021 5:57 PM 214 76207 6/8/2021 5:53 PM 215 76208 6/8/2021 5:52 PM 216 76209 6/8/2021 5:28 PM 217 76208 6/8/2021 5:20 PM 218 76209 6/8/2021 5:17 PM 219 76209 6/8/2021 5:12 PM 220 76210 6/8/2021 4:56 PM 221 76209 6/8/2021 4:53 PM 222 76209 6/8/2021 4:52 PM 223 76210 6/8/2021 4:51 PM 238 American Rescue Plan Act (ARPA) Survey 9 / 24 224 76209 6/8/2021 4:50 PM 225 76208 6/8/2021 4:49 PM 226 76201 6/8/2021 4:43 PM 227 76209 6/8/2021 4:40 PM 228 76210 6/8/2021 4:25 PM 229 76207 6/8/2021 4:23 PM 230 76208-6014 6/8/2021 4:22 PM 231 76209 6/8/2021 4:20 PM 232 76209 6/8/2021 4:18 PM 233 76205 6/8/2021 4:14 PM 234 76208 6/8/2021 4:12 PM 235 76210 6/8/2021 4:10 PM 236 76210 6/8/2021 4:07 PM 237 76209 6/8/2021 4:06 PM 238 76207 6/8/2021 4:06 PM 239 76205 6/8/2021 4:00 PM 240 76205 6/8/2021 4:00 PM 241 76207 6/8/2021 3:55 PM 242 76201 6/8/2021 3:54 PM 243 76208 6/8/2021 3:50 PM 239 American Rescue Plan Act (ARPA) Survey 10 / 24 Q3 Please rank the following opportunities to use ARPA funds to support public health resources: Answered: 243 Skipped: 0 High Priority Medium Priority Low Priority No Priority Funding to address... Grant assistance f... Funding for vaccine clin... Funding an Emergency... 0%10%20%30%40%50%60%70%80%90%100% 240 American Rescue Plan Act (ARPA) Survey 11 / 24 62.24% 150 21.99% 53 12.03% 29 3.73% 9 241 49.17% 119 35.54% 86 11.16% 27 4.13% 10 242 30.29% 73 35.27% 85 22.41% 54 12.03% 29 241 19.17% 46 39.58% 95 30.42% 73 10.83% 26 240 HIGH PRIORITY MEDIUM PRIORITY LOW PRIORITY NO PRIORITY TOTAL Funding to address homelessness, including temporary and permanent shelters Grant assistance for behavioral healthcare services Funding for vaccine clinic and outreach support Funding an Emergency Management Program Manager 241 American Rescue Plan Act (ARPA) Survey 12 / 24 Q4 Are there any other uses of ARPA funding to support public health resources that you would like the City to consider? Answered: 64 Skipped: 179 #RESPONSES DATE 1 LGBTQIA forward and Sex Worker safe resources 6/19/2021 9:44 AM 2 I perder invest the funding into recovering the economy.6/17/2021 10:18 PM 3 Maybe more mental health and sexual health 6/17/2021 10:12 PM 4 Assistance for children with learning disabilities such as dyslexia as the schools services is not enough for these children. They need help. 6/16/2021 7:15 PM 5 Not at this time 6/16/2021 6:56 PM 6 Go door-to-door Covid vaccines and where nonprofits take care of homeless needs.6/16/2021 4:35 PM 7 The Alternative First Responders program - Would send trained mental health and de- escalation professionals to respond to certain 911 calls, rather than armed police officers. People experiencing mental health crises are 16 times more likely to be killed in police interactions than those who are not. Armed police officers are not trained to help people in crisis, and their presence can be triggering. Investing the extra funding being offered by the federal government to a non-police first responders program would save lives and help people in crisis. 6/16/2021 3:29 PM 8 If you could somehow use it to help make mental healthcare more accessible that would be great. Also support setting up permanent warming/cooling stations for the homeless, and any sort of permanent housing solution for them would be cool. 6/16/2021 9:19 AM 9 Supporting small, local businesses. Supporting the senior population.6/15/2021 4:01 PM 10 Reimburse the general and utility funds for funds used for COVID-related expenditures in 2020 and 2021. Stop funding for homeless who are continuing to come to our city because Council keeps catering to them, while they look away at the increased criminal acts they are committing in our City. 6/14/2021 9:44 PM 11 Mental health 6/14/2021 12:33 PM 12 Assistance for the elderly/disabled 6/13/2021 5:04 PM 13 No 6/13/2021 3:28 PM 14 Give it to people who can't pay their utilities so they don't lose services. Give this money directly to people, not other orgs. 6/13/2021 1:58 PM 15 Health care access to low/no income residents.6/12/2021 11:52 PM 16 Giving residents under a certain income limit. A direct stimulus payment 6/12/2021 2:23 PM 17 No 6/12/2021 2:03 PM 18 Reimbursing citizens tax dollars currently being spent to house and feedi homeless peoplnlong after pandemic crisis dictates. No more Armintor giveaways of my tax dollars. Reimburse taxpayers for money she hijacked. That's equity, not her bs Robin hood method. 6/12/2021 1:33 PM 19 Food Drives and worker livable wage subsidie 6/12/2021 1:29 PM 20 The military retired,people that are getting funds for ssi,which me and my wife she doesen't receive much monthly. with everything that is wrong with here she and other ssi receipent's should receive more funds 6/12/2021 12:04 PM 21 Speed up opening of the new one-stop homeless resource center. Hire a Public Health Director for the city 6/12/2021 9:44 AM 242 American Rescue Plan Act (ARPA) Survey 13 / 24 22 Building sustainable tax revenue by creating a vocational training and certification scholarship fund. Residents unable to find post-pandemic employment should be able to apply for retraining grants and job placement assistance. A rising tide lifts all boats. 6/12/2021 6:37 AM 23 Public Health Director 6/12/2021 6:23 AM 24 Housing and food for low income 6/11/2021 9:27 PM 25 Funding to address food insecurity 6/11/2021 2:27 PM 26 Long Term Sustainable Housing Options for Chronically Homeless and Families effected by poverty and job loss 6/11/2021 1:17 PM 27 Food Resources......is a public health area as well.6/11/2021 12:34 PM 28 Fund additional mental health resources especially counseling, prescriptions, occupational and group therapy. 6/11/2021 11:28 AM 29 Having been unemployed for 16 months and fighting TWC to GET unemployment, I incurred damages from the freeE that insurance feels is settling and cosmetic , but it’s very vast and expensive . I don’t even have funds to rip out dead shrubs. I know the SBA program just ended and FEMA does some things, it would be great to have some tiptoe of help to get some things fixed that I as a single mom cannot so. 6/10/2021 8:52 AM 30 Paying the huge energy bill during the blackouts.6/9/2021 8:22 PM 31 Homelessness 6/9/2021 6:10 PM 32 Affordable housing 6/9/2021 5:35 PM 33 No 6/9/2021 5:29 PM 34 Water and sewer are the building blocks of public health. That option seems to be a high priority. Use federal support to help keep our rates down. 6/9/2021 1:10 PM 35 Finding for public primary & acute care clinics-adult and pediatric 6/9/2021 11:37 AM 36 N/A 6/9/2021 11:36 AM 37 Funding to address hunger in poverty-stricken and/or food-insecure families.6/9/2021 11:23 AM 38 No 6/9/2021 11:16 AM 39 Funding a public health director 6/9/2021 11:06 AM 40 Educating the public regarding continued healthy practices 6/9/2021 11:01 AM 41 Grants for mental health inpatient treatments for kids, teens and adults.6/9/2021 11:00 AM 42 Fund a city of Denton health director to manage current and future health/medical challenges.6/9/2021 9:23 AM 43 Food assistance for families in need 6/9/2021 8:15 AM 44 Affordable housing 6/9/2021 7:40 AM 45 Direct payment to citizens making under $50,000 6/9/2021 7:39 AM 46 provide health care assistance for hard working under paid residents 6/9/2021 5:53 AM 47 Pay for the damages you caused and the businesses you wrecked with your unfounded, criminal shutdowns. 6/9/2021 2:11 AM 48 Transitional and affordable housing options. Tiny home village. More access to community resources. 6/8/2021 10:43 PM 49 A portion of funds should be used for paratransit services like Span and fixed route or on- demand services through DCTA. Low income folks rely on public transportation to reach medical appointments but sanitizing vehicles and reducing capacity of buses not only affects how reliable the service is but also reduces overall service. Funds should be used to help Public Transit agencies get back in their feet. 6/8/2021 10:37 PM 50 address air pollution in Denton 6/8/2021 10:04 PM 243 American Rescue Plan Act (ARPA) Survey 14 / 24 51 More support of the medical reserve Corp 6/8/2021 9:13 PM 52 Awareness in schools - high priority 6/8/2021 6:59 PM 53 Schools as they support kids and staff throughout the pandemic 6/8/2021 6:55 PM 54 The DCPH seems to under staff and what I heard is that a terrible place to work. Over worked and under paid. 6/8/2021 6:41 PM 55 Dental/medical clinic for uninsured/underinsured kids 6/8/2021 6:32 PM 56 No 6/8/2021 5:53 PM 57 Yes, work on stabilizing property taxes. Every year they go up. It is out fo control 6/8/2021 5:52 PM 58 Aid to NGOs and Religious organizations that provide community services 6/8/2021 5:20 PM 59 Ensure the people who respond have the tools to do their jobs well. Ensure they are fully staffed and have the right credentials to impact our community. 6/8/2021 4:49 PM 60 I wish you would have helped Nursing Homes or the families of the people that lost family members. I didn’t seen any help fir Seniors. I know there are Seniors trying to repair there homes from the freeze. 6/8/2021 4:23 PM 61 Combating the spread of conspiracy theories, the support of the Big Lie, and anti-vaccine support 6/8/2021 4:22 PM 62 Help for people who can't afford their meds, especially insulin and others that people literally will die without. 6/8/2021 4:20 PM 63 Better fund the police department’s mental health and homeless outreach units.6/8/2021 4:10 PM 64 Benches for bus stops, rain coverings for benches for bus stops, sidewalks, and rental assistance grants. 6/8/2021 4:00 PM 244 American Rescue Plan Act (ARPA) Survey 15 / 24 Q5 Please rank the following opportunities to use ARPA funds to address negative economic impacts from the pandemic: Answered: 242 Skipped: 1 High Priority Medium Priority Low Priority No Priority (no label) Financial support to... Grant assistance... Grant assistance... 0%10%20%30%40%50%60%70%80%90%100% 245 American Rescue Plan Act (ARPA) Survey 16 / 24 34.30% 83 47.11% 114 14.46% 35 2.48% 6 1.65% 4 242 52.89% 128 35.12% 85 10.74% 26 1.24% 3 0.00% 0 242 29.34% 71 31.82% 77 28.51% 69 7.85% 19 2.48% 6 242 HIGH PRIORITY MEDIUM PRIORITY LOW PRIORITY NO PRIORITY (NO LABEL) TOTAL Financial support to nonprofit organizations Grant assistance programs for small businesses Grant assistance programs supporting local music and arts 246 American Rescue Plan Act (ARPA) Survey 17 / 24 Q6 Are there any other uses of ARPA funding to address negative economic impacts of the pandemic that you would like the City to consider? Answered: 68 Skipped: 175 #RESPONSES DATE 1 Aid vulnerable populations most severely affected by the pandemic 6/19/2021 9:44 AM 2 Utility assistance to those unemployed due to business layoffs or failures as a result of COVID-19. Property tax abatements for residential property owners unemployed as a result of COVID-19. 6/17/2021 11:38 PM 3 Funding for upgrading and developing infrastructure. Funding for develop emergency reaction plan in response to winter storm, flood, tornado, and other natural disasters. 6/17/2021 10:18 PM 4 Maybe towards utilities and updating outdated infrastructures which we rely on 6/17/2021 10:12 PM 5 Single homeowners mortgage and renters assistance. A year without a peppery tax increase for homeowners. 6/17/2021 8:16 PM 6 Continue to give free lunches to school age kids. Support teachers and update local schools 6/17/2021 1:36 PM 7 Keep businesses fully open, help small business by letting them stay open at full capacity. Small businesses suffered the most during the "pandemic". Do not drive things by fear. Let citizens take care of their own health. if you want to address "public health", let's talk about what we are putting into our bodies, get outside and exercise, let's not put bandaids on our health issues, but fix the root causes. We know that co-morbidities were a leading factor in cover, why don't we as a city make healthy habits and change our overall health. But our national debt is through the roof, if we don't actually need the money, I would send it back. If we want to help the future or our kids, keep the debt down so we don't have outrageous taxes. 6/17/2021 12:53 PM 8 Help with financing prescriptions & getting to see doctors to receive prescriptions.6/16/2021 4:35 PM 9 Alternative First Responders program that would send trained mental health and de-escalation professionals to respond to certain 911 calls, rather than armed police officers. People experiencing mental health crises are 16 times more likely to be killed in police interactions than those who are not. Armed police officers are not trained to help people in crisis, and their presence can be triggering. Investing the extra funding being offered by the federal government to a non-police first responders program would save lives and help people in crisis. 6/16/2021 3:29 PM 10 Grants to small businesses would be cool, maybe also reach out to the small businesses that had to close down and see if a grant could help them reopen? We lost a lot of Denton gems, so just an idea to maybe get them back. 6/16/2021 9:19 AM 11 Job training to those who lost jobs and need updated skillls and updating infrastructure.6/13/2021 3:28 PM 12 Get broadband internet all over the city and don't charge people for it. Feed hungry people, house the unhoused. 6/13/2021 1:58 PM 13 Invest in broadband infrastructure for the love of God!!!!!!!!6/13/2021 12:06 PM 14 More support and marketing dollars in Denton for Tourism and Conventions to help support the devastation to the local hotel and hospitality industry. 6/13/2021 9:53 AM 15 Supports and services for children and people with disabilities. They were highly affected by the pandemic. 6/13/2021 8:10 AM 16 Grants to help working parents with childcare costs 6/13/2021 4:28 AM 17 City outreach to the homeless and almost homeless in Denton that does not depend on NGO’s. City funded outreach will help to connect them directly to the services they needs 6/12/2021 11:52 PM 247 American Rescue Plan Act (ARPA) Survey 18 / 24 18 Please fund secular nonprofits. I find it un-American that most of the social services here seem to be via by religious organizations who are able to discriminate in who they serve, if they want to. 6/12/2021 6:51 PM 19 Offer grants to help businesses closed because of COVID to reopen.6/12/2021 6:29 PM 20 Grant assistance to a stimulus for low income Dentonites.6/12/2021 4:36 PM 21 Direct stimulus to residents. I'm a self employed resident who did not qualify for unemployment. It took months for rent and electric assistance to be received. The decisions of the less fortunate residents should not be made by those who did not suffer. And the City of Denton council members did not struggle. To make matters worse, you shut our power off in one of the worst storms Texas has seen. Yet you keep allowing new sub divisions and apartments to be built. Try focusing on the residents you have, before adding more to a struggling system. 6/12/2021 2:23 PM 22 Put on a small business and local arts event where people can show off their talent and businesses and people can spend their money in the community 6/12/2021 2:18 PM 23 No 6/12/2021 2:03 PM 24 Reumburse city and taxpayers for money fronted from general fund paid by taxpayes advanced for the care and feeding of homeless people, and reimburse the victims of criminal acts at the hands of homeless people whom Armintor continues to invite to pollute our parks and our communities. 6/12/2021 1:33 PM 25 I should be receiving more military retired.6/12/2021 12:04 PM 26 Fix our power stations. And our natural gas stations.6/12/2021 10:37 AM 27 PPP helped many small business owners support their staff. However, those funds were designated as pass-through to staff. Owners were completely excluded and my industry (bar/restaurant) was punished harder than any. The owners of these businesses need cash to catch up on their personal and business mortgages, auto financing, and everything else they were forced to abandon paying in 2020. 6/12/2021 9:55 AM 28 Support for eviction prevention 6/12/2021 9:44 AM 29 Public parks 6/12/2021 8:18 AM 30 Stimulus for residents.6/12/2021 6:55 AM 31 Create a small business pandemic grant program. Only small businesses with less than 50 employees and located in Denton should be eligible. The grants should also fund Denton-based entrepreneurs interested in starting new businesses. 6/12/2021 6:37 AM 32 Rental and medical expenses for low income 6/11/2021 9:27 PM 33 Grocery costs are increasing significantly and household economics will be negatively impacted. Therefore FOOD (a lowest common denominator on the survival scale) will become important. Access to healthy food to keep families nourished is an economic impact to families and the non-profits assisting low income and struggling households due to the impact Covid is having on our economy, etc. 6/11/2021 12:34 PM 34 Payoff debt of nonprofit agencies so more operating funds are available for services. Paying off debt doesn't require sustainment funding as new programs do. 6/11/2021 11:28 AM 35 street improvement!6/10/2021 9:48 PM 36 you need to shore up the police and fireman;s pension funds. So the young recruits have a reason to stay and build a solid career 6/10/2021 9:09 PM 37 Unemployment being cut off for so many abs Abbott opting out of program will definitely hurt myself And many people I know 6/10/2021 8:52 AM 38 If rising property taxes are in any way pandemic related, some relief there is a HIGH priority. People moving here from states with outrageous property values are able to pay outrageous prices here, over-inflating our values and subsequent taxes to the point we can't even afford to stay. 30+ year residents. 6/10/2021 8:41 AM 39 Raise local wages and lower property taxes for housing. Anything to supplement incomes and 6/9/2021 10:17 PM 248 American Rescue Plan Act (ARPA) Survey 19 / 24 provide permanent affordable housing for people in crisis and also to prevent such crises in the local community. 40 Support pedestrian and alternative vehicle transportation, which saw increase during the pandemic. Easing walkability helps the community as a whole and becomes part of our network. Economic woes will continue for many and they will be back some day for all of us. 6/9/2021 7:03 PM 41 Affordable housing 6/9/2021 5:35 PM 42 No 6/9/2021 5:29 PM 43 Attempting to mitigate some of the rent and mortgage arrears that are now coming due with the lifting of eviction moratoriums. Like offering assistance to landlords, if they forgive an equal amount of outstanding rent. e.g. Renter owes $1500, city grants landlord $750, landlord forgives the remaining $750 and the renter's slate is clean. 6/9/2021 2:23 PM 44 Childcare cost assistance 6/9/2021 12:15 PM 45 Replace lost revenue rather than leaning on property owners to shoulder the entire responsibility. It’s absolutely appalling that taxes rose at all this year, but that they rose the level they did, when people are already struggling, is inhumane AT BEST. I also feel that women have been disproportionately affected financially and I would love to see programs that help mitigate continued harm and help shrink the gap in income that only widened over the last 18 mos. 6/9/2021 11:23 AM 46 No 6/9/2021 11:16 AM 47 Continued funding of food programs for struggling families 6/9/2021 11:01 AM 48 Grants for childcare and early childhood education for infants-preschoolers aged children to have access to early education. 6/9/2021 11:00 AM 49 Invest in broadband infrastructure 6/9/2021 9:23 AM 50 Give to THE PEOPLE, not the businesses. The people were hit the hardest, not the businesses or nonprofits. Grants for home owners. "Denton Cash" given to all taxpayers for spending at local stores. Free food, childcare, or financial literacy classes. Or perhaps just a break on our house taxes? 6/9/2021 8:56 AM 51 Teachers deserve a bonus if the city has the ability to give it!6/9/2021 8:24 AM 52 Direct payments to essential workers 6/9/2021 8:15 AM 53 N/A 6/9/2021 7:40 AM 54 How about letting citizens decide their own priority and give them the money. Everyone’s priorities are not the same 6/9/2021 7:39 AM 55 help small business! Give to those who work or want to work. Use the money in a way to create employement opportunities 6/9/2021 5:53 AM 56 Hi, If you are reading this thank you. The pandemic was hard yet the amount of wild life you are tearing down with the new high way system not to mention how the rodents are pushed closers to homes and affecting our health even more. I hope you are reading this, cause if you are and no chances are made. Than I will Personally start getting involved. I will not stand for the injustice for the people of this town and the nature that is protected by United States law. Together we can build a legacy that can last, with your economical Growth well all be the rats that crawl out the sewer. Wake up Denton. The people are Hungry. 6/8/2021 11:16 PM 57 Job fairs and training or paid internship opportunities. Partial reimbursement of pay to employers for offering a higher wage. 6/8/2021 10:43 PM 58 Public transportation has taken a huge hit from COVID. Not only is it a wonderful alternative to driving, it is necessary for many low income and struggling families! Let’s help folks out! 6/8/2021 10:37 PM 59 rent relief for out of work people who may be kicked out of apartments 6/8/2021 10:04 PM 60 Rent assistance 6/8/2021 6:59 PM 61 School systems 6/8/2021 6:55 PM 62 Give a tax break to small business.6/8/2021 6:41 PM 249 American Rescue Plan Act (ARPA) Survey 20 / 24 63 Make sure Denton residents won't have to pay for ERCOT fiasco, have money stashed or given to Denton municipal. Find a loophole, you people are good at it 6/8/2021 5:53 PM 64 - public transportation - childcare 6/8/2021 5:17 PM 65 Small Business is where the lifeblood of our community is. It employs and lifts up others in the community. 6/8/2021 4:49 PM 66 I would like the city to educate the citizens so many are still in fear.6/8/2021 4:23 PM 67 Supporting the changing of the archaic alcohol laws. Such as beverage limits directly from the producers and the crazy whiskey laws (no mail order, no liquor bottle sales on Sunday, etc) What about attracting affordable higher speed broadband to Denton. Especially south Denton? 6/8/2021 4:22 PM 68 Small businesses are leaving denton because of high taxes and rent due to corporate buy out. It seems denton could care less about your citizens. The vaccine support seems to be well funded due to the success of the tms drive thru clinic. Not sure why denton would need more funding for the public health department. Although i did her dcph over worked their employees during the pandemic. Behavioral health is a hugely underfunded area in denton and coupled with high homeless population this should be a high priority. 6/8/2021 4:00 PM 250 American Rescue Plan Act (ARPA) Survey 21 / 24 Q7 While the questions above related to supporting public health resources and reducing the negative economic impacts of the pandemic, do you have any other feedback or input regarding uses for the funding that fit within the four qualifying areas of:1. Respond to COVID-19 or its Economic Impacts;2. Replace revenues lost due to COVID-19;3. Provide premium pay to eligible essential workers; and4. Invest in water, sewer, storm water, and broadband infrastructure.Note: More information about ARPA local government assistance can be found at the U.S. Treasury Department. Answered: 71 Skipped: 172 #RESPONSES DATE 1 Assistance to small local business owners who started businesses during COVID. Theses businesses cannot show loss as they were not open prior to the event and as such cannot participate in most assistance programs. 6/18/2021 6:05 PM 2 Invest in water, sewer, storm water, and broadband infrastructure.6/18/2021 5:02 PM 3 Water infrastructure and the safety of our citizens when we have to drive down flooded roads when it rains here. And invest the majority of the funds into capital goods such as infrastructure. 6/17/2021 10:12 PM 4 4. Invest in water, sewer, storm water, and broadband infrastructure. Recycling.6/17/2021 8:16 PM 5 3 and 4 6/17/2021 3:26 PM 6 invest in infrastructure.6/17/2021 2:30 PM 7 Our city infrastructure is extremely important - hope this includes electrical grid and streets.6/17/2021 12:46 PM 8 Provide services for those unable to obtain like homeless. Pay essential workers more and front line workers 6/16/2021 4:41 PM 9 Replace revenues lost due to Covid-19.6/16/2021 4:35 PM 10 Oh that broadband idea is cool - there's a state law that makes municipal broadband illegal, but some cities have figures out a loophole for it. Maybe have staff dig into that and see if we could do municipal fiber to every home? Would attract people that work remotely for companies, would help educate everyone, and would make internet more affordable. 6/16/2021 9:19 AM 11 While it is not pandemic related, grant funding should go toward securing the energy and water/wastewater resources, especially cybersecurity. 6/14/2021 4:25 PM 12 Definitely investing in water, sewer, storm water, and broadband infrastructure. Water safety especially is a concern, given the amount of fracking happening around Denton, and the recent storms have shown that storm water infrastructure is equally important. 6/14/2021 2:15 PM 13 Replace the Hotel Occupancy Tax shortage that has occurred to help those organizations that receive them have ability to get their funding back to pre-Covid levels. 6/13/2021 9:53 AM 14 Update infrastructure 6/13/2021 9:30 AM 15 If you can figure out a way to relate it to storm water, it would be nice to have more sidewalks so we don't have to walk on the streets. 6/13/2021 8:37 AM 16 Invest in infrastructure but with efficient outcomes. Currently, most infrastructure outcomes are taking too long. Focus on enhancing the lives of people with disabilities by making the city 6/13/2021 8:10 AM 251 American Rescue Plan Act (ARPA) Survey 22 / 24 more accessible. 17 Pay increases to teachers and police.6/13/2021 7:42 AM 18 Behind homelessness and mental health, I see a need for infrastructure all around the community. 6/13/2021 6:46 AM 19 Broadband infrastructure would be nice. Right now where I live we are only given one service provider option. 6/13/2021 4:28 AM 20 There is an incredible need for distributed broadband in Denton. Our world had moved online, even before the pandemic. Without free internet access, residents would not be able to participate in forums such as this. Creating a citywide wireless system, would not only connect low/no income residents, but would cut down on data fees for students and families, and be a draw for business. 6/12/2021 11:52 PM 21 Fund projects that will make Denton more sustainable (reduce greenhouse gas emissions and pollution, increase pedestrian and bicyclist access, increase recycling, limit increases in impermeable surfaces, etc.). All development and economic support in the city should have sustainability built in, so that Denton remains livable. 6/12/2021 6:51 PM 22 Do whatever you can to get as many homeowners as possible to use solar. That is the only way our old, outdated grid will get through the periods of high usage. 6/12/2021 6:29 PM 23 Nowhere in those questions posed did you ask for feedback regarding #2, that's why I chose to reply with REIMBURSE THE TAXPAYERS, REIMBURSE THE CITY, not create a surplus of money and create excuses to spend it. It is designed to reimburse, so do that, or invest in universal public infrastructure upgrades that need BENEFIT ALL CITIZENS, not the homeless Armintor consistently invites and gifts with our tax dollars. 6/12/2021 1:33 PM 24 Please give us a livable wage or food I don't care about anything else 6/12/2021 1:29 PM 25 Providing income for ACTUAL first responders: Teachers! We went back to work before the majority of everyone else and received ZERO support from local or federal government. It is high time we are considered an essential worker, and paid accordingly. I think most parents who had to stay home and homeschool their children for the first time would agree! 6/12/2021 12:03 PM 26 Fixing our electrical stations 6/12/2021 10:37 AM 27 PPP helped many small business owners support their staff. However, those funds were designated as pass-through to staff. Owners were completely excluded and my industry (bar/restaurant) was punished harder than any. The owners of these businesses need cash to catch up on their personal and business mortgages, auto financing, and everything else they were forced to abandon paying in 2020. 6/12/2021 9:55 AM 28 Invest in our power grid 6/12/2021 9:44 AM 29 Investment in water, sewer etc. infrastructure is always an important investment, especially if there are extra funds. 6/12/2021 8:39 AM 30 Invest in water sewer 6/12/2021 8:06 AM 31 Build back better by using funds to support employment and small businesses.6/12/2021 6:37 AM 32 Coordinated drainage and other projects necessary to encourage development investment in targeted areas (south of downtown with PEC-4, etc.). 6/11/2021 8:48 PM 33 N/A 6/11/2021 2:27 PM 34 Please make funding available to the local non-profits that already deal with the households on a regular basis. Try to avoid creating new organizations to re-invent the solution. Thank You. 6/11/2021 12:34 PM 35 Invest in infrastructure . I have a huge problem with surface water running onto my property and causing damage to my foundation, yard and home . My son and I can’t utilize most of the year 6/10/2021 8:52 AM 36 To the extent #4 improvements are needed and not otherwise funded, yes, improve our infrastructure. 6/10/2021 8:41 AM 37 High priority-tradional infrastructure streets, water, sewer 6/9/2021 7:49 PM 252 American Rescue Plan Act (ARPA) Survey 23 / 24 38 Stop encouraging poor behaviors and support the people who went to work through the whole pandemic shutdown 6/9/2021 7:11 PM 39 Yes. Refunds or direct investment in sewer and water lines, especially in older parts of the city.6/9/2021 7:03 PM 40 I think there's enough other monies and opportunities for money, when ur comes to infrastructure, that the ARPA monies should remain focused on stabilizing families and family businesses here in our city. I do not support it's use with regard to infrastructure. 6/9/2021 6:10 PM 41 Affordable housing 6/9/2021 5:35 PM 42 Increase access to low cost, high quality broadband access. It increases economic opportunities and access to essential resources and services. 6/9/2021 5:29 PM 43 I observed many people over the past year struggling to afford car expenses in order to access or maintain employment. We need to invest in infrastructure to allow people to safely move about the city without a car. Focus on building safe walking/biking routes between lower income areas and major employment centers. 6/9/2021 2:57 PM 44 $ to those who lost jobs during covid. Extend shelter to include weekends. Bonus to essential workers. 6/9/2021 2:08 PM 45 Water and sewer were left off the public health section.6/9/2021 1:10 PM 46 4.use the overwhelming majority of funding here-water,sewer,storm water. also add for road repair/expansions, police and fire services, landfill and refuge disposal. 6/9/2021 11:37 AM 47 There isn’t room to address that “nonprofit” is a huge category and I don’t think that it’s possible to approve or disapprove without clarifying which nonprofits. I am also deeply suspicious of a lot of behavioral health services because they tend to be predicated upon condescension, if not outright hostility, towards mentally ill and neurodivergent people. 6/9/2021 11:36 AM 48 Infrastructure for sure. Storm water is a big issue for me personally, but I don’t know how widespread the issue is. It would be great if the city created a drainage system instead of leaving me to deal with water from the entire neighborhood running through my yard and causing damage at *my* expense. Especially since your “repairs” have only made the problem worse. However, I think we have firmly established that broadband is crucial to disaster management and it’s about time we finally develop it as a public utility for the good of the entire city. 6/9/2021 11:23 AM 49 Providing Healthcare workers including fire persons and EMT with top pay and investing in our infrastructure 6/9/2021 11:01 AM 50 Mental health at a child's level is ignored regularly in our city. I would like to see an initiative to promote children's mental health. Current evidence shows a surge in anxiety and depression among children and adolescents since the pandemic began. Given the extent to which the pandemic has exacerbated challenges that already existed, we cannot afford to wait any longer to build an effective system that promotes children’s mental health. These children our our future leaders, take action now! 6/9/2021 11:00 AM 51 If govt employees were not given their cost of living increase last year, that needs to be a priority. 6/9/2021 8:56 AM 52 Be sure that 'priorities' are GENUINE priorities. Pouring money into music and arts is NOT a priority. Small business, non-profits, and teachers ARE priorities. Choose wisely - the residents are watching. 6/9/2021 8:24 AM 53 #4 is critical, get this fixed before you give money to non-profits and the arts. Also, broadband should be available to all, just like electricity. 6/9/2021 7:57 AM 54 Replace revenues lost during covid-19 to individuals or those with small businesses, premium pay to eligible essential workers (including teachers, grocery workers, and food workers), invest in infrastructure 6/9/2021 7:45 AM 55 Give it to the people. It’s our money to begin with.6/9/2021 7:39 AM 56 Additional rental assistance to get families living in hotels or other temporary housing arrangements back into permanent housing. (Paying deposits and at least first month's rent.) 6/8/2021 10:43 PM 57 Increasing access to internet for low income and minority groups in Denton is essential! We all 6/8/2021 10:37 PM 253 American Rescue Plan Act (ARPA) Survey 24 / 24 saw how some families were disproportionately affected by at-home learning. Access to education via accessible and free internet should be expanded. 58 infrastructure investments. create a tax-free development zone for financial services and tech startups. partner with universities and high schools to take on students into apprenticeships with city infrastructure workers (plumbers, road work, surveying, electrical, etc.) 6/8/2021 10:04 PM 59 Fix our electrical grid so no more power outrages!6/8/2021 8:39 PM 60 Provide premium pay to eligible essential workers 6/8/2021 8:34 PM 61 broadband infrastructure for low income public school students 6/8/2021 7:13 PM 62 Essential workers worked thru the pandemic and yet they won't get raise because of the pandemic. A lot of the these workers got covid-19 because they had to go to work, while many worked from home. Compensate these workers. 6/8/2021 6:41 PM 63 Grants or rebates for broadband services for all households with DISD students.6/8/2021 6:32 PM 64 Be transparent and accountable. Acknowledge the source of the money is not directly from taxes or the State of Texas. 6/8/2021 5:20 PM 65 I highly support an investment in city broadband infrastructure.6/8/2021 5:17 PM 66 INVEST IN INFRASTRUCTURE.6/8/2021 4:49 PM 67 I would like sone of the funds be used to upgrade our water system so we don’t have to turn off water if we have another bad freeze. Upgrade those facilities. Our Infrastructure always need upgrading. 6/8/2021 4:23 PM 68 I’m all for better wages for essential workers and improving our broadband infrastructure! Also, I’d like to see more “pressure” (positive, of course) on residents to get their Covid vaccine. 6/8/2021 4:22 PM 69 I think that investment in broadbrand to get equitable access to the internet for all residents should be the top priority. Then water, drainage and sewer infrastructure should be tackled. This is a golden opportunity to improve basic public services. Denton has high rates of sewer backups which put burdens on low income households. Denton's water system could use bolstering as evidence by the boil water notice issued during the winter storm. Before granting out money I would focus on these basics services to all residents. 6/8/2021 4:14 PM 70 Pay people to get vaccinated so we can reach herd immunity. 23.29Million is roughly $115 per person that gets vaccinated; just tell people they can use the $115 towards their future DME bill from Snovid 2020. https://www.npr.org/2021/01/13/955594105/should-the-government-pay- people-to-get-vaccinated-some-economists-think-so 6/8/2021 4:06 PM 71 You need to prioritize basic infrastructure like stop buying land and building apartments all over denton county without first thinking about the road conditions and population explosion. If denton could use this money to fix these issues instead of constantly letting developers build first worry later we wouldn't have wrecks all the time and terrible flooding during rainy seasons, pot holes and traffic jams. 6/8/2021 4:00 PM 254 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-966,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a funding agreement with Denton Community Food Center to provide Community Development Block Grant- Coronavirus funds for public facility improvements in Denton,Texas;authorizing the expenditure of funds in an amount not to exceed $439,483.00; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™255 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Community Services CM/ DCM/ ACM: Sara Hensley, Interim City Manager DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a funding agreement with Denton Community Food Center to provide Community Development Block Grant- Coronavirus funds for public facility improvements in Denton, Texas; authorizing the expenditure of funds in an amount not to exceed $439,483.00; and providing an effective date. BACKGROUND Denton Community Food Center (DCFC) is a nonprofit agency that assists persons with food insecurity. DCFC was founded in 1974 with a mission to provide food from a central community store house to individuals and families who are struggling with hunger insecurity. With the event of the COVID-19 pandemic, the center went from allowing applicants/clients requesting food six times each year and no more than once per calendar month to allowing clients to come every two weeks or 24 times a year. The food pantry is open 2-3 days per week for food distribution. DCFC volunteers bring food (about 100 pounds) to the clients’ vehicle. For the duration of the pandemic, the food pantry serves all clients from Denton city and county, as well as DFW and surrounding areas, who visit DCFC requesting food from the Serve Denton campus location. Currently, seventy-one percent of clients reside within the city limits of Denton. The food is purchased from retail suppliers and donated, and most of the protein comes from the Tarrant Area Food Bank. The DCFC serves individuals and families regardless of race, ethnicity, or age. This diverse cross-section of clients includes the low-income working poor, veterans, and the homeless, and people who are recipients of Federal programs such as SNAP/Food Stamps, Temporary Assistance for Needy Families, Supplement Security Income, National School Lunch Program, and Medicaid, among others. DCFC follows the income eligibility guidelines as specified by the Emergency Food Assistance Program. The DCFC proposes to assist 21,000 unduplicated people during the 2021-22 fiscal year. A majority of the clients at 99.97% are at or below 80% of the Area Median Income. Project Description The project consists of expanding the Denton Community Food Center to help grow the food distribution capacity to provide food from a central community storehouse to needy families struggling with hunger insecurities. Community Development Block Grant – Coronavirus funds will add a 4,500 square feet addition to the Denton Community Food Center and installation of sidewalks leading to the proposed addition and along Loop 288. Denton Community Food Center is located at 306 N. Loop 288 in Denton. The Denton Assistance City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 256 Center Inc, d/b/a Serve Denton owns the Denton Community Food Center where the project site is located. Denton Community Food Center leases from Serve Denton with a term of 99 years. Denton Community Food Center and Serve Denton has entered into a development agreement for Serve Denton to manage the construction of the addition and other administrative tasks. Serve Denton will own the addition and, effective upon completion of the addition, the Denton Community Food Center current lease with Serve Denton will be amended to add the addition to the lease. Project Funding Program Year 2020-21 Community Development Block Grant-Coronavirus (CDBG-CV) funds are budgeted for the project. The Community Development Advisory Committee recommended approval of funding for improvements to the Denton Community Food Center. Funding for the project was included in City’s Second Substantial Amendment to the 2020 Action Plan for Housing and Community Development. City Council approved the Second Substantial Amendment to the 2020 Action Plan for Housing and Community Development with Ordinance No. 21-504 on May 4, 2021. The U.S. Department of Housing and Urban Development (HUD) approved the amendment to the Action Plan in June 2021. The final agreement, as recommended by staff, is now being submitted to the City Council for approval. Community Development staff costs to monitor construction, labor standards compliance, and annual monitoring are paid through CDBG administration funds. OPTIONS • Approve the funding agreement; • Not approve the funding agreement. ESTIMATED SCHEDULE OF PROJECT • City Council considers approval of Funding Agreement – July 27, 2021 • Denton Community Food Center completes the scope of work and competitive bidding process – August/September 2021 • Begins construction of an addition to Denton Community Food Center – October 2021 • Completion of all improvements – March 2022 • Community Development monitors for CDBG-CV compliance through quarterly reporting requirements and onsite inspection until July 2031 EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Ordinance-Agreement Respectfully submitted: Danielle Shaw Community Services Manager Prepared By: Luisa Garcia Community Development Coordinator 257 ORDINANCE NO. 21-966 AN ORDINANCE OF THE CITY OF DENTON AUTHORIZING THE CITY MANAGER TO EXECUTE A FUNDING AGREEMENT WITH DENTON COMMUNITY FOOD CENTER TO PROVIDE COMMUNITY DEVELOPMENT BLOCK GRANT-CORONAVIRUS FUNDS FOR PUBLIC FACILITY IMPROVEMENTS IN DENTON, TEXAS; AUTHORIZING THE EXPENDITURE OF FUNDS IN AN AMOUNT NOT TO EXCEED $439,483.00; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, pursuant to Ordinance No. 21-504, the City Council approved the Second Substantial Amendment to the City’s 2020 Action Plan for Housing and Community Development that included an authorized budget expenditure of $439,483.00 in Community Development Block Grant-Coronavirus (“CDBG-CV”) funds for public facility improvements for Denton Community Food Center; and WHEREAS, the Denton Community Food Center has developed a program to assist families with food insecurities; and WHEREAS, Denton Community Food Center has outgrown its current facility at 306 North Loop 288, Suite 400, and wishes to expand by adding an addition and sidewalk improvements to this facility (the “Project”); WHEREAS, the City and Denton Community Food Center desire to enter into an Agreement, attached hereto as Exhibit A and incorporated herein for all purposes, to provide CDBG-CV funds for the Project in an amount not to exceed $439,483.00 (the “Agreement”); and WHEREAS, the City Council deems it in the public interest to enter into the Agreement in support of much needed services for Denton residents; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The findings and recitations in the preamble of this ordinance are incorporated herein by reference as true and as if fully set forth in the body of this ordinance. SECTION 2. The City Manager, or designee, is hereby authorized to execute the Agreement with Denton Community Food Center. SECTION 3. The City Manager, or designee, is hereby authorized to expend funds in an amount not to exceed $439,483.00 in the manner specified in the Agreement, and to take any other actions that may be necessary or convenient, in the reasonable opinion of either the City Manager or the City Attorney, to carry out the City’s rights and obligations under the Agreement. SECTION 4. This ordinance shall become effective immediately upon its passage and approval. 258 Page 2 The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. The ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _______ day of _______________________, 2021. ______________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: _________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: _________________________________ Kendra Kennedy 259 Page 3 EXHIBIT A AGREEMENT BETWEEN THE CITY OF DENTON AND DENTON COMMUNITY FOOD CENTER This Agreement is made and entered into by and between the City of Denton, a Texas home-rule municipal corporation, hereinafter referred to as CITY, acting by and through its City Manager, pursuant to Ordinance No. 21-966, and Denton Community Food Center located at 306 North Loop 288, Suite 400, Denton Texas 76209 (the “Project Site”), a Texas non-profit corporation, hereinafter referred to as SUBRECIPIENT. WHEREAS, CITY has received certain funds from the U.S. Department of Housing and Urban Development (“HUD”) under the Coronavirus Aid, Relief and Economic Security Act. WHEREAS, the City Council approved the Second Substantial Amendment to 2020 Action Plan for Housing and Community Development which includes an authorized budget expenditure of funds for a public facility project for SUBRECIPIENT; and WHEREAS, the SUBRECIPIENT has developed a program to assist families with food insecurities; and WHEREAS, SUBRECIPIENT has outgrown the Project Site and wishes to expand the Project Site by adding a 4,500 square foot addition and sidewalk improvement to the Project Site to store food and specialized equipment for food distribution (the “Project”); and WHEREAS, Denton Assistance Center Inc, d/b/a Serve Denton (“Serve Denton”) owns the building at which the Project Site is located; and WHEREAS, SUBRECIPIENT leases the Project Site from Serve Denton under a lease dated July 30, 2018, as amended, with a term of 99 years; and WHEREAS, SUBRECIPIENT and Serve Denton intend to enter into a development agreement pursuant to which Serve Denton will manage the construction of the Project and certain administrative tasks on behalf of SUBRECIPIENT; and WHEREAS, Serve Denton will own the addition and, effective upon completion of the Project, SUBRECIPIENT’s current lease with Serve Denton will be amended to add the addition to the lease; and WHEREAS, the City Council deems it in the public interest to enter into an agreement for a public facility project that will support much needed services for Denton residents; and WHEREAS, CITY has designated Community Services as the department responsible for the administration of this Agreement and all matters pertaining thereto; NOW, THEREFORE, the parties hereto agree, and by the execution hereof are bound, to the mutual obligations and to the performance and accomplishment of the terms and conditions hereinafter described. 260 Page 4 1. TERM This Agreement shall commence on or as of August 1, 2021, and shall terminate on July 31, 2022, unless sooner terminated in accordance with Section 25 “Termination.” 2. RESPONSIBILITIES A. The CITY’s Community Services Manager will be CITY’s representative responsible for the administration of this Agreement. B. SUBRECIPIENT hereby accepts the responsibility for the performance of all services and activities described in the Scope of Services attached hereto as Exhibit A, and incorporated herein by reference, in a satisfactory and efficient manner as determined by CITY, in accordance with the terms and conditions herein. SUBRECIPIENT may perform the obligations, services and activities under this Agreement itself or may contract with Serve Denton to perform certain of such obligations, services or activities on SUBRECIPIENT’s behalf; however, SUBRECIPIENT shall be and remain directly responsible to CITY under this Agreement for the performance of all obligations, services and activities hereunder and SUBRECIPIENT shall be responsible for ensuring the compliance of Serve Denton with the applicable terms and conditions of this Agreement. CITY will consider SUBRECIPIENT’s executive officer to be SUBRECIPIENT’s representative responsible for the management of all contractual matters pertaining hereto, unless written notification to the contrary is received from SUBRECIPIENT and approved by CITY. C. SUBRECIPIENT certifies that the activities carried out with Community Development Block Grant (“CDBG”) funds shall meet the CDBG program’s National Objective of benefit to low and moderate-income persons. The majority of beneficiaries of the activities to be provided hereunder must reside in the City of Denton. SUBRECIPIENT shall provide services to persons whose income is equal to or lower than 80% of the area median income of the Dallas standard metropolitan statistical area. To accomplish this, the SUBRECIPIENT shall use the applicable income limits published by HUD for lower income housing assistance under Section 8 of the United States Housing Act of 1937 and updated by HUD annually SUBRECIPIENT must use the most current HUD Income limits. Income eligibility shall be determined by the sum of the gross income of all individuals residing in the household. Services must be provided directly to or on behalf of specific identified eligible clients. Eligibility documentation must be included in each client’s file and updated annually, or services must be provided to a clientele that is within a “presumed benefit” category as specified in 24 CFR 570.208. 3. OBLIGATIONS In consideration of the receipt of funds from HUD, CITY agrees to the following terms and conditions: A. Limit of Liability. CITY will reimburse SUBRECIPIENT for expenses incurred pursuant to and in accordance with the Project Budget attached hereto as Exhibit B and the Scope of Services herein attached as Exhibit A and incorporated herein by reference. Notwithstanding any other provision of the Agreement, the total of all payments and other obligations made or incurred by CITY hereunder shall not exceed the sum of Four Hundred Thirty-Nine Thousand Four Hundred Eighty-Three and no/100 Dollars ($439,483.00). B. Measure of Liability. In consideration of full and satisfactory performance of the services and activities hereunder by SUBRECIPIENT and receipt of a requisition for payment with appropriate documentation of expenditures, CITY shall make payments to SUBRECIPIENT 261 Page 5 based on the Project Budget in Exhibit B, subject to the limitations and provisions set forth in this Section and Section 7 of this Agreement. Payments may be contingent upon certification of the SUBRECIPIENT’s financial management system in accordance with the standards specified in 2 CFR Part 200 Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards. (1) The parties expressly understand and agree that CITY’s obligations under this Section are contingent upon the actual receipt of adequate CDBG funds to meet CITY’s liabilities under this Agreement. If adequate funds are not available to make payments under this Agreement, CITY shall notify SUBRECIPIENT in writing within a reasonable time after such fact has been determined. CITY may, at its option, either reduce the amount of its liability, or terminate the Agreement. If funds eligible for use for purposes of this Agreement are reduced, CITY shall not be liable for further payments due to SUBRECIPIENT under this Agreement. (2) It is expressly understood that this Agreement in no way obligates the General Fund or any other monies or credits of the City of Denton. (3) CITY shall not be liable for any cost or portion thereof which: (a) has been paid, reimbursed, or is subject to payment or reimbursement, from any other source; (b) was incurred prior to the beginning date or after the ending date specified in Section 1; (c) is not in strict accordance with the terms of this Agreement, including all exhibits attached hereto; (d) has not been billed to CITY within 90 calendar days following billing to SUBRECIPIENT, or termination of the Agreement, whichever date is earlier; or (e) is not an allowable cost as defined by Section 10 of this Agreement or the Project Budget in Exhibit B. (4) CITY shall not be liable for any cost or portion thereof which is incurred with respect to any activity of SUBRECIPIENT requiring prior written authorization from CITY, or after CITY has requested that SUBRECIPIENT furnish data concerning such action prior to proceeding further, unless and until CITY advises SUBRECIPIENT to proceed. (5) CITY shall not be obligated or liable under this Agreement to any party other than SUBRECIPIENT for payment of any monies or provision of any goods or services. (6) Funding not expended within the term of this Agreement will revert to the City of Denton CDBG budget for use on alternative projects. C. SUBRECIPIENT’S Obligations. In consideration of the receipt of funds from the CITY, the SUBRECIPIENT agrees to the following terms and conditions: (1) Four Hundred Thirty-Nine Thousand Four Hundred Eighty-Three and no/100 Dollars ($439,483.00) may be paid to SUBRECIPIENT by CITY, and the only expenditures reimbursed from these funds shall be those in accordance with the Project Budget, Exhibit B, for those Project activities listed in the Scope of Services, Exhibit A, as provided herein. SUBRECIPIENT shall not utilize these funds for any other purpose. (2) SUBRECIPIENT will establish, operate, and maintain an account system for these funds that will allow for a tracing of funds and a review of the financial status of the Project. The system will be based on generally accepted accounting principles as recognized by the American Institute of Certified Public Accountants. 262 Page 6 (3) SUBRECIPIENT will permit authorized officials of the City to review its books at any time. (4) SUBRECIPIENT will reduce to writing all of its rules, regulations, and policies and file a copy with CITY's Community Development Office along with any amendments, additions, or revisions upon request. (5) SUBRECIPIENT will not enter into any contracts that would encumber CITY funds for a period that would extend beyond the term of this Agreement. (6) SUBRECIPIENT will promptly pay all bills when submitted unless there is a discrepancy in a bill; any errors or discrepancies in bills shall be promptly reported to CITY’s Community Development Division for further direction. (7) SUBRECIPIENT will appoint a representative who will be available to meet with CITY officials when requested. (8) SUBRECIPIENT will indemnify and hold harmless CITY, its officers, elected and appointed officials, and employees, from any and all claims and suits arising out of the activities of SUBRECIPIENT, its employees, contractors and/or subcontractors. (9) SUBRECIPIENT will submit to CITY copies of year-end audited financial statements. 4. COMPLIANCE WITH FEDERAL, STATE, AND LOCAL LAWS A. SUBRECIPIENT understands that funds provided to it pursuant to this Agreement are funds which have been made available to CITY by the Federal Government (HUD) under the Housing and Community Development Act of 1974, as amended, in accordance with an approved Grant Application and specific assurances. Accordingly, SUBRECIPIENT assures and certifies that it will comply with the requirements of the Housing and Community Development Act of 1974 (P.L. 93-383) as amended and with regulations promulgated thereunder and codified at 24 CFR 570. The foregoing is in no way meant to constitute a complete compilation of all duties imposed upon SUBRECIPIENT by law or administrative ruling or to narrow the standards that SUBRECIPIENT must follow. B. SUBRECIPIENT shall comply with all applicable federal laws, laws of the State of Texas, and ordinances of the City of Denton. C. SUBRECIPIENT agrees to abide by the conditions of and comply with the requirements of 2 CFR Part 200 Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards. D. SUBRECIPIENT further agrees and certifies that if the regulations and issuances promulgated pursuant to the Act are amended or revised, it shall comply with them, or notify CITY, as provided in Section 23 of this Agreement. E. SUBRECIPIENT is required to comply with the applicable uniform administrative requirements as described in 24 CFR 570.502, 570.505, and 24 CFR 570 subpart K with the exceptions noted below: (1) SUBRECIPIENT does not assume CITY’S environmental responsibilities described at CFR 570.604; and (2) SUBRECIPIENT does not assume the CITY’s responsibility for initiating the review process under the provisions of 24 CFR Part 52. F. SUBRECIPIENT shall give the CITY, HUD, the Comptroller General of the United States, the Auditor of the State of Texas, and any authorized representative, access to and the right to reproduce all records belonging to or in use by SUBRECIPIENT. SUBRECIPIENT further agrees to abide by the conditions of this Agreement and all applicable Federal, state, and local laws and regulations such as the requirements of the Secretary of Labor in accordance 263 Page 7 with the Davis-Bacon Act as amended, the provisions of the Contract Work Hours Safety Standards Act, the Copeland “Anti-Kickback Act” (40 U.S.C. 276a-276a-5; 40 USC 327 and 40 USC 276c) pertaining to the performance of this Agreement. G. SUBRECIPIENT will work with CITY to obtain and maintain documentation of compliance. H. SUBRECIPIENT agrees to comply with the provisions of Section 3, the regulations set forth in 24 CFR 135, and all applicable rules and orders issued hereunder prior to the execution of this Agreement and agrees that these provisions shall also be binding on any of the SUBRECIPIENT’S subcontractors. SUBRECIPIENT certifies that no contractual or other disability exists which would prevent compliance with these requirements. SUBRECIPIENT further agrees to include a statement in all subcontracts requiring compliance with Section 3 and requiring subcontractors, to the greatest extent feasible, to provide opportunities for training and employment to low and moderate-income individuals that are residents of the project area. Upon written request of the CITY, SUBRECIPIENT will obtain the services of a consultant to monitor the general contractor’s compliance with the Section 3 requirements. I. SUBRECIPIENT shall not use funding under this Agreement to influence the outcome of elections or the passage or defeat of any legislative measures. SUBRECIPIENT understands that funds provided to it pursuant to this Agreement are funds which have been made available to CITY by the Federal Government (HUD) under the Housing and Community Development Act of 1974, as amended, in accordance with an approved Grant Application and specific assurances. Accordingly, SUBRECIPIENT assures and certifies that it will comply with the requirements of the Housing and Community Development Act of 1974 (P.L. 93-383) as amended and with regulations promulgated thereunder and codified at 24 CFR 570. The foregoing is in no way meant to constitute a complete compilation of all duties imposed upon SUBRECIPIENT by law or administrative ruling, or to narrow the standards which SUBRECIPIENT must follow. J. SUBRECIPIENT will comply with the Federal procurement standards at 2 CFR 200 Subpart D – Post Federal Award Requirements. 5. REPRESENTATIONS A. SUBRECIPIENT assures and guarantees that it possesses the legal authority, pursuant to any proper, appropriate, and official motion, resolution, or action passed or taken, to enter into this Agreement. B. The person or persons signing and executing this Agreement on behalf of SUBRECIPIENT do hereby warrant and guarantee that he, she, or they have been fully authorized by SUBRECIPIENT to execute this Agreement on behalf of SUBRECIPIENT and to validly and legally bind SUBRECIPIENT to all terms, performances, and provisions herein set forth. C. CITY shall have the right, at its option, to either temporarily suspend or permanently terminate this Agreement if there is a dispute as to the legal authority of either SUBRECIPIENT or the person signing the Agreement to enter into this Agreement. SUBRECIPIENT is liable to CITY for any money it has received from CITY for performance of the provisions of this Agreement if CITY has suspended or terminated this Agreement for the reasons enumerated in this Section. D. SUBRECIPIENT agrees that the funds and resources provided under the terms of this Agreement will in no way be substituted for funds and resources from other sources, nor in any way serve to reduce the resources, services, or other benefits which would have been available to, or provided through, SUBRECIPIENT had this Agreement not been executed. 6. PERFORMANCE BY SUBRECIPIENT 264 Page 8 SUBRECIPIENT will provide, oversee, administer, and carry out activities and services set out in Exhibit A, utilizing the funds described in Exhibit B, deemed by both parties to be necessary and sufficient payment for full and satisfactory performance of the Project, as determined solely by CITY and in accordance with all other terms, provisions, and requirements of this Agreement. No modifications or alterations may be made in the Scope of Services or Project Budget without the prior written approval of the CITY’s Community Services Manager. 7. PAYMENTS A. Payments to SUBRECIPIENT. The CITY shall pay to SUBRECIPIENT a maximum amount of money not to exceed Four Hundred Thirty-Nine Thousand Four Hundred Eighty- Three and no/100 Dollars ($439,483) for activities carried out in connection with the Project under this Agreement. The CITY will pay these funds on a reimbursement basis to SUBRECIPIENT within twenty days after CITY has received supporting documentation of eligible expenditures. Documentation of expenditures must be submitted to the Community Development Division by dates required by Community Development. SUBRECIPIENT’s failure to provide information on a timely basis may jeopardize present or future funding. The project must be completed, and all payments requested on or before July 31, 2022. No additional payments will be made if the work is not completed and the payment request(s) with appropriate documentation is not received by July 31, 2022. B. Funds are to be used for the sole purpose of carrying out the activities in connection with the Project described in the Scope of Services in Exhibit A and based on the Project Budget in Exhibit B. C. Excess Payment. SUBRECIPIENT shall refund to CITY within ten working days of CITY’s request, any sum of money which has been paid by CITY and which CITY at any time thereafter determines: (1) has resulted in overpayment to SUBRECIPIENT; or (2) has not been spent strictly in accordance with the terms of this Agreement; or (3) is not supported by adequate documentation to fully justify the expenditure. D. Disallowed Costs. Upon termination of this Agreement, should any expense or charge for which payment has been made be subsequently disallowed or disapproved as a result of any auditing or monitoring by CITY, HUD, or any other Federal agency, SUBRECIPIENT will refund such amount to CITY within ten working days of a written notice to SUBRECIPIENT specifying the amount disallowed. Refunds of disallowed costs may not be made from these or any funds received from or through CITY. E. Reversion of Assets. (1) SUBRECIPIENT, upon expiration of this Agreement, shall transfer to the CITY any funds on hand at the time of expiration and any accounts receivable attributable to the use of funds. (2) The reversion of these financial assets shall be in addition to any other remedy available to CITY either at law or in equity for breach of this Agreement. F. Obligation of Funds. (1) In the event that actual expenditure rates deviate from SUBRECIPIENT’s provision of a corresponding level of performance, as specified in Exhibit A, CITY hereby reserves the right to reappropriate or recapture any such under expended funds. (2) If CITY finds that SUBRECIPIENT is unwilling and/or unable to comply with any of the terms of this Agreement, CITY may require a refund of any and all money 265 Page 9 expended pursuant to this Agreement by SUBRECIPIENT, as well as any remaining unexpended funds which shall be refunded to CITY within ten working days of a written notice to SUBRECIPIENT to revert these financial assets. G. Contract Close Out. SUBRECIPIENT shall submit a final expenditure report, for the time period covered by the last invoice requesting reimbursement of funds under this Agreement, within 15 working days following the close of the Agreement period. 8. WARRANTIES SUBRECIPIENT represents and warrants that: A. All information, reports, and data heretofore or hereafter requested by CITY and furnished to CITY, are complete and accurate as of the date shown on the information, data, or report, and, since that date, have not undergone any significant change without written notice to CITY. B. Any supporting financial statements heretofore requested by CITY and furnished to CITY, are complete, accurate, and fairly reflect the financial condition of SUBRECIPIENT on the date shown on said report, and the results of the operation for the period covered by the report, and that since said date, there has been no material change, adverse or otherwise, in the financial condition of SUBRECIPIENT. C. No litigation or legal proceedings are presently pending or threatened against the SUBRECIPIENT. D. None of the provisions herein contravene or are in conflict with the authority under which SUBRECIPIENT is doing business or with the provisions of any existing indenture or agreement of SUBRECIPIENT. E. SUBRECIPIENT has the power to enter into this Agreement and accept payments hereunder and has taken all necessary action to authorize such acceptance under the terms and conditions of this Agreement. F. None of the assets of SUBRECIPIENT are subject to any lien or encumbrance of any character, except for current taxes not delinquent, except as shown in the financial statements furnished by SUBRECIPIENT to CITY. G. Each of these representations and warranties shall be continuing and shall be deemed to have been repeated by the submission of each request for payment. H. SUBRECIPIENT agrees to execute, and SUBRECIPIENT will use its best efforts to cause Serve Denton to execute, a lien that will be placed on the property improved with CDBG funds. The lien will name CITY as the primary beneficiary for a period not to exceed ten years. 9. COVENANTS A. During the period of time that payment may be made hereunder and so long as any payments remain unliquidated, SUBRECIPIENT shall not, without the prior written consent of the Community Services Manager or her authorized representative: (1) Mortgage, pledge, or otherwise encumber or suffer to be encumbered, any of the assets of SUBRECIPIENT now owned or hereafter acquired by it, or permit any pre- existing mortgages, liens, or other encumbrances to remain on, or attached to, any assets of SUBRECIPIENT which are allocated to the performance of this Agreement and with respect to which CITY has ownership hereunder. (2) Sell, assign, pledge, transfer, or otherwise dispose of accounts receivables, notes, or claims for money due or to become due. (3) Sell, convey, or lease all or a substantial part of its assets. 266 Page 10 (4) Make any advance or loan to, or incur any liability for, any other firm, person, entity, or corporation as guarantor, surety, or accommodation endorser. (5) Sell, donate, loan, or transfer any equipment or item of personal property purchased with funds paid to SUBRECIPIENT by CITY, unless CITY authorizes such transfer in writing. (6) Enter into any agreements or subcontracts with any agency or individual in the performance of this Agreement without the written consent of CITY prior to the execution of such an agreement or subcontract. B. SUBRECIPIENT agrees, upon written request by CITY, to require its employees to attend training sessions sponsored by the Community Development Division. 10. ALLOWABLE COSTS A. Costs shall be considered allowable only if incurred directly and specifically in the performance of and in compliance with this Agreement and in conformance with the standards and provisions of Exhibits A and B. B. CITY shall not be obligated to any third parties, including any contractors or subcontractors of SUBRECIPIENT, and CITY funds shall not be used to pay for any contract service extending beyond the expiration of this Agreement. C. Approval of SUBRECIPIENT’s Project Budget, Exhibit B, does not constitute prior written approval, even though certain items may appear in the Project Budget. CITY’s prior written authorization is required in order for the following to be considered allowable costs: (1) Any alterations, deletions, or additions to the Project Budget, Exhibit B. (2) Any fees or payments for consulting services. D. Written requests for prior approval are SUBRECIPIENT’s responsibility and shall be made within sufficient time to permit a thorough review by CITY. SUBRECIPIENT must obtain written approval by CITY prior to the commencement of procedures to solicit or purchase services, equipment, or real or personal property. Any procurement or purchase which may be approved under the terms of this Agreement must be conducted in its entirety in accordance with the provisions of this Agreement. 11. PROGRAM INCOME A. For purposes of this Agreement, “Program Income” means earnings of SUBRECIPIENT realized from activities resulting from this Agreement or from SUBRECIPIENT’s management of funding provided or received hereunder. Such earnings include, but are not limited to, income from interest, usage or rental or lease fees, income produced from contract-supported services of individuals or employees, or from the use or sale of equipment or facilities of SUBRECIPIENT provided as a result of this Agreement, and payments from clients or third parties for services rendered by SUBRECIPIENT under this Agreement. B. SUBRECIPIENT shall maintain records of the receipt and disposition of Program Income in the same manner as required for other contract funds and reported to CITY in the format prescribed by CITY. CITY and SUBRECIPIENT agree that any fees collected for services performed by SUBRECIPIENT shall be used for payment of costs associated with service provision. Revenue remaining after payment of all program expenses for service provision shall be considered Program Income and shall be subject to all the requirements of this Agreement and the regulations found at CFR, Section 570.504. C. SUBRECIPIENT shall include this Section in its entirety in all of its subcontracts which involve other income-producing services or activities. 267 Page 11 D. It is SUBRECIPIENT’s responsibility to obtain from CITY a prior determination as to whether or not income arising directly or indirectly from this Agreement, or the performance thereof, constitutes Program Income. SUBRECIPIENT is responsible to CITY for the repayment of any and all amounts determined by CITY to be Program Income, unless otherwise approved in writing by CITY. E. Recording Program Income. The receipt and expenditure of Program Income as defined in Section 570.500(a) shall be recorded as part of the financial transactions of the grant program. 12. MAINTENANCE OF RECORDS A. SUBRECIPIENT agrees to maintain records that will provide accurate, current, separate, and complete disclosure of the status of the funds received under this Agreement, in compliance with the provisions of Exhibit A and Exhibit B, and with any other applicable Federal and State regulations establishing standards for financial management, SUBRECIPIENT’s expenditures of funds made under this Agreement will conform to 2 CFR §200 Uniform Administrative Requirements, Cost Principles, and Audit Requirements for Federal Awards, and the regulations at 24 CFR Part 570, as applicable, including Title 24 CFR Sections 570.502(b), 570.504, and 570.506 as they pertain to costs incurred, audits, Program Income, administration, and other activities and functions. SUBRECIPIENT’s record system shall contain sufficient documentation to provide in detail full support and justification for each expenditure. Nothing in this Section shall be construed to relieve SUBRECIPIENT of fiscal accountability and liability under any other provision of this Agreement or any applicable law. SUBRECIPIENT shall include the substance of this provision in all subcontracts. B. SUBRECIPIENT agrees to retain all books, records, documents, reports, and written accounting procedures pertaining to the PROJECT and operation of programs and expenditures of funds under this Agreement for five years after the termination of all activities funded under this Agreement. C. Nothing in the above subsections shall be construed to relieve SUBRECIPIENT of responsibility for retaining accurate and current records, which clearly reflect the level and benefit of services provided under this Agreement. D. At any reasonable time and as often as CITY may deem necessary, the SUBRECIPIENT shall make available to CITY, HUD, or any of their authorized representatives, all of its records and shall permit CITY, HUD, or any of their authorized representatives to audit, examine, make excerpts and copies of such records, and to conduct audits of all contracts, invoices, materials, payrolls, records of personnel, conditions of employment, and all other data requested by said representatives. 13. REPORTS AND INFORMATION At such times and in such form as CITY may require, SUBRECIPIENT shall furnish such statements, records, data, and information as CITY may request and deem pertinent to matters covered by this Agreement. SUBRECIPIENT shall submit beneficiary and financial reports to CITY no less than once every three months. The beneficiary report shall detail client information, including race, ethnicity, income, female head of household, and other statistics required by CITY. The financial report shall include information and data relative to all programmatic and financial reporting as of the commencement date specified in Section 1 of this Agreement. 268 Page 12 Unless the CITY has granted a written exemption, SUBRECIPIENT shall submit an audit conducted by independent examiners in accordance with Generally Accepted Accounting Principles. If the SUBRECIPIENT receives and/or expends more than $750,000 in federal funding, the audit must be conducted in accordance with OMB 2 CFR Part 200, as applicable, within thirty days after receipt of such audit. 14. MONITORING AND EVALUATION SUBRECIPIENT agrees to participate in a monitoring and evaluation system whereby the services can be continuously monitored. CITY shall perform monitoring of the SUBRECIPIENT’s performances under this Agreement. A. SUBRECIPIENT agrees that CITY may carry out monitoring and evaluation activities to ensure adherence by SUBRECIPIENT to the provisions of this Agreement. B. SUBRECIPIENT agrees to cooperate fully with CITY and to provide data determined by CITY to be necessary for CITY to effectively fulfill its monitoring and evaluation responsibilities. C. SUBRECIPIENT agrees to cooperate in such a way so as not to obstruct or delay CITY in such monitoring and to designate one of its staff to coordinate the monitoring process as requested by CITY staff. D. To comply with this section, SUBRECIPIENT agrees to maintain records that will provide accurate, current, separate, and complete disclosure of the status of funds received and the services performed under this Agreement. SUBRECIPIENT's record system shall contain sufficient documentation to provide in detail full support and justification for each expenditure. SUBRECIPIENT agrees to retain all books, records, documents, reports, and written accounting procedures pertaining to the services provided and expenditure of funds under this Agreement for the period of time and under the conditions specified by the CITY. Nothing in the above subsections shall be construed to relieve SUBRECIPIENT of responsibility for retaining accurate and current records, which clearly reflect the level and benefit of services, provided under this Agreement. E. After each official monitoring on-site visit, CITY shall provide SUBRECIPIENT with a written report of monitoring findings, documenting findings and concerns that will require a written response to the CITY. An acceptable response must be received by the City within 60 days from the SUBRECIPIENT’s receipt of the monitoring report or audit review letter. Future payments under this Agreement can be withheld for the SUBRECIPIENT’s failure to submit a written response within 60 days. F. SUBRECIPIENT shall submit copies of any fiscal, management, or audit reports by any of the SUBRECIPIENT’s funding or regulatory bodies to CITY within ten working days of receipt by SUBRECIPIENT. G. SUBRECIPIENT will monitor all subcontracted services on a regular basis to assure contract compliance. Results of monitoring efforts shall be summarized in written reports and supported with documented evidence of follow-up actions taken to correct areas of noncompliance. 15. DIRECTORS’ MEETINGS During the term of this Agreement, SUBRECIPIENT shall cause to be delivered to CITY copies of all notices of meetings of its Board of Directors, setting forth the time and place thereof. Such notice shall be delivered to CITY in a timely manner to give adequate notice and shall include an agenda and a brief description of the matters to be discussed. SUBRECIPIENT understands and agrees that CITY representatives shall be afforded access to all of the Board of Directors’ 269 Page 13 meetings. Minutes of all meetings of SUBRECIPIENT’s governing body shall be available to CITY within ten days after Board approval. 16. INSURANCE A. SUBRECIPIENT shall observe sound business practices with respect to providing such bonding and insurance as would provide adequate coverage for services offered under this Agreement. B. The premises on and in which the activities described in Exhibit A are conducted, and the employees conducting these activities, shall be covered by premise liability insurance, commonly referred to as “Owner/Tenant” coverage, with CITY named as an additional insured. Upon request of SUBRECIPIENT, CITY may, at its sole discretion, approve alternate insurance coverage arrangements. C. SUBRECIPIENT will comply with applicable workers’ compensation statutes and will obtain employers’ liability coverage where available and other appropriate liability coverage for program participants, if applicable. D. SUBRECIPIENT will maintain adequate and continuous liability insurance on all vehicles owned, leased, or operated by SUBRECIPIENT. All employees of SUBRECIPIENT who are required to drive a vehicle in the normal scope and course of their employment must possess a valid Texas driver’s license and automobile liability insurance. Evidence of the employee’s current possession of a valid license and insurance must be maintained on a current basis in SUBRECIPIENT’s files. E. Actual losses not covered by insurance as required by this Section are not allowable costs under this Agreement and remain the sole responsibility of SUBRECIPIENT. F. The policy or policies of insurance shall contain a clause which requires that CITY and SUBRECIPIENT be notified in writing of any cancellation or change in the policy at least 30 days prior to such change or cancellation. 17. CIVIL RIGHTS / EQUAL OPPORTUNITY A. SUBRECIPIENT shall comply with all applicable equal employment opportunity and affirmative action laws or regulations. The SUBRECIPIENT shall not discriminate against any employee or applicant for employment because of race, color, creed, religion, national origin, gender, age, or disability. The SUBRECIPIENT will take affirmative action to ensure that all employment practices are free from such discrimination. Such employment practices include but are not limited to the following: hiring, upgrading, demotion, transfer, recruitment or recruitment advertising, layoff, termination, rates of pay or other forms of compensation, and selection for training, including apprenticeship. B. SUBRECIPIENT shall comply with all applicable equal employment opportunity and affirmative action laws or regulations. The SUBRECIPIENT agrees to comply with Title VI of the Civil Rights Act of 1964 as amended, Title VIII of the Civil Rights Act of 1968 as amended, Section 104(b), Section 109 of Title 1 of the Housing and Community Development Act of 1974 as amended, Section 504 of the Rehabilitation Act of 1973, the Americans with Disabilities Act of 1990, the Age Discrimination Act of 1975, Executive Order 11063 and Executive Order 11246 as amended by Executive Orders 11375 and 12086. C. SUBRECIPIENT will furnish all information and reports requested by the CITY, and will permit access to its books, records, and accounts for purposes of investigation to ascertain compliance with local, state, and Federal rules and regulations. 270 Page 14 D. In the event of SUBRECIPIENT’s non-compliance with the non-discrimination requirements, CITY may cancel or terminate the Agreement in whole or in part, and SUBRECIPIENT may be barred from further contracts with CITY. 18. PERSONNEL POLICIES Personnel policies shall be established by SUBRECIPIENT and shall be available for examination. Such personnel policies shall: A. Include policies with respect to employment, salary and wage rates, working hours and holidays, fringe benefits, vacation and sick leave privileges, and travel; and B. Be in writing; and C. Be approved by the governing body of SUBRECIPIENT. 19. CONFLICT OF INTEREST A. SUBRECIPIENT covenants that neither it nor any member of its governing body presently has any interest, direct or indirect, which would conflict in any manner or degree with the performance of services required to be performed under this Agreement. SUBRECIPIENT further covenants that in the performance of this Agreement, no person having such interest shall be employed or appointed as a member of its governing body. B. SUBRECIPIENT further covenants that no member of its governing body or its staff, subcontractors, or employees shall possess any interest in or use his/her position for a purpose that is or gives the appearance of being motivated by desire for private gain for himself/herself, or others, particularly those with which he/she has family, business, or other ties. C. No officer, member, or employee of CITY and no member of its governing body who exercises any function or responsibilities in the review or approval of the undertaking or carrying out of this Agreement shall participate in any decision relating to the Agreement which affects his or her personal interest or the interest in any corporation, partnership, or association in which he or she has a direct or indirect interest. 20. NEPOTISM SUBRECIPIENT shall not employ in any paid capacity any person who is a member of the immediate family of any person who is currently employed by SUBRECIPIENT or is a member of SUBRECIPIENT’s governing board. The term “member of immediate family” includes: wife, husband, son, daughter, mother, father, brother, sister, in-laws, aunt, uncle, nephew, niece, stepparent, stepchild, half-brother, and half-sister. 21. POLITICAL OR SECTARIAN ACTIVITY A. Neither the funds provided pursuant to this Agreement, nor any personnel which may be employed by the SUBRECIPIENT with funds provided pursuant to this Agreement shall be in any way or to any extent engaged in any conduct or political activity in contravention of Chapter 15 of Title 5 of the United States Code. B. The SUBRECIPIENT is prohibited from using funds provided herein or personnel employed in the administration of the program for: political activities; sectarian or religious activities, lobbying, political patronage, or nepotism activities. C. The SUBRECIPIENT agrees that none of the funds or services provided directly or indirectly under this Agreement shall be used for any partisan political activity or to further the election or defeat of any candidate for public office, or for publicity, lobbying, and/or propaganda purposes designed to support or defeat pending legislation. Employees of the 271 Page 15 SUBRECIPIENT connected with any activity that is funded in whole or in part by funds provided to SUBRECIPIENT under this Agreement may not under the term of this Agreement: (1) Use their official position or influence to affect the outcome of an election or nomination; (2) Solicit contributions for political purposes; or (3) Take an active part in political management or in political campaigns. D. SUBRECIPIENT hereby agrees to sign a Certification Regarding Lobbying included herein as Exhibit D and, if necessary, the Disclosure of Lobbying Activities provided by the CITY. 22. PUBLICITY Where such action is appropriate, SUBRECIPIENT shall publicize the activities conducted by SUBRECIPIENT under this Agreement. In any news release, sign, brochure, or other advertising medium, disseminating information prepared or distributed by or for SUBRECIPIENT, the advertising medium shall state that the U.S. Department of Housing and Urban Development’s Community Development Block Grant Program funding through the City of Denton has contributed to make the project possible. 23. CHANGES AND AMENDMENTS A. Any alterations, additions, or deletions to the terms of this Agreement shall be by written amendment executed by both parties, except when the terms of this Agreement expressly provide that another method shall be used. B. SUBRECIPIENT may not make transfers between or among approved line items within budget categories set forth in Exhibit B without prior written approval of CITY. SUBRECIPIENT shall request, in writing, the budget revision in a form prescribed by CITY, and such request for revision shall not increase the total monetary obligation of CITY under this Agreement. In addition, budget revisions cannot significantly change the nature, intent, or scope of the program funded under this Agreement. C. SUBRECIPIENT will submit revised budget and program information whenever the level of funding for SUBRECIPIENT or the program(s) described herein is altered according to the total levels contained in any portion of Exhibit B. D. It is understood and agreed by the parties hereto that changes in the State, Federal, or local laws or regulations pursuant hereto may occur during the term of this Agreement. Any such modifications are to be automatically incorporated into this Agreement without written amendment hereto and shall become a part of the Agreement on the effective date specified by the law or regulation. E. CITY may, from time to time during the term of the Agreement, request changes to the Agreement, which may include an increase or decrease in the amount of SUBRECIPIENT’s compensation. Such changes shall be incorporated in a written amendment hereto, as provided in Subsection A of this Section. F. Any alterations, deletions, or additions to the Project Budget incorporated in Exhibit B shall require the prior written approval of CITY. G. SUBRECIPIENT agrees to notify CITY of any proposed change in physical location for work performed under this Agreement at least 30 calendar days in advance of the change. H. SUBRECIPIENT shall notify CITY of any changes in personnel or governing board composition. 272 Page 16 I. It is expressly understood that neither the performance of Exhibit A for any program contracted hereunder nor the transfer of funds between or among said programs will be permitted. 24. SUSPENSION OF FUNDING Upon determination by CITY of SUBRECIPIENT’s failure to timely and properly perform each of the requirements, time conditions, and duties provided herein, CITY, without limiting any rights it may otherwise have, may, at its discretion, and upon ten working days written notice to SUBRECIPIENT, withhold further payments to SUBRECIPIENT. Such notice may be given by mail to the Executive Officer and the Board of Directors of SUBRECIPIENT. The notice shall set forth the default or failure alleged, and the action required for cure. The period of such suspension shall be of such duration as is appropriate to accomplish corrective action, but in no event shall it exceed 30 calendar days. At the end of the suspension period, if CITY determines the default or deficiency has been satisfied, SUBRECIPIENT may be restored to full compliance status and paid all eligible funds withheld or impounded during the suspension period. If however, CITY determines that SUBRECIPIENT has not come into compliance, the provisions of Section 25 may be effectuated. 25. TERMINATION A. CITY may terminate this Agreement for cause under any of the following reasons or for other reasons not specifically enumerated in this Section: (1) SUBRECIPIENT’s failure to attain compliance during any prescribed period of suspension as provided in Section 24. (2) SUBRECIPIENT’s failure to materially comply with any of the terms of this Agreement. (3) SUBRECIPIENT’s violation of covenants, agreements, or guarantees of this Agreement. (4) Termination or reduction of funding by the CITY or HUD. (5) Finding by CITY that the SUBRECIPIENT: (a) is in such unsatisfactory financial condition as to endanger performance under this Agreement; (b) has allocated inventory to this Agreement substantially exceeding reasonable requirements; or (c) is delinquent in payment of taxes or of costs of performance of this Agreement in the ordinary course of business. (6) Appointment of a trustee, receiver, or liquidator for all or substantial part of SUBRECIPIENT’s property, or institution of bankruptcy, reorganization, rearrangement of, or liquidation proceedings by or against SUBRECIPIENT. (7) SUBRECIPIENT’s inability to conform to changes required by Federal, State, and local laws or regulations as provided in Section 4, and Section 2, of this Agreement. (8) The commission of an act of bankruptcy. (9) SUBRECIPIENT’s violation of any law or regulation to which SUBRECIPIENT is bound or shall be bound under the terms of the Agreement. B. CITY shall promptly notify SUBRECIPIENT in writing of the decision to terminate and the effective date of termination. Simultaneous notice of pending termination may be made to other funding sources specified in Exhibit B. 273 Page 17 C. CITY may terminate this Agreement for convenience at any time. If CITY terminates this Agreement for convenience, SUBRECIPIENT will be paid an amount not to exceed the total of accrued expenditures as of the effective date of termination subject to the requirements of Section 7. In no event will this compensation exceed an amount which bears the same ratio to the total compensation as the services actually performed bears to the total services of SUBRECIPIENT covered by the Agreement, less payments previously made. D. SUBRECIPIENT may terminate this Agreement in whole or in part by written notice to CITY if a termination of outside funding occurs upon which SUBRECIPIENT depends for performance hereunder. SUBRECIPIENT may opt, within the limitations of this Agreement, to seek an alternative funding source, with the approval of CITY, provided the termination by the outside funding source was not occasioned by a breach of contract as defined herein or as defined in a contract between SUBRECIPIENT and the funding source in question. E. SUBRECIPIENT may terminate this Agreement upon the dissolution of SUBRECIPIENT’s organization not occasioned by a breach of this Agreement. F. Upon receipt of notice to terminate, SUBRECIPIENT shall cancel, withdraw, or otherwise terminate any outstanding orders or subcontracts relating to the performance of this Agreement. CITY shall not be liable to SUBRECIPIENT or SUBRECIPIENT’s contractors, subcontractors or creditors, including but not limited to Serve Denton, for any expenses, encumbrances, or obligations whatsoever incurred after the termination date listed on the notice to terminate referred to in this Section. G. Notwithstanding any exercise by CITY of its right of suspension or termination, SUBRECIPIENT shall not be relieved of liability to CITY for damages sustained by CITY by virtue of any breach of the Agreement by SUBRECIPIENT, and CITY may withhold any reimbursement to SUBRECIPIENT until such time as the exact amount of damages due to CITY from SUBRECIPIENT is agreed upon or otherwise determined. 26. NOTIFICATION OF ACTION BROUGHT In the event that any claim, demand, suit, or other action is made or brought by any person(s), firm, corporation, or other entity against SUBRECIPIENT, SUBRECIPIENT shall give written notice thereof to CITY within five working days after being notified of such claim, demand, suit, or other action. Such notice shall state the date and hour of notification of any such claim, demand, suit, or other action; the names and addresses of the person(s), firm, corporation, or other entity making such claim or demand, or that instituted or threatened to institute any type of action or proceeding; the basis of such claim, demand, suit, action, or proceeding; and the name of any person(s) against whom such claim, demand, suit, action, or proceeding is being made or threatened. Such written notice shall be delivered either personally or by mail. 27. INDEMNIFICATION A. It is expressly understood and agreed by both parties hereto that CITY is contracting with SUBRECIPIENT as an independent contractor and that as such, SUBRECIPIENT shall save and hold CITY, its officers, elected and appointed officials, agents, and employees harmless from all liability of any nature or kind, including costs and expenses for, or on account of, any claims, audit exceptions, demands, suits, or damages of any character whatsoever resulting in whole or in part from the performance or omission of any employee, agent, contractor, subcontractor or representative of SUBRECIPIENT. B. SUBRECIPIENT agrees to provide the defense for, and to indemnify and hold harmless CITY its officers, elected and appointed officials, agents, employees, or contractors from any and all claims, suits, causes of action, demands, damages, losses, attorney fees, expenses, and 274 Page 18 liability arising out of the use of these contracted funds and program administration and implementation except to the extent caused by the willful act or omission of CITY, its agents, employees, or contractors. 28. NON-RELIGIOUS ACTIVITIES A. As stated in 24 CFR Part 5.109, no organization will be prohibited from participating in activities supported by CITY funding including programs that make funds available through contracts, grants, or cooperative agreements. SUBRECIPIENT is prohibited from discriminating against beneficiaries in providing services or carrying out activities with such assistance based on religion, a religious belief, a refusal to hold a religious belief, or a refusal to attend or participate in a religious practice, while also noting that organizations that participate in programs only funded by indirect CITY or Federal financial assistance need not modify their program or activities to accommodate beneficiaries who choose to expend the indirect aid on those organizations’ programs. B. Faith based organizations that carry out programs or activities with direct Federal financial assistance from HUD are required to provide written notice of certain protections to beneficiaries and prospective beneficiaries. Specifically, such organizations are required to give notice to beneficiaries that: (1) The organization may not discriminate against a beneficiary or prospective beneficiary based on religion, a religious belief, a refusal to hold a religious belief, or a refusal to attend or participate in a religious practice; and (2) The organization may not require a beneficiary to attend or participate in any explicitly religious activities that are offered by the organization, and any participation by the beneficiary in such activities must be purely voluntary; and (3) The organization must separate, in time or location, any privately funded explicitly religious activities from activities supported by direct Federal financial assistance; and (4) If a beneficiary objects to the religious character of the organization, the organization must undertake reasonable efforts to identify and refer the beneficiary to an alternative provider to which the beneficiary has no such objection; and (5) A beneficiary or prospective beneficiary may report an organization's violation of these protections, including any denials of services or benefits by an organization, by contacting or filing a written complaint to HUD or the intermediary administering the program, if applicable. a) Faith-based organizations must provide this notice to prospective beneficiaries prior to enrollment. In the event of an emergency or exigent circumstance that makes it impracticable to provide the written notice in advance, prospective beneficiaries may receive the notice at the earliest available opportunity. Current beneficiaries must receive the notice at the earliest available opportunity. b) Faith-based organizations that carry out a program or activity with direct Federal financial assistance from HUD are to promptly undertake reasonable efforts to identify an alternative provider if a beneficiary or prospective beneficiary objects to the religious character of the organization, and to refer the beneficiary or prospective beneficiary to an alternative provider to which the beneficiary or prospective beneficiary has no such objection. 275 Page 19 29. MISCELLANEOUS A. SUBRECIPIENT shall not transfer, pledge, or otherwise assign this Agreement or any interest therein, or any claim arising thereunder, to any party or parties, bank, trust company, or other financial institution without the prior written approval of CITY. B. If any provision of this Agreement is held to be invalid, illegal, or unenforceable, the remaining provisions shall remain in full force and effect and continue to conform to the original intent of both parties hereto. C. All reports, documents, studies, charts, schedules, or other appended documentation to any proposal, content of basic proposal, or contracts and any responses, inquiries, correspondence, and related material submitted by SUBRECIPIENT shall become the property of CITY upon request. D. Debarment: SUBRECIPIENT certifies that it is not listed on the System for Award Management (SAM), which lists the debarred, suspended, or otherwise excluded from or ineligible for participation in federal assistance programs under Executive Order 12549 and 24 CFR Part 24. E. In no event shall any payment to SUBRECIPIENT hereunder, or any other act or failure of CITY to insist in any one or more instances upon the terms and conditions of this Agreement, constitute or be construed in any way to be a waiver by CITY of any breach of covenant or default which may then or subsequently be committed by SUBRECIPIENT. Neither shall such payment, act, or omission in any manner impair or prejudice any right, power, privilege, or remedy available to CITY to enforce its rights hereunder, which rights, powers, privileges, or remedies are always specifically preserved. No representative or agent of CITY may waive the effect of this provision. F. This Agreement, together with referenced Exhibits, constitutes the entire agreement between the parties hereto, and any prior agreement, assertion, statement, understanding, or other commitment antecedent to this Agreement, whether written or oral, shall have no force or effect whatsoever; nor shall an agreement, assertion, statement, understanding, or other commitment occurring during the term of this Agreement, or subsequent thereto, have any legal force or effect whatsoever, unless properly executed in writing and, if appropriate, recorded as an amendment of this Agreement. G. In the event any disagreement or dispute should arise between the parties hereto pertaining to the interpretation or meaning of any part of this Agreement or its governing rules, codes, laws, ordinances, or regulations, CITY as the party ultimately responsible to HUD for matters of compliance, will have the final authority to render or to secure an interpretation. H. If SUBRECIPIENT provides services to the homeless it is required to: (1) Report homeless data to the Homeless Management Information System (“HMIS”). HMIS is a countywide data management tool designed to facilitate data collection in order to improve human service delivery throughout Denton County. Participation in HMIS is a requirement per this Agreement. Data entered into HMIS will help our community improve services to individuals experiencing homelessness by providing accurate information on the extent and nature of homelessness in our community and by accounting for our success in helping people move out of homelessness. Participation is also critical to help CITY and Denton County successfully compete for grants for federal funding, such HUD’s homeless assistance funds. (2) Participate in the Denton County Homeless Leadership Team meetings and any applicable workgroup(s). The Denton County Homeless Leadership Team is a collaborative, cross-sector team that convenes to improve the planning, coordination, oversight, and implementation required to create systems change for 276 277 Kendra Kennedy 278 Page 22 EXHIBIT A SCOPE OF SERVICES Description of Project Community Development Block Grant – Coronavirus funds will be used to pay for the construction costs associated with the addition of 4,500 square feet to the Project Site, including building permit fees and sidewalk improvements. The Project Site is located at the Serve Denton Center at 306 N. Loop 288 Suite 400, Denton, Texas. The Project is designed to construct an addition to expand the Project Site to store food and specialized equipment to help grow the food distribution capacity to provide food from a central community storehouse to needy families and struggling with hunger insecurity. Estimated Project Timeline July 2021 Project Approval: Contract is executed with SUBRECIPIENT and approved by City Council August 2021 Pre-Construction: SUBRECIPIENT completes necessary architecture, engineering, design, permitting, and all activities and approvals September 2021 Procurement: SUBRECIPIENT completes the procurement process including advertisement and selection of a contractor October 2021 – March 2022 Construction: SUBRECIPIENT manages the project April 2022 Reimbursement: Request reimbursement for project costs. May 2022 Reporting: SUBRECIPIENT submits client data to the City to complete project June 2022 Monitoring: SUBRECIPIENT begins reporting July 2031 Monitoring: SUBRECIPIENT ends reporting Work Statement In orGer to FomSlete tKe aJreeG uSon aFtiYity, SUBRECIPIENT sKall SroYiGe tKe folloZinJ serYiFes from tKe imSroYeG faFility SUBRECIPIENT was founded in 1974 with a mission to provide food from a central community store house to needy individuals and families who are struggling with hunger insecurity. With the event of the Covid-19 pandemic, the center went from allowing applicants/clients requesting food six times each year, no more than once per calendar month, to allowing clients to come every two weeks or 24 times a year. The food pantry is open 2-3 days per week with drive-through distribution of a basket with about 100 pounds of food) to the clients’ vehicle. 279 Page 23 For the duration of the pandemic, the food pantry serves all clients from Denton and Denton County, as well as DFW and surrounding areas, who visit requesting food from SUBRECIPIENT’s Serve Denton campus location. Currently, seventy-one percent of clients reside within the city limits of Denton. The food is purchased from retail suppliers and donated, and most of the protein comes from the Tarrant Area Food Bank. SUBRECIPIENT serves individuals and families regardless of race, ethnicity, or age. This diverse cross-section of clients includes the low-income working poor, veterans, and the homeless, and people who are recipients of Federal programs such as SNAP/Food Stamps, Temporary Assistance for Needy Families, Supplement Security Income, National School Lunch Program, and Medicaid, among others. SUBRECIPIENT follows the income eligibility guidelines as specified by the Emergency Food Assistance Program. SUBRECIPIENT proposes to assist 21,000 unduplicated people during the 2021-22 fiscal year. A majority of the clients at 99.97% are at or below 80% of the Area Median Income. 280 Page 24 EXHIBIT B PRO-ECT BUDGET Four-Hundred Thirty-Nine Thousand Four-Hundred Eighty-Three and no/100 Dollars ($439,483.00) in Community Development Block Grant – Coronavirus funds for public facility improvements for low and moderate-income households. Funding may be reallocated as needed to complete the improvements described in Exhibit A. As stated in the Agreement, any remaining fund balance will be returned to CITY. Prior to the start of construction, SUBRECIPIENT shall provide the Community Development Division with an overall budget, documentation of any additional funding sources and commitments (if other funding sources are included in the Project), and a Project planning/construction schedule. 281 Page 25 EXHIBIT C U.S. DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT HUD INCOME LIMITS 4ualifying Income Limits for Federally Assisted Programs FY 2021 Income Limits Summary Dallas, TX HUD Metro FMR Area Effective June 1, 2021 Median Household Income: $ 89,000 (Household of 4) Household Low (80%) Very Low (50%) Extremely Low (30%) 1 $49,850 $31,150 $18,700 2 $57,000 $35,600 $21,400 3 $64,100 $40,050 $24,050 4 $71,200 $44,500 $26,700 5 $76,900 $48,100 $28,850 6 $82,600 $51,650 $31,000 7 $88,300 $55,200 $33,150 8 $94,000 $58,750 $35,250 282 283 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1507,Version:1 AGENDA CAPTION Consider approval of a resolution of the City of Denton, Texas, amending Resolution No. 19-2886 relating to the Bond Oversight Committee, to amend the manner in which members are appointed to the committee; and provide for an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™284 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Finance ACM/CFO: David Gaines DATE: July 27, 2021 SUBJECT Consider approval of a resolution of the City of Denton, Texas, amending resolution No. 19-2886 relating to the Bond Oversight Committee, to amend the manner in which members are appointed to the committee; and provide for an effective date. BACKGROUND On December 17, 2019, City Council approved resolution 19-2286 establishing The Bond Oversight Committee. The Bond Oversight Committee is a seven (7) member committee which monitor, evaluate and report on the progress of all the City’s active bond election capital programs. The Committee also provides guidance when potential changes or adjustments to the bond program projects occur. One of the Bond Oversight Committee members, Eric Pruett, recently moved to the Planning & Zoning Committee leaving a vacancy on the Bond Oversight Committee. In order to fill the vacant seat, resolution 19-2886 must be repealed since the original committee members are listed by name. The proposed resolution allows Council to appoint new committee members without listing specific names. The City has received one application for the vacant seat which will be presented at a future City Council meeting. The members of the Bond Oversight Committee are previous members of the 2014 Bond Oversight Committee and the Special Citizens Bond Advisory Committee for the 2019 Bond Election. RECOMMENDATION Staff recommends approval of the resolution. EXHIBITS 1. Agenda Information Sheet 2. Resolution Respectfully submitted: Cassey Ogden ` Finance Director 940-349-7195 City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 285 RESOLUTION NO._________________ A RESOLUTION OF THE CITY OF DENTON AMENDING RESOLUTION NO. 19-2886 RELATING TO THE BOND OVERSIGHT COMMITTEE, TO AMEND THE MANNER IN WHICH MEMBERS ARE APPOINTED TO THE COMMITTEE; AND PROVIDE FOR AN EFFECTIVE DATE. WHEREAS, the City Council of the City of Denton (“City Council”) called and ordered a bond election for November 5, 2019, for the purpose of submitting to the voters of the City of Denton certain capital improvements, which bonds were approved by the voters as a result of the election; and WHEREAS, on December 17, 2019, the City Council created a Special Citizens Bond Advisory Committee (“Bond Oversight Committee”) to monitor, evaluate, and report on the progress of the Six Year Capital Improvement Program approved by the voters at the bond election on November 5, 2019 and all prior bond election capital programs; and WHEREAS, the City Council desires to amend the manner in which members of the Bond Oversight Committee are appointed; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY RESOLVES: SECTION 1. Section 2 of Resolution No. 19-2886 is hereby amended in its entirety to read as follows: “The membership of the Bond Oversight Committee shall be composed of seven (7) residents of the City of Denton appointed by the City Council. The members shall serve at the pleasure of the City Council until successors are duly appointed.” SECTION 2. Members of the Bond Oversight Committee appointed prior to the effective date of this resolution shall continue to serve until successors are duly appointed. SECTION 3. All other resolutions that conflict with this resolution are hereby repealed. SECTION 4. This resolution shall become effective immediately upon its passage and approval. The motion to approve this resolution was made by __________________________ and seconded by _________________________________; the resolution was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Gerard Hudspeth, Mayor: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ 286 Page 2 of 2 PASSED AND APPROVED this the ______ day of _______________, 2021. ___________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: _________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: _________________________________ Digitally signed by Mack Reinwand Date: 2021.06.09 14:42:46 -05'00' 287 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1489,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,a Texas home-rule municipal corporation,authorizing the City Manager,or their designee,to execute a contract with On Computer Services,L.L.C.,dba Unified Power,for uninterruptible power supply (UPS)maintenance and services for the Technology Services Department;providing for the expenditure of funds therefor;and providing an effective date (RFP 7546 - awarded to On Computer Services,L.L.C.,dba Unified Power,for three (3)years,with the option for two (2) additional one (1) year extensions, in the total five (5) year not-to-exceed amount of $195,000.00). City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™288 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Procurement & Compliance ACM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with On Computer Services, L.L.C., dba Unified Power, for uninterruptible power supply (UPS) maintenance and services for the Technology Services Department; providing for the expenditure of funds therefor; and providing an effective date (RFP 7546 – awarded to On Computer Services, L.L.C., dba Unified Power, for three (3) years, with the option for two (2) additional one (1) year extensions, in the total five (5) year not-to-exceed amount of $195,000.00). INFORMATION/BACKGROUND Currently, the City of Denton has five (5) uninterruptible power supply (UPS)/ power distribution units (PDU) and two (2) static transfer switches (STS) distributed across four (4) locations. The UPS distribution system supports mission-critical equipment used by the entire City including our primary data center, backup data center, Police Dispatch Operations Center, and Denton Municipal Electric. An uninterruptible power supply (UPS) is a device that allows equipment such as computers and servers to keep running for a short time when the primary power source is lost. It also filters the power to provide a clean steady current to our equipment. Two (2) additional UPS systems will be added next year as part of the Police department’s renovation project. To ensure that this equipment is ready in an emergency, the equipment goes through a preventative maintenance program that inspects the equipment twice a year and replaces any needed components to ensure that the equipment is always available when needed. As part of the preventative maintenance program, the batteries used in the UPS systems are replaced every three (3) years, or sooner if they are not capable of being fully charged. Over the next eighteen (18) months we expect to replace all our current batteries, so during the life of this contract, we expect to replace the batteries twice. Year 1 Year 2 Year 3 Year 4 Year 5 Annual Preventative Maintenance: $15,171.68 $20,171.68 $20,171.68 $20,171.68 $20,171.68 Projected Battery Replacement: $14,645.09 $14,645.09 $14,645.09 $14,645.09 $14,645.09 Projected Annual Cost: $29,816.77 $34,816.77 $34,816.77 $34,816.77 $34,816.77 Contingency: $25,916.15 Contract 5yr NTE Amount: $195,000 City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 289 Requests for Proposals was sent to 199 prospective suppliers, including seven (7) Denton firms, of this item. In addition, specifications were placed on the Materials Management website for prospective suppliers to download and advertised in the local newspaper. Seven (7) proposals were received and evaluated based upon published criteria including compliance with specifications, probable performance, delivery/project schedule, and price. Based upon this evaluation, On Computer Services, L.L.C., dba Unified Power was ranked the highest and determined to be the best value for the City. NIGP Code Used for Solicitation: 207 - Computer Accessories and Supplies Notifications sent for Solicitation sent in IonWave: 199 Number of Suppliers that viewed Solicitation in IonWave: 19 HUB-Historically Underutilized Business Invitations sent out: 20 SBE-Small Business Enterprise Invitations sent out: 77 Responses from Solicitation: 7 RECOMMENDATION Award a contract with On Computer Services, L.L.C., dba Unified Power for uninterruptible power supply (UPS) maintenance and services for the Technology Services Department, in a three (3) year, with the option for two (2) additional one (1) year extensions, in the total five (5) year not-to-exceed amount of $195,000. PRINCIPAL PLACE OF BUSINESS On Computer Services, L.L.C., dba Unified Power Terrell, TX ESTIMATED SCHEDULE OF PROJECT This is an initial three (3) year contract with options to extend the contract for two (2) additional one (1) year periods, with all terms and conditions remaining the same. FISCAL INFORMATION These services will be funded from the Technology Services Department Operating Funds. EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Evaluation Exhibit 3: LLC Members Exhibit 4: Ordinance and Contract Respectfully submitted: Lori Hewell, 940-349-7100 Purchasing Manager For information concerning this acquisition, contact: Leisha Meine, 940-349-7823. Legal point of contact: Marcella Lunn at 940-349-8333. 290 On Computer Services LLC, DBA Unified Power DataCom Power, Inc.DC Group Facility Gateway Corporation e² Power LLC Gruber Power Services BATTERY SYSTEMS LLC Terrell, TX Plano, TX Minneapolis, MN Madison, WI Richardson, TX Phoenix, AZ Naperville, IL Line #Description 1 2 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033D-D803DU-4; Serial #06-7M71464-01 $2,177.68 $3,390.00 $2,000.00 $2,375.00 $3,414.44 $2,425.00 $1,200.00 3 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033D-A503DU-4; Serial #02-GJW8Q1-02 $1,695.32 $3,410.00 $1,700.00 $1,900.00 $3,610.00 $2,200.00 $1,200.00 4 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033C-A403SU-2; Serial #00-BU06Q1-05 $2,342.72 $3,206.00 $1,700.00 $1,800.00 $3,065.56 $2,200.00 $1,200.00 5 Annual Preventative Maintenance on GE UPS Model #LP 33; Serial #Q1060-2711-B204B $2,534.84 $3,520.00 $2,000.00 $2,375.00 $3,344.44 $2,350.00 $1,200.00 6 Annual Preventative Maintenance on Toshiba UPS Model #UE3G2L140C61T; Serial #080800603 $1,075.80 $1,693.00 $1,000.00 $1,370.00 $2,365.56 $1,600.00 $1,200.00 7 Annual Preventative Maintenance on PDI PDU Model #PP12-4-100-G-641; Serial #110-1895 $1,306.66 $1,766.00 $550.00 $200.00 $800.00 $300.00 $600.00 8 Annual Preventative Maintenance on PDI STS Model #STS-FO-STD-2480-150-60; Serial #411-0009 $1,306.66 $1,766.00 $550.00 $200.00 $1,270.00 $300.00 $600.00 9 Annual Preventative Maintenance on PDI PDU Model #PPI12-0-050-E-641; Serial #440-0005 $963.48 $1,324.00 $550.00 $200.00 $747.78 $300.00 $600.00 10 Annual Preventative Maintenance on PDI STS Model #STSSBR-STD-2-480-100-60; Serial #440-0005-1A $963.48 $1,324.00 $550.00 $200.00 $1,200.00 $300.00 $600.00 11 Annual Preventative Maintenance on PDI PDU Model #RPP-02-1-441-D3; Serial #180-1672 $805.04 $1,109.00 $550.00 $200.00 $760.00 $300.00 $600.00 $15,171.68 $22,508.00 $11,150.00 $10,820.00 $20,577.78 $12,275.00 $9,000.00 12 13 Price per each for 12-300MR Battery-12V (Cost of battery per each only)$155.53 $166.08 $172.00 $155.00 $168.78 $155.00 $162.00 Price per string of 40 for 12-300MR Batteries-12V (Cost of battery per string of 40 only)$6,221.20 $6,643.00 $5,630.00 $6,200.00 $6,751.11 $6,200.00 $6,480.00 14 Price per each for 150WPC Battery-12V (Cost of battery per each only)$132.00 $122.78 $110.00 $85.00 $117.32 $125.00 $102.96Price per string of 40 for 150WPC Batteries-12V (Cost of battery per string of 40 only)$5,280.00 $4,911.00 $3,750.00 $3,400.00 $4,692.89 $5,000.00 $4,118.40 15 Price per each for 100WPC Battery-12V (Cost of battery per each only)$149.00 $155.03 $94.00 $85.00 $99.41 $106.00 $85.57 Price per string of 30 for 100WPC Batteries-12 (Cost of battery per string of 30 only)$4,470.00 $4,651.00 $2,600.00 $2,550.00 $2,982.22 $3,180.00 $2,567.10 16 Price per each for 150WPC Battery-12V (Cost of battery per each only)$132.00 $121.87 $110.00 $85.00 $121.03 $125.00 $102.96 Price per string of 24 for 150WPC Batteries-12 (Cost of battery per string of 24 only)$3,168.00 $2,925.00 $2,400.00 $2,040.00 $2,904.62 $3,000.00 2471.04 17 Price per each for NPX-35TFR Battery-12V (Cost of battery per each only)$20.00 $25.48 $23.00 $16.50 $27.85 $42.00 $864.00 Price per string of 48 for NPX-35TFR Batteries-12 (Cost of battery per string of 48 only)$960.00 $1,223.00 1,220.00$ $792.00 $1,336.71 $2,016.00 $41,472.00 $20,687.73 $20,944.24 $16,109.00 $15,408.50 $19,201.94 $19,949.00 $58,426.03 $35,859.41 $43,452.24 $27,259.00 $26,228.50 $39,779.72 $32,224.00 $67,426.03 $25,916.15 $195,000.00 Item #Standard Criteria On Computer Services LLC, DBA Unified Power DataCom Power, Inc.DC Group Facility Gateway Corporation e² Power LLC Gruber Power Services BATTERY SYSTEMS LLC 1 Delivery/Project Schedule - 10%8.00 9.33 4.67 4.67 6.00 2.67 3.33 2 Compliance with Specifications - 10%7.33 8.00 6.67 5.33 6.00 5.33 4.67 3 Probable Performance - 40%34.67 37.33 21.33 18.67 24.00 13.33 16.00 4 Price, Total Cost of Ownership - 40%29.26 24.14 38.49 40.00 26.37 32.56 15.56 79.26 78.81 71.15 68.67 62.37 53.89 39.56Total Score: Total Battery Replacement Unit Cost: Response Total Cost: Total Annual Maintenance Cost: Evaluation Contingency: Total Contract Amount (5 years): Battery Replacement on Mitsubishi UPS Model #UP2033D-A503DU-4; Serial #02-GJW8Q1-02 (50kva) Battery Replacement on Mitsubishi UPS Model #UP2033D-A403SU-2 Serial #00-BU06Q1-05 (40kva) Battery Replacement on GE UPS Model #LP 33 Serial #Q1060-2711-B204B (60kva) Battery Replacement on Toshiba UPS Model #UE3G2L140C61T; Serial #080800603 (14kva) Exhibit 2 RFP 7546 - Pricing Evaluation for Uninterruptible Power Supply (UPS) Maintenance SECTION A -BI-ANNUAL MAINTENANCE (2PM visits per year) SECTION B - BATTERY REPLACEMENT Battery Replacement on Mitsubishi UPS Model #UP2033D-D803DU-4; Serial #06-7M71464-01 (80kva) Respondent's Business Name: Principal Place of Business (City and State): 291 292 ORDINANCE NO. _________ AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORIZING THE CITY MANAGER, OR THEIR DESIGNEE, TO EXECUTE A CONTRACT WITH ON COMPUTER SERVICES, L.L.C., DBA UNIFIED POWER, FOR UNINTERRUPTIBLE POWER SUPPLY (UPS) MAINTENANCE AND SERVICES FOR THE TECHNOLOGY SERVICES DEPARTMENT; PROVIDING FOR THE EXPENDITURE OF FUNDS THEREFOR; AND PROVIDING AN EFFECTIVE DATE (RFP 7546 AWARDED TO ON COMPUTER SERVICES, L.L.C., DBA UNIFIED POWER, FOR THREE (3) YEARS, WITH THE OPTION FOR TWO (2) ADDITIONAL ONE (1) YEAR EXTENSIONS, IN THE TOTAL FIVE (5) YEAR NOT-TO-EXCEED AMOUNT OF $195,000.00). WHEREAS, the City has solicited, received, and evaluated competitive proposals for uninterruptible power supply (UPS) maintenance and services for the Technology Services Department; and WHEREAS, the City Manager, or a designated employee, has received, reviewed, and recommended that the herein described proposals are the most advantageous to the City considering the relative importance of price and the other evaluation factors included in the request for proposals; and WHEREAS, the City Council has provided in the City Budget for the appropriation of funds to be used for the purchase of the materials, equipment, supplies, or services approved and accepted herein; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The items in the following numbered request for proposal for materials, equipment, supplies, Purchasing Agent, are hereby accepted and approved as being the most advantageous to the City considering the relative importance of price and the other evaluation factors included in the request for proposals. RFP NUMBER CONTRACTOR AMOUNT 7546 On Computer Services, L.L.C., $195,000.00 dba Unified Power SECTION 2. That by the acceptance and approval of the above numbered items of the submitted proposals, the City accepts the offer of the persons submitting the proposals for such items and agrees to purchase the materials, equipment, supplies, or services in accordance with the terms, specifications, standards, quantities, and for the specified sums contained in the Proposal Invitations, Proposals, and related documents. 293 SECTION 3. That should the City and person submitting approved and accepted items wish to enter into a formal written agreement as a result of the acceptance, approval, and awarding of the proposals, the City Manager, or their designated representative, is hereby authorized to execute the written contract which shall be attached hereto; provided that the written contract is in accordance with the terms, conditions, specifications, standards, quantities, and specified sums contained in the Proposal and related documents herein approved and accepted. SECTION 4. The City Council of the City of Denton, hereby expressly delegates the authority to take any actions that may be required or permitted to be performed by the City of Denton under this ordinance to the City Manager of the City of Denton, or their designee. SECTION 5. By the acceptance and approval of the above enumerated bids, the City Council hereby authorizes the expenditure of funds therefor in the amount and in accordance with the approved bids. SECTION 6. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. This ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _______ day of ___________________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR 294 ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: _________________________________ 295 Docusign City Council Transmittal Coversheet File Name Purchasing Contact City Council Target Date Piggy Back Option Contract Expiration Ordinance DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 7546RFP Cori Power UPS Maintenance Yes 296 Contract # 7546 CONTRACT BY AND BETWEEN CITY OF DENTON, TEXAS AND ON COMPUTER SERVICES, L.L.C., DBA UNIFIED POWER (CONTRACT 7546) THIS CONTRACT is made and entered into this date ______________________, by and between On Computer Services, L.C.C., dba Unified Power, a Texas Limited Liability Company, whose address is 217 Metro Drive, Terrell, TX 75160, hereinafter referred to as "Contractor," and the CITY OF DENTON, TEXAS, a home rule municipal corporation, hereinafter referred to as "City," to be effective upon approval of the Denton City Council and subsequent execution of this Contract by the Denton City Manager or his duly authorized designee. For and in consideration of the covenants and agreements contained herein, and for the mutual benefits to be obtained hereby, the parties agree as follows: SCOPE OF SERVICES Contractor shall provide products and/or services in accordance with the City’s document RFP 7546 - Uninterruptible Power Supply (UPS) Maintenance, a copy of which is on file at the office of Purchasing Agent and incorporated herein for all purposes. The Contract consists of this written agreement and the following items which are attached hereto and incorporated herein by reference: (a) Special Terms and Conditions (Exhibit “A”); (b) City of Denton’s RFP 7546 (Exhibit “B” on File at the Office of the Purchasing Agent); (c) City of Denton Standard Terms and Conditions (Exhibit “C”); (d) Insurance Requirements (Exhibit “D”); (e) Certificate of Interested Parties Electronic Filing (Exhibit "E"); (f) Contractor’s Proposal (Exhibit "F"); (g) Form CIQ – Conflict of Interest Questionnaire (Exhibit "G"); These documents make up the Contract documents and what is called for by one shall be as binding as if called for by all. In the event of an inconsistency or conflict in any of the provisions of the Contract documents, the inconsistency or conflict shall be resolved by giving precedence first to the written agreement then to the contract documents in the order in which they are listed above. These documents shall be referred to collectively as “Contract Documents.” Prohibition on Contracts with Companies Boycotting Israel Contractor acknowledges that in accordance with Chapter 2270 of the Texas Government Code, City is prohibited from entering into a contract with a company for goods or services unless the contract contains a written verification from the company that it: (1) does not boycott Israel; and (2) will not boycott Israel during the term of the contract. The terms “boycott Israel” and “company” shall have the meanings ascribed to those terms in Section 808.001 of the Texas Government Code. By signing this agreement, Contractor certifies that Contractor’s signature provides written verification to the City that Contractor: (1) does not boycott Israel; and (2) will not boycott Israel during the term of the agreement. Failure to meet or maintain the requirements under this provision will be considered a material breach. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 297 Contract # 7546 Prohibition On Contracts With Companies Doing Business with Iran, Sudan, or a Foreign Terrorist Organization Section 2252 of the Texas Government Code restricts CITY from contracting with companies that do business with Iran, Sudan, or a foreign terrorist organization. By signing this agreement, Contractor certifies that Contractor’s signature provides written verification to the City that Contractor, pursuant to Chapter 2252, is not ineligible to enter into this agreement and will not become ineligible to receive payments under this agreement by doing business with Iran, Sudan, or a foreign terrorist organization. Failure to meet or maintain the requirements under this provision will be considered a material breach. The parties agree to transact business electronically. Any statutory requirements that certain terms be in writing will be satisfied using electronic documents and signing. Electronic signing of this document will be deemed an original for all legal purposes. IN WITNESS WHEREOF, the parties of these presents have executed this agreement in the year and day first above written. CONTRACTOR BY: ______________________________ AUTHORIZED SIGNATURE Printed Name: ______________________ Title: _____________________________ __________________________________ PHONE NUMBER _________________________________ EMAIL ADDRESS ___________________________________ TEXAS ETHICS COMMISSION 1295 CERTIFICATE NUMBER CITY OF DENTON, TEXAS BY: _____________________________ ATTEST: ROSA RIOS, CITY SECRETARY BY: _______________________________ APPROVED AS TO LEGAL FORM: BY: _______________________________ THIS AGREEMENT HAS BEEN BOTH REVIEWED AND APPROVED as to financial and operational obligations and business terms. _______________ ________________ SIGNATURE PRINTED NAME __________________________________ TITLE __________________________________ DEPARTMENT DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 2021-762656 Steven Gottlieb steven.gottlieb@unifiedpowerusa.com EVP Sales & Business Development 3038084725 Leisha Meine Chief Technology Officer Technology Services 298 Contract # 7546 Exhibit A Special Terms and Conditions 1. Total Contract Amount The contract total for services shall not exceed $195,000. Pricing shall be per Exhibit F attached. 2. The Quantities The quantities indicated on Exhibit F are estimates based upon the best available information. The City reserves the right to increase or decrease the quantities to meet its actual needs without any adjustments in the bid price. Individual purchase orders will be issued on an as needed basis. 3. Contract Terms The contract term will be three (3) year, effective from date of award. The City and the Supplier shall have the option to renew this contract for an additional two (2) one-year periods. The Contract shall commence upon the issuance of a Notice of Award by the City of Denton and shall automatically renew each year, from the date of award by City Council. The Supplier’s request to not renew the contract must be submitted in writing to the Purchasing Manager at least 60 days prior to the contract renewal date for each year. At the sole option of the City of Denton, the Contract may be further extended as needed, not to exceed a total of six (6) months. 4. Price Escalation and De-escalation On Supplier’s request in the form stated herein, the City will implement an escalation/de- escalation price adjustment annually based on these special terms. Any request for price adjustment must be based on the, U.S Department of Labor, Bureau of Labor Statistics, Producer Price Index (PPI) or the manufacturer published pricing list. The maximum escalation will not exceed +/- 8% for any individual year. The escalation will be determined annually at the renewal date. The price will be increased or decreased based upon the annual percentage change in the PPI or the percentage change in the manufacturer’s price list. Should the PPI or manufacturer price list change exceed a minimum threshold value of +/-1%, then the stated eligible bid prices shall be adjusted in accordance with the percent change not to exceed the 8% limit per year. The supplier should provide documentation as percentage of each cost associated with the unit prices quoted for consideration. Request must be submitted in writing with supporting evidence for need of such increase to the Purchasing Manager at least 60 days prior to contract expiration of each year. Respondent must also provide supporting documentation as justification for the request. If no request is made, then it will be assumed that the current contract price will be in effect. Upon receipt of such request, the City of Denton reserves the right to either: accept the escalation as competitive with the general market price at the time, and become effective upon the renewal date of the contract award or reject the increases within 30 calendar days after receipt of a properly submitted request. If a properly submitted increase is rejected, the Contractor may DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 299 Contract # 7546 request cancellation of such items from the Contract by giving the City of Denton written notice. Cancellation will not go into effect for 15 calendar days after a determination has been issued. Pre-price increase prices must be honored on orders dated up to the official date of the City of Denton approval and/or cancellation. The request can be sent by e-mail to: purchasing@cityofdenton.com noting the solicitation number. The City of Denton reserves the right to accept, reject, or negotiate the proposed price changes. 5. Performance Liquidated Damages The Contractor shall incur contractual payment losses, as initiated by the City for performance that falls short of specified performance standards as outlined below: • Delivery beyond contracted lead times • Performance below contracted levels (services only) The Contractor shall be assessed a one (1%) percent fee each month when any one of the performance standards outlined above are not met in full. The Contractor shall be assessed a two (2%) percent profit fee each month when any two (2) or more performance standards outlined above are not met in full. At the end of each month, the City will review the monthly reports and determine the percentage of penalty to be assessed to the Contractor’s monthly profit margin. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 300 Contract # 7546 Exhibit C Standard Purchase Terms and Conditions These standard Terms and Conditions and the Terms and Conditions, Specifications, Drawings and other requirements included in the City of Denton’s contract are applicable to contracts/purchase orders issued by the City of Denton hereinafter referred to as the City or Buyer and the Seller or respondent herein after referred to as Contractor or Supplier. Any deviations must be in writing and signed by a representative of the City’s Procurement Department and the Supplier. No Terms and Conditions contained in the seller’s proposal response, invoice or statement shall serve to modify the terms set forth herein. If there is a conflict between the provisions on the face of the contract/purchase order these written provisions will take precedence. The Contractor agrees that the contract shall be governed by the following terms and conditions, unless exceptions are duly noted and fully negotiated. Unless otherwise specified in the contract, Sections 3, 4, 5, 6, 7, 8, 20, 21, and 36 shall apply only to a solicitation to purchase goods, and sections 9, 10, 11, 22 and 32 shall apply only to a solicitation to purchase services to be performed principally at the City’s premises or on public rights-of-way. 1. CONTRACTOR’S OBLIGATIONS. The Contractor shall fully and timely provide all deliverables described in the Solicitation and in the Contractor’s Offer in strict accordance with the terms, covenants, and conditions of the Contract and all applicable Federal, State, and local laws, rules, and regulations. 2. EFFECTIVE DATE/TERM. Unless otherwise specified in the Solicitation, this Contract shall be effective as of the date the contract is signed by the City, and shall continue in effect until all obligations are performed in accordance with the Contract. 3. CONTRACTOR TO PACKAGE DELIVERABLES: The Contractor will package deliverables in accordance with good commercial practice and shall include a packing list showing the description of each item, the quantity and unit price unless otherwise provided in the Specifications or Supplemental Terms and Conditions, each shipping container shall be clearly and permanently marked as follows: (a) The Contractor's name and address, (b) the City’s name, address and purchase order or purchase release number and the price agreement number if applicable, (c) Container number and total number of containers, e.g. box 1 of 4 boxes, and (d) the number of the container bearing the packing list. The Contractor shall bear cost of packaging. Deliverables shall be suitably packed to secure lowest transportation costs and to conform to all the requirements of common carriers and any applicable specification. The City's count or weight shall be final and conclusive on shipments not accompanied by packing lists. 4. SHIPMENT UNDER RESERVATION PROHIBITED: The Contractor is not authorized to ship the deliverables under reservation and no tender of a bill of lading will operate as a tender of deliverables. 5. TITLE & RISK OF LOSS: Title to and risk of loss of the deliverables shall pass to the City only when the City actually receives and accepts the deliverables. 6. DELIVERY TERMS AND TRANSPORTATION CHARGES: Deliverables shall be DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 301 Contract # 7546 shipped F.O.B. point of delivery unless otherwise specified in the Supplemental Terms and Conditions. Unless otherwise stated in the Offer, the Contractor’s price shall be deemed to include all delivery and transportation charges. The City shall have the right to designate what method of transportation shall be used to ship the deliverables. The place of delivery shall be that set forth the purchase order. 7. RIGHT OF INSPECTION AND REJECTION: The City expressly reserves all rights under law, including, but not limited to the Uniform Commercial Code, to inspect the deliverables at delivery before accepting them, and to reject defective or non-conforming deliverables. If the City has the right to inspect the Contractor’s, or the Contractor’s Subcontractor’s, facilities, or the deliverables at the Contractor’s, or the Contractor’s Subcontractor’s, premises, the Contractor shall furnish, or cause to be furnished, without additional charge, all reasonable facilities and assistance to the City to facilitate such inspection. 8. NO REPLACEMENT OF DEFECTIVE TENDER: Every tender or delivery of deliverables must fully comply with all provisions of the Contract as to time of delivery, quality, and quantity. Any non-complying tender shall constitute a breach and the Contractor shall not have the right to substitute a conforming tender; provided, where the time for performance has not yet expired, the Contractor may notify the City of the intention to cure and may then make a conforming tender within the time allotted in the contract. 9. PLACE AND CONDITION OF WORK: The City shall provide the Contractor access to the sites where the Contractor is to perform the services as required in order for the Contractor to perform the services in a timely and efficient manner, in accordance with and subject to the applicable security laws, rules, and regulations. The Contractor acknowledges that it has satisfied itself as to the nature of the City’s service requirements and specifications, the location and essential characteristics of the work sites, the quality and quantity of materials, equipment, labor and facilities necessary to perform the services, and any other condition or state of fact which could in any way affect performance of the Contractor’s obligations under the contract. The Contractor hereby releases and holds the City harmless from and against any liability or claim for damages of any kind or nature if the actual site or service conditions differ from expected conditions. The contractor shall, at all times, exercise reasonable precautions for the safety of their employees, City Staff, participants and others on or near the City’s facilities. 10. WORKFORCE A. The Contractor shall employ only orderly and competent workers, skilled in the performance of the services which they will perform under the Contract. B. The Contractor, its employees, subcontractors, and subcontractor's employees may not while engaged in participating or responding to a solicitation or while in the course and scope of delivering goods or services under a City of Denton contract or on the City's property . i. use or possess a firearm, including a concealed handgun that is licensed under state law, except as required by the terms of the contract; or ii. use or possess alcoholic or other intoxicating beverages, illegal drugs or controlled substances, nor may such workers be intoxicated, or under the influence of alcohol or drugs, on the job. C. If the City or the City's representative notifies the Contractor that any worker is incompetent, disorderly or disobedient, has knowingly or repeatedly violated safety regulations, has possessed DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 302 Contract # 7546 any firearms, or has possessed or was under the influence of alcohol or drugs on the job, the Contractor shall immediately remove such worker from Contract services, and may not employ such worker again on Contract services without the City's prior written consent. Immigration: The Contractor represents and warrants that it shall comply with the requirements of the Immigration Reform and Control Act of 1986 and 1990 regarding employment verification and retention of verification forms for any individuals hired on or after November 6, 1986, who will perform any labor or services under the Contract and the Illegal Immigration Reform and Immigrant Responsibility Act of 1996 (“IIRIRA) enacted on September 30, 1996. 11. COMPLIANCE WITH HEALTH, SAFETY, AND ENVIRONMENTAL REGULATIONS: The Contractor, it’s Subcontractors, and their respective employees, shall comply fully with all applicable federal, state, and local health, safety, and environmental laws, ordinances, rules and regulations in the performance of the services, including but not limited to those promulgated by the City and by the Occupational Safety and Health Administration (OSHA). In case of conflict, the most stringent safety requirement shall govern. The Contractor shall indemnify and hold the City harmless from and against all claims, demands, suits, actions, judgments, fines, penalties and liability of every kind arising from the breach of the Contractor’s obligations under this paragraph. Environmental Protection: The Respondent shall be in compliance with all applicable standards, orders, or regulations issued pursuant to the mandates of the Clean Air Act (42 U.S.C. §7401 et seq.) and the Federal Water Pollution Control Act, as amended, (33 U.S.C. §1251 et seq.). 12. INVOICES: A. The Contractor shall submit separate invoices in duplicate on each purchase order or purchase release after each delivery. If partial shipments or deliveries are authorized by the City, a separate invoice must be sent for each shipment or delivery made. B. Proper Invoices must include a unique invoice number, the purchase order or delivery order number and the master agreement number if applicable, the Department’s Name, and the name of the point of contact for the Department. Invoices shall be itemized and transportation charges, if any, shall be listed separately. A copy of the bill of lading and the freight waybill, when applicable, shall be attached to the invoice. The Contractor’s name, remittance address and, if applicable, the tax identification number on the invoice must exactly match the information in the Vendor’s registration with the City. Unless otherwise instructed in writing, the City may rely on the remittance address specified on the Contractor’s invoice. C. Invoices for labor shall include a copy of all time-sheets with trade labor rate and deliverables order number clearly identified. Invoices shall also include a tabulation of work-hours at the appropriate rates and grouped by work order number. Time billed for labor shall be limited to hours actually worked at the work site. D. Unless otherwise expressly authorized in the Contract, the Contractor shall pass through all Subcontract and other authorized expenses at actual cost without markup. E. Federal excise taxes, State taxes, or City sales taxes must not be included in the invoiced amount. The City will furnish a tax exemption certificate upon request. 13. PAYMENT: A. All proper invoices need to be sent to Accounts Payable. Approved invoices will be paid within thirty (30) calendar days of the City’s receipt of the deliverables or of the invoice being received DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 303 Contract # 7546 in Accounts Payable, whichever is later. B. If payment is not timely made, (per paragraph A); interest shall accrue on the unpaid balance at the lesser of the rate specified in Texas Government Code Section 2251.025 or the maximum lawful rate; except, if payment is not timely made for a reason for which the City may withhold payment hereunder, interest shall not accrue until ten (10) calendar days after the grounds for withholding payment have been resolved. C. If partial shipments or deliveries are authorized by the City, the Contractor will be paid for the partial shipment or delivery, as stated above, provided that the invoice matches the shipment or delivery. D. The City may withhold or set off the entire payment or part of any payment otherwise due the Contractor to such extent as may be necessary on account of: i. delivery of defective or non-conforming deliverables by the Contractor; ii. third party claims, which are not covered by the insurance which the Contractor is required to provide, are filed or reasonable evidence indicating probable filing of such claims; iii. failure of the Contractor to pay Subcontractors, or for labor, materials or equipment; iv. damage to the property of the City or the City’s agents, employees or contractors, which is not covered by insurance required to be provided by the Contractor; v. reasonable evidence that the Contractor’s obligations will not be completed within the time specified in the Contract, and that the unpaid balance would not be adequate to cover actual or damages for the anticipated delay; vi. failure of the Contractor to submit proper invoices with purchase order number, with all required attachments and supporting documentation; or vii. failure of the Contractor to comply with any material provision of the Contract Documents. E. Notice is hereby given that any awarded firm who is in arrears to the City of Denton for delinquent taxes, the City may offset indebtedness owed the City through payment withholding. F. Payment will be made by check unless the parties mutually agree to payment by credit card or electronic transfer of funds. The Contractor agrees that there shall be no additional charges, surcharges, or penalties to the City for payments made by credit card or electronic funds transfer. G. The awarding or continuation of this contract is dependent upon the availability of funding. The City’s payment obligations are payable only and solely from funds Appropriated and available for this contract. The absence of Appropriated or other lawfully available funds shall render the Contract null and void to the extent funds are not Appropriated or available and any deliverables delivered but unpaid shall be returned to the Contractor. The City shall provide the Contractor written notice of the failure of the City to make an adequate Appropriation for any fiscal year to pay the amounts due under the Contract, or the reduction of any Appropriation to an amount insufficient to permit the City to pay its obligations under the Contract. In the event of none or inadequate appropriation of funds, there will be no penalty nor removal fees charged to the City. 14. TRAVEL EXPENSES: All travel, lodging and per diem expenses in connection with the Contract shall be paid by the Contractor, unless otherwise stated in the contract terms. During the term of this contract, the contractor shall bill and the City shall reimburse contractor for all reasonable and approved out of pocket expenses which are incurred in the connection with the performance of duties hereunder. Notwithstanding the foregoing, expenses for the time spent by the contractor in traveling to and from City facilities shall not be reimbursed, unless otherwise negotiated. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 304 Contract # 7546 15. FINAL PAYMENT AND CLOSE-OUT: A. If a DBE/MBE/WBE Program Plan is agreed to and the Contractor has identified Subcontractors, the Contractor is required to submit a Contract Close-Out MBE/WBE Compliance Report to the Purchasing Manager no later than the 15th calendar day after completion of all work under the contract. Final payment, retainage, or both may be withheld if the Contractor is not in compliance with the requirements as accepted by the City. B. The making and acceptance of final payment will constitute: i. a waiver of all claims by the City against the Contractor, except claims (1) which have been previously asserted in writing and not yet settled, (2) arising from defective work appearing after final inspection, (3) arising from failure of the Contractor to comply with the Contract or the terms of any warranty specified herein, (4) arising from the Contractor’s continuing obligations under the Contract, including but not limited to indemnity and warranty obligations, or (5) arising under the City’s right to audit; and ii. a waiver of all claims by the Contractor against the City other than those previously asserted in writing and not yet settled. 16. SPECIAL TOOLS & TEST EQUIPMENT: If the price stated on the Offer includes the cost of any special tooling or special test equipment fabricated or required by the Contractor for the purpose of filling this order, such special tooling equipment and any process sheets related thereto shall become the property of the City and shall be identified by the Contractor as such. 17. RIGHT TO AUDIT: A. The City shall have the right to audit and make copies of the books, records and computations pertaining to the Contract. The Contractor shall retain such books, records, documents and other evidence pertaining to the Contract period and five years thereafter, except if an audit is in progress or audit findings are yet unresolved, in which case records shall be kept until all audit tasks are completed and resolved. These books, records, documents and other evidence shall be available, within ten (10) business days of written request. Further, the Contractor shall also require all Subcontractors, material suppliers, and other payees to retain all books, records, documents and other evidence pertaining to the Contract, and to allow the City similar access to those documents. All books and records will be made available within a 50 mile radius of the City of Denton. The cost of the audit will be borne by the City unless the audit reveals an overpayment of 1% or greater. If an overpayment of 1% or greater occurs, the reasonable cost of the audit, including any travel costs, must be borne by the Contractor which must be payable within five (5) business days of receipt of an invoice. B. Failure to comply with the provisions of this section shall be a material breach of the Contract and shall constitute, in the City’s sole discretion, grounds for termination thereof. Each of the terms “books”, “records”, “documents” and “other evidence”, as used above, shall be construed to include drafts and electronic files, even if such drafts or electronic files are subsequently used to generate or prepare a final printed document. 18. SUBCONTRACTORS: A. If the Contractor identified Subcontractors in a DBE/MBE/WBE agreed to Plan, the Contractor shall comply with all requirements approved by the City. The Contractor shall not initially employ any Subcontractor except as provided in the Contractor’s Plan. The Contractor shall not substitute any Subcontractor identified in the Plan, unless the substitute has been accepted by the City in writing. No acceptance by the City of any Subcontractor shall constitute a waiver of any rights or remedies of the City with respect to defective deliverables provided by a Subcontractor. If a Plan has been approved, the Contractor is additionally required to submit a monthly Subcontract DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 305 Contract # 7546 Awards and Expenditures Report to the Procurement Manager, no later than the tenth calendar day of each month. B. Work performed for the Contractor by a Subcontractor shall be pursuant to a written contract between the Contractor and Subcontractor. The terms of the subcontract may not conflict with the terms of the Contract, and shall contain provisions that: i. require that all deliverables to be provided by the Subcontractor be provided in strict accordance with the provisions, specifications and terms of the Contract; ii. prohibit the Subcontractor from further subcontracting any portion of the Contract without the prior written consent of the City and the Contractor. The City may require, as a condition to such further subcontracting, that the Subcontractor post a payment bond in form, substance and amount acceptable to the City; iii. require Subcontractors to submit all invoices and applications for payments, including any claims for additional payments, damages or otherwise, to the Contractor in sufficient time to enable the Contractor to include same with its invoice or application for payment to the City in accordance with the terms of the Contract; iv. require that all Subcontractors obtain and maintain, throughout the term of their contract, insurance in the type and amounts specified for the Contractor, with the City being a named insured as its interest shall appear; and v. require that the Subcontractor indemnify and hold the City harmless to the same extent as the Contractor is required to indemnify the City. C. The Contractor shall be fully responsible to the City for all acts and omissions of the Subcontractors just as the Contractor is responsible for the Contractor's own acts and omissions. Nothing in the Contract shall create for the benefit of any such Subcontractor any contractual relationship between the City and any such Subcontractor, nor shall it create any obligation on the part of the City to pay or to see to the payment of any moneys due any such Subcontractor except as may otherwise be required by law. D. The Contractor shall pay each Subcontractor its appropriate share of payments made to the Contractor not later than ten (10) calendar days after receipt of payment from the City. 19. WARRANTY-PRICE: A. The Contractor warrants the prices quoted in the Offer are no higher than the Contractor's current prices on orders by others for like deliverables under similar terms of purchase. B. The Contractor certifies that the prices in the Offer have been arrived at independently without consultation, communication, or agreement for the purpose of restricting competition, as to any matter relating to such fees with any other firm or with any competitor. C. In addition to any other remedy available, the City may deduct from any amounts owed to the Contractor, or otherwise recover, any amounts paid for items in excess of the Contractor's current prices on orders by others for like deliverables under similar terms of purchase. 20. WARRANTY – TITLE: The Contractor warrants that it has good and indefeasible title to all deliverables furnished under the Contract, and that the deliverables are free and clear of all liens, claims, security interests and encumbrances. The Contractor shall indemnify and hold the City harmless from and against all adverse title claims to the deliverables. 21. WARRANTY – DELIVERABLES: The Contractor warrants and represents that all deliverables sold the City under the Contract shall be free from defects in design, workmanship or manufacture, and conform in all material respects to the specifications, drawings, and descriptions in the Solicitation, to any samples furnished by the Contractor, to the terms, covenants and DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 306 Contract # 7546 conditions of the Contract, and to all applicable State, Federal or local laws, rules, and regulations, and industry codes and standards. Unless otherwise stated in the Solicitation, the deliverables shall be new or recycled merchandise, and not used or reconditioned. A. Recycled deliverables shall be clearly identified as such. B. The Contractor may not limit, exclude or disclaim the foregoing warranty or any warranty implied by law; and any attempt to do so shall be without force or effect. C. Unless otherwise specified in the Contract, the warranty period shall be at least one year from the date of acceptance of the deliverables or from the date of acceptance of any replacement deliverables. If during the warranty period, one or more of the above warranties are breached, the Contractor shall promptly upon receipt of demand either repair the non-conforming deliverables, or replace the non-conforming deliverables with fully conforming deliverables, at the City’s option and at no additional cost to the City. All costs incidental to such repair or replacement, including but not limited to, any packaging and shipping costs shall be borne exclusively by the Contractor. The City shall endeavor to give the Contractor written notice of the breach of warranty within thirty (30) calendar days of discovery of the breach of warranty, but failure to give timely notice shall not impair the City’s rights under this section. D. If the Contractor is unable or unwilling to repair or replace defective or non-conforming deliverables as required by the City, then in addition to any other available remedy, the City may reduce the quantity of deliverables it may be required to purchase under the Contract from the Contractor, and purchase conforming deliverables from other sources. In such event, the Contractor shall pay to the City upon demand the increased cost, if any, incurred by the City to procure such deliverables from another source. E. If the Contractor is not the manufacturer, and the deliverables are covered by a separate manufacturer’s warranty, the Contractor shall transfer and assign such manufacturer’s warranty to the City. If for any reason the manufacturer’s warranty cannot be fully transferred to the City, the Contractor shall assist and cooperate with the City to the fullest extent to enforce such manufacturer’s warranty for the benefit of the City. 22. WARRANTY – SERVICES: The Contractor warrants and represents that all services to be provided the City under the Contract will be fully and timely performed in a good and workmanlike manner in accordance with generally accepted industry standards and practices, the terms, conditions, and covenants of the Contract, and all applicable Federal, State and local laws, rules or regulations. A. The Contractor may not limit, exclude or disclaim the foregoing warranty or any warranty implied by law, and any attempt to do so shall be without force or effect. B. Unless otherwise specified in the Contract, the warranty period shall be at least one year from the Acceptance Date. If during the warranty period, one or more of the above warranties are breached, the Contractor shall promptly upon receipt of demand perform the services again in accordance with above standard at no additional cost to the City. All costs incidental to such additional performance shall be borne by the Contractor. The City shall endeavor to give the Contractor written notice of the breach of warranty within thirty (30) calendar days of discovery of the breach warranty, but failure to give timely notice shall not impair the City’s rights under this section. C. If the Contractor is unable or unwilling to perform its services in accordance with the above standard as required by the City, then in addition to any other available remedy, the City may reduce the amount of services it may be required to purchase under the Contract from the Contractor, and purchase conforming services from other sources. In such event, the Contractor shall pay to the City upon demand the increased cost, if any, incurred by the City to procure such DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 307 Contract # 7546 services from another source. 23. ACCEPTANCE OF INCOMPLETE OR NON-CONFORMING DELIVERABLES: If, instead of requiring immediate correction or removal and replacement of defective or non-conforming deliverables, the City prefers to accept it, the City may do so. The Contractor shall pay all claims, costs, losses and damages attributable to the City’s evaluation of and determination to accept such defective or non-conforming deliverables. If any such acceptance occurs prior to final payment, the City may deduct such amounts as are necessary to compensate the City for the diminished value of the defective or non-conforming deliverables. If the acceptance occurs after final payment, such amount will be refunded to the City by the Contractor. 24. RIGHT TO ASSURANCE: Whenever one party to the Contract in good faith has reason to question the other party’s intent to perform, demand may be made to the other party for written assurance of the intent to perform. In the event that no assurance is given within the time specified after demand is made, the demanding party may treat this failure as an anticipatory repudiation of the Contract. 25. STOP WORK NOTICE: The City may issue an immediate Stop Work Notice in the event the Contractor is observed performing in a manner that is in violation of Federal, State, or local guidelines, or in a manner that is determined by the City to be unsafe to either life or property. Upon notification, the Contractor will cease all work until notified by the City that the violation or unsafe condition has been corrected. The Contractor shall be liable for all costs incurred by the City as a result of the issuance of such Stop Work Notice. 26. DEFAULT: The Contractor shall be in default under the Contract if the Contractor (a) fails to fully, timely and faithfully perform any of its material obligations under the Contract, (b) fails to provide adequate assurance of performance under Paragraph 24, (c) becomes insolvent or seeks relief under the bankruptcy laws of the United States or (d) makes a material misrepresentation in Contractor’s Offer, or in any report or deliverable required to be submitted by the Contractor to the City. 27. TERMINATION FOR CAUSE: In the event of a default by the Contractor, the City shall have the right to terminate the Contract for cause, by written notice effective ten (10) calendar days, unless otherwise specified, after the date of such notice, unless the Contractor, within such ten (10) day period, cures such default, or provides evidence sufficient to prove to the City’s reasonable satisfaction that such default does not, in fact, exist. In addition to any other remedy available under law or in equity, the City shall be entitled to recover all actual damages, costs, losses and expenses, incurred by the City as a result of the Contractor’s default, including, without limitation, cost of cover, reasonable attorneys’ fees, court costs, and prejudgment and post-judgment interest at the maximum lawful rate. Additionally, in the event of a default by the Contractor, the City may remove the Contractor from the City’s vendor list for three (3) years and any Offer submitted by the Contractor may be disqualified for up to three (3) years. All rights and remedies under the Contract are cumulative and are not exclusive of any other right or remedy provided by law. 28. TERMINATION WITHOUT CAUSE: The City shall have the right to terminate the Contract, in whole or in part, without cause any time upon thirty (30) calendar days’ prior written notice. Upon receipt of a notice of termination, the Contractor shall promptly cease all further work pursuant to the Contract, with such exceptions, if any, specified in the notice of termination. The City shall pay the Contractor, to the extent of funds Appropriated or otherwise legally available for such purposes, for all goods delivered and services performed and obligations incurred prior to DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 308 Contract # 7546 the date of termination in accordance with the terms hereof. 29. FRAUD: Fraudulent statements by the Contractor on any Offer or in any report or deliverable required to be submitted by the Contractor to the City shall be grounds for the termination of the Contract for cause by the City and may result in legal action. 30. DELAYS: A. The City may delay scheduled delivery or other due dates by written notice to the Contractor if the City deems it is in its best interest. If such delay causes an increase in the cost of the work under the Contract, the City and the Contractor shall negotiate an equitable adjustment for costs incurred by the Contractor in the Contract price and execute an amendment to the Contract. The Contractor must assert its right to an adjustment within thirty (30) calendar days from the date of receipt of the notice of delay. Failure to agree on any adjusted price shall be handled under the Dispute Resolution process specified in paragraph 49. However, nothing in this provision shall excuse the Contractor from delaying the delivery as notified. B. Neither party shall be liable for any default or delay in the performance of its obligations under this Contract if, while and to the extent such default or delay is caused by acts of God, fire, riots, civil commotion, labor disruptions, sabotage, sovereign conduct, or any other cause beyond the reasonable control of such Party. In the event of default or delay in contract performance due to any of the foregoing causes, then the time for completion of the services will be extended; provided, however, in such an event, a conference will be held within three (3) business days to establish a mutually agreeable period of time reasonably necessary to overcome the effect of such failure to perform. 31. INDEMNITY: A. Definitions: i. "Indemnified Claims" shall include any and all claims, demands, suits, causes of action, judgments and liability of every character, type or description, including all reasonable costs and expenses of litigation, mediation or other alternate dispute resolution mechanism, including attorney and other professional fees for: (1) damage to or loss of the property of any person (including, but not limited to the City, the Contractor, their respective agents, officers, employees and subcontractors; the officers, agents, and employees of such subcontractors; and third parties); and/or (2) death, bodily injury, illness, disease, worker's compensation, loss of services, or loss of income or wages to any person (including but not limited to the agents, officers and employees of the City, the Contractor, the Contractor’s subcontractors, and third parties), ii. "Fault" shall include the sale of defective or non-conforming deliverables, negligence, willful misconduct or a breach of any legally imposed strict liability standard. B. THE CONTRACTOR SHALL DEFEND (AT THE OPTION OF THE CITY), INDEMNIFY, AND HOLD THE CITY, ITS SUCCESSORS, ASSIGNS, OFFICERS, EMPLOYEES AND ELECTED OFFICIALS HARMLESS FROM AND AGAINST ALL INDEMNIFIED CLAIMS DIRECTLY ARISING OUT OF, INCIDENT TO, CONCERNING OR RESULTING FROM THE FAULT OF THE CONTRACTOR, OR THE CONTRACTOR'S AGENTS, EMPLOYEES OR SUBCONTRACTORS, IN THE PERFORMANCE OF THE CONTRACTOR’S OBLIGATIONS UNDER THE CONTRACT. NOTHING HEREIN SHALL BE DEEMED TO LIMIT THE RIGHTS OF THE CITY OR THE CONTRACTOR (INCLUDING, BUT NOT LIMITED TO, THE DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 309 Contract # 7546 RIGHT TO SEEK CONTRIBUTION) AGAINST ANY THIRD PARTY WHO MAY BE LIABLE FOR AN INDEMNIFIED CLAIM. 32. INSURANCE: The following insurance requirements are applicable, in addition to the specific insurance requirements detailed in Appendix A for services only. The successful firm shall procure and maintain insurance of the types and in the minimum amounts acceptable to the City of Denton. The insurance shall be written by a company licensed to do business in the State of Texas and satisfactory to the City of Denton. A. General Requirements: i. The Contractor shall at a minimum carry insurance in the types and amounts indicated and agreed to, as submitted to the City and approved by the City within the procurement process, for the duration of the Contract, including extension options and hold over periods, and during any warranty period. ii. The Contractor shall provide Certificates of Insurance with the coverage’s and endorsements required to the City as verification of coverage prior to contract execution and within fourteen (14) calendar days after written request from the City. Failure to provide the required Certificate of Insurance may subject the Offer to disqualification from consideration for award. The Contractor must also forward a Certificate of Insurance to the City whenever a previously identified policy period has expired, or an extension option or hold over period is exercised, as verification of continuing coverage. iii. The Contractor shall not commence work until the required insurance is obtained and until such insurance has been reviewed by the City. Approval of insurance by the City shall not relieve or decrease the liability of the Contractor hereunder and shall not be construed to be a limitation of liability on the part of the Contractor. iv. The Contractor must submit certificates of insurance to the City for all subcontractors prior to the subcontractors commencing work on the project. v. The Contractor’s and all subcontractors’ insurance coverage shall be written by companies licensed to do business in the State of Texas at the time the policies are issued and shall be written by companies with A.M. Best ratings of A- VII or better. The City will accept workers’ compensation coverage written by the Texas Workers’ Compensation Insurance Fund. vi. All endorsements naming the City as additional insured, waivers, and notices of cancellation endorsements as well as the Certificate of Insurance shall contain the solicitation number and the following information: City of Denton Materials Management Department 901B Texas Street Denton, Texas 76209 vii. The “other” insurance clause shall not apply to the City where the City is an additional insured shown on any policy. It is intended that policies required in the Contract, covering both the City and the Contractor, shall be considered primary coverage as applicable. viii. If insurance policies are not written for amounts agreed to with the City, the Contractor shall carry Umbrella or Excess Liability Insurance for any differences in amounts specified. If Excess Liability Insurance is provided, it shall follow the form of the primary coverage. ix. The City shall be entitled, upon request, at an agreed upon location, and without expense, to review certified copies of policies and endorsements thereto and may make any reasonable requests for deletion or revision or modification of particular policy terms, conditions, limitations, or exclusions except where policy provisions are established by law DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 310 Contract # 7546 or regulations binding upon either of the parties hereto or the underwriter on any such policies. x. The City reserves the right to review the insurance requirements set forth during the effective period of the Contract and to make reasonable adjustments to insurance coverage, limits, and exclusions when deemed necessary and prudent by the City based upon changes in statutory law, court decisions, the claims history of the industry or financial condition of the insurance company as well as the Contractor. xi. The Contractor shall not cause any insurance to be canceled nor permit any insurance to lapse during the term of the Contract or as required in the Contract. xii. The Contractor shall be responsible for premiums, deductibles and self-insured retentions, if any, stated in policies. All deductibles or self-insured retentions shall be disclosed on the Certificate of Insurance. xiii. The Contractor shall endeavor to provide the City thirty (30) calendar days’ written notice of erosion of the aggregate limits below occurrence limits for all applicable coverage’s indicated within the Contract. xiv. The insurance coverage’s specified in within the solicitation and requirements are required minimums and are not intended to limit the responsibility or liability of the Contractor. B. Specific Coverage Requirements: Specific insurance requirements are contained in the solicitation instrument. 33. CLAIMS: If any claim, demand, suit, or other action is asserted against the Contractor which arises under or concerns the Contract, or which could have a material adverse effect on the Contractor’s ability to perform thereunder, the Contractor shall give written notice thereof to the City within ten (10) calendar days after receipt of notice by the Contractor. Such notice to the City shall state the date of notification of any such claim, demand, suit, or other action; the names and addresses of the claimant(s); the basis thereof; and the name of each person against whom such claim is being asserted. Such notice shall be delivered personally or by mail and shall be sent to the City and to the Denton City Attorney. Personal delivery to the City Attorney shall be to City Hall, 215 East McKinney Street, Denton, Texas 76201. 34. NOTICES: Unless otherwise specified, all notices, requests, or other communications required or appropriate to be given under the Contract shall be in writing and shall be deemed delivered three (3) business days after postmarked if sent by U.S. Postal Service Certified or Registered Mail, Return Receipt Requested. Notices delivered by other means shall be deemed delivered upon receipt by the addressee. Routine communications may be made by first class mail, telefax, or other commercially accepted means. Notices to the Contractor shall be sent to the address specified in the Contractor’s Offer, or at such other address as a party may notify the other in writing. Notices to the City shall be addressed to the City at 901B Texas Street, Denton, Texas 76209 and marked to the attention of the Purchasing Manager. 35. RIGHTS TO BID, PROPOSAL AND CONTRACTUAL MATERIAL: All material submitted by the Contractor to the City shall become property of the City upon receipt. Any portions of such material claimed by the Contractor to be proprietary must be clearly marked as such. Determination of the public nature of the material is subject to the Texas Public Information Act, Chapter 552, and Texas Government Code. 36. NO WARRANTY BY CITY AGAINST INFRINGEMENTS: The Contractor represents DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 311 Contract # 7546 and warrants to the City that: (i) the Contractor shall provide the City good and indefeasible title to the deliverables and (ii) the deliverables supplied by the Contractor in accordance with the specifications in the Contract will not infringe, directly or contributorily, any patent, trademark, copyright, trade secret, or any other intellectual property right of any kind of any third party; that no claims have been made by any person or entity with respect to the ownership or operation of the deliverables and the Contractor does not know of any valid basis for any such claims. The Contractor shall, at its sole expense, defend, indemnify, and hold the City harmless from and against all liability, damages, and costs (including court costs and reasonable fees of attorneys and other professionals) arising out of or resulting from: (i) any claim that the City’s exercise anywhere in the world of the rights associated with the City’s’ ownership, and if applicable, license rights, and its use of the deliverables infringes the intellectual property rights of any third party; or (ii) the Contractor’s breach of any of Contractor’s representations or warranties stated in this Contract. In the event of any such claim, the City shall have the right to monitor such claim or at its option engage its own separate counsel to act as co-counsel on the City’s behalf. Further, Contractor agrees that the City’s specifications regarding the deliverables shall in no way diminish Contractor’s warranties or obligations under this paragraph and the City makes no warranty that the production, development, or delivery of such deliverables will not impact such warranties of Contractor. 37. CONFIDENTIALITY: In order to provide the deliverables to the City, Contractor may require access to certain of the City’s and/or its licensors’ confidential information (including inventions, employee information, trade secrets, confidential know-how, confidential business information, and other information which the City or its licensors consider confidential) (collectively, “Confidential Information”). Contractor acknowledges and agrees that the Confidential Information is the valuable property of the City and/or its licensors and any unauthorized use, disclosure, dissemination, or other release of the Confidential Information will substantially injure the City and/or its licensors. The Contractor (including its employees, subcontractors, agents, or representatives) agrees that it will maintain the Confidential Information in strict confidence and shall not disclose, disseminate, copy, divulge, recreate, or otherwise use the Confidential Information without the prior written consent of the City or in a manner not expressly permitted under this Agreement, unless the Confidential Information is required to be disclosed by law or an order of any court or other governmental authority with proper jurisdiction, provided the Contractor promptly notifies the City before disclosing such information so as to permit the City reasonable time to seek an appropriate protective order. The Contractor agrees to use protective measures no less stringent than the Contractor uses within its own business to protect its own most valuable information, which protective measures shall under all circumstances be at least reasonable measures to ensure the continued confidentiality of the Confidential Information. 38. OWNERSHIP AND USE OF DELIVERABLES: The City shall own all rights, titles, and interests throughout the world in and to the deliverables. A. Patents. As to any patentable subject matter contained in the deliverables, the Contractor agrees to disclose such patentable subject matter to the City. Further, if requested by the City, the Contractor agrees to assign and, if necessary, cause each of its employees to assign the entire right, title, and interest to specific inventions under such patentable subject matter to the City and to execute, acknowledge, and deliver and, if necessary, cause each of its employees to execute, acknowledge, and deliver an assignment of letters patent, in a form to be reasonably approved by the City, to the City upon request by the City. B. Copyrights. As to any deliverables containing copyrightable subject matter, the Contractor DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 312 Contract # 7546 agrees that upon their creation, such deliverables shall be considered as work made-for-hire by the Contractor for the City and the City shall own all copyrights in and to such deliverables, provided however, that nothing in this Paragraph 38 shall negate the City’s sole or joint ownership of any such deliverables arising by virtue of the City’s sole or joint authorship of such deliverables. Should by operation of law, such deliverables not be considered works made-for-hire, the Contractor hereby assigns to the City (and agrees to cause each of its employees providing services to the City hereunder to execute, acknowledge, and deliver an assignment to the City of) all worldwide right, title, and interest in and to such deliverables. With respect to such work made- for-hire, the Contractor agrees to execute, acknowledge, and deliver and cause each of its employees providing services to the City hereunder to execute, acknowledge, and deliver a work-made-for-hire agreement, in a form to be reasonably approved by the City, to the City upon delivery of such deliverables to the City or at such other time as the City may request. C. Additional Assignments. The Contractor further agrees to, and if applicable, cause each of its employees to, execute, acknowledge, and deliver all applications, specifications, oaths, assignments, and all other instruments which the City might reasonably deem necessary in order to apply for and obtain copyright protection, mask work registration, trademark registration and/or protection, letters patent, or any similar rights in any and all countries and in order to assign and convey to the City, its successors, assigns and nominees, the sole and exclusive right, title, and interest in and to the deliverables. The Contractor’s obligations to execute, acknowledge, and deliver (or cause to be executed, acknowledged, and delivered) instruments or papers such as those described in this Paragraph 38 a., b., and c. shall continue after the termination of this Contract with respect to such deliverables. In the event the City should not seek to obtain copyright protection, mask work registration or patent protection for any of the deliverables, but should desire to keep the same secret, the Contractor agrees to treat the same as Confidential Information under the terms of Paragraph 37 above. 39. PUBLICATIONS: All published material and written reports submitted under the Contract must be originally developed material unless otherwise specifically provided in the Contract. When material not originally developed is included in a report in any form, the source shall be identified. 40. ADVERTISING: The Contractor shall not advertise or publish, without the City’s prior consent, the fact that the City has entered into the Contract, except to the extent required by law. 41. NO CONTINGENT FEES: The Contractor warrants that no person or selling agency has been employed or retained to solicit or secure the Contract upon any agreement or understanding for commission, percentage, brokerage, or contingent fee, excepting bona fide employees of bona fide established commercial or selling agencies maintained by the Contractor for the purpose of securing business. For breach or violation of this warranty, the City shall have the right, in addition to any other remedy available, to cancel the Contract without liability and to deduct from any amounts owed to the Contractor, or otherwise recover, the full amount of such commission, percentage, brokerage or contingent fee. 42. GRATUITIES: The City may, by written notice to the Contractor, cancel the Contract without liability if it is determined by the City that gratuities were offered or given by the Contractor or any agent or representative of the Contractor to any officer or employee of the City of Denton with a view toward securing the Contract or securing favorable treatment with respect to the awarding DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 313 Contract # 7546 or amending or the making of any determinations with respect to the performing of such contract. In the event the Contract is canceled by the City pursuant to this provision, the City shall be entitled, in addition to any other rights and remedies, to recover or withhold the amount of the cost incurred by the Contractor in providing such gratuities. 43. PROHIBITION AGAINST PERSONAL INTEREST IN CONTRACTS: No officer, employee, independent consultant, or elected official of the City who is involved in the development, evaluation, or decision-making process of the performance of any solicitation shall have a financial interest, direct or indirect, in the Contract resulting from that solicitation solicitation as defined in the City’s Ethic Ordinance 18-757 and in the City Charter chapter 2 article XI(Ethics). Any willful violation of this section shall constitute impropriety in office, and any officer or employee guilty thereof shall be subject to disciplinary action up to and including dismissal. Any violation of this provision, with the knowledge, expressed or implied, of the Contractor shall render the Contract voidable by the City. The Contractor shall complete and submit the City’s Conflict of Interest Questionnaire. 44. INDEPENDENT CONTRACTOR: The Contract shall not be construed as creating an employer/employee relationship, a partnership, or a joint venture. The Contractor’s services shall be those of an independent contractor. The Contractor agrees and understands that the Contract does not grant any rights or privileges established for employees of the City of Denton, Texas for the purposes of income tax, withholding, social security taxes, vacation or sick leave benefits, worker’s compensation, or any other City employee benefit. The City shall not have supervision and control of the Contractor or any employee of the Contractor, and it is expressly understood that Contractor shall perform the services hereunder according to the attached specifications at the general direction of the City Manager of the City of Denton, Texas, or his designee under this agreement. The contractor is expressly free to advertise and perform services for other parties while performing services for the City. 45. ASSIGNMENT-DELEGATION: The Contract shall be binding upon and ensure to the benefit of the City and the Contractor and their respective successors and assigns, provided however, that no right or interest in the Contract shall be assigned and no obligation shall be delegated by the Contractor without the prior written consent of the City. Any attempted assignment or delegation by the Contractor shall be void unless made in conformity with this paragraph. The Contract is not intended to confer rights or benefits on any person, firm or entity not a party hereto; it being the intention of the parties that there are no third party beneficiaries to the Contract. The Vendor shall notify the City’s Purchasing Manager, in writing, of a company name, ownership, or address change for the purpose of maintaining updated City records. The president of the company or authorized official must sign the letter. A letter indicating changes in a company name or ownership must be accompanied with supporting legal documentation such as an updated W-9, documents filed with the state indicating such change, copy of the board of director’s resolution approving the action, or an executed merger or acquisition agreement. Failure to do so may adversely impact future invoice payments. 46. WAIVER: No claim or right arising out of a breach of the Contract can be discharged in whole or in part by a waiver or renunciation of the claim or right unless the waiver or renunciation is supported by consideration and is in writing signed by the aggrieved party. No waiver by either DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 314 Contract # 7546 the Contractor or the City of any one or more events of default by the other party shall operate as, or be construed to be, a permanent waiver of any rights or obligations under the Contract, or an express or implied acceptance of any other existing or future default or defaults, whether of a similar or different character. 47. MODIFICATIONS: The Contract can be modified or amended only by a writing signed by both parties. No pre-printed or similar terms on any the Contractor invoice, order or other document shall have any force or effect to change the terms, covenants, and conditions of the Contract. 48. INTERPRETATION: The Contract is intended by the parties as a final, complete and exclusive statement of the terms of their agreement. No course of prior dealing between the parties or course of performance or usage of the trade shall be relevant to supplement or explain any term used in the Contract. Although the Contract may have been substantially drafted by one party, it is the intent of the parties that all provisions be construed in a manner to be fair to both parties, reading no provisions more strictly against one party or the other. Whenever a term defined by the Uniform Commercial Code, as enacted by the State of Texas, is used in the Contract, the UCC definition shall control, unless otherwise defined in the Contract. 49. DISPUTE RESOLUTION: A. If a dispute arises out of or relates to the Contract, or the breach thereof, the parties agree to negotiate prior to prosecuting a suit for damages. However, this section does not prohibit the filing of a lawsuit to toll the running of a statute of limitations or to seek injunctive relief. Either party may make a written request for a meeting between representatives of each party within fourteen (14) calendar days after receipt of the request or such later period as agreed by the parties. Each party shall include, at a minimum, one (1) senior level individual with decision-making authority regarding the dispute. The purpose of this and any subsequent meeting is to attempt in good faith to negotiate a resolution of the dispute. If, within thirty (30) calendar days after such meeting, the parties have not succeeded in negotiating a resolution of the dispute, they will proceed directly to mediation as described below. Negotiation may be waived by a written agreement signed by both parties, in which event the parties may proceed directly to mediation as described below. B. If the efforts to resolve the dispute through negotiation fail, or the parties waive the negotiation process, the parties may select, within thirty (30) calendar days, a mediator trained in mediation skills to assist with resolution of the dispute. Should they choose this option; the City and the Contractor agree to act in good faith in the selection of the mediator and to give consideration to qualified individuals nominated to act as mediator. Nothing in the Contract prevents the parties from relying on the skills of a person who is trained in the subject matter of the dispute or a contract interpretation expert. If the parties fail to agree on a mediator within thirty (30) calendar days of initiation of the mediation process, the mediator shall be selected by the Denton County Alternative Dispute Resolution Program (DCAP). The parties agree to participate in mediation in good faith for up to thirty (30) calendar days from the date of the first mediation session. The City and the Contractor will share the mediator’s fees equally and the parties will bear their own costs of participation such as fees for any consultants or attorneys they may utilize to represent them or otherwise assist them in the mediation. 50. JURISDICTION AND VENUE: The Contract is made under and shall be governed by the laws of the State of Texas, including, when applicable, the Uniform Commercial Code as adopted in Texas, V.T.C.A., Bus. & Comm. Code, Chapter 1, excluding any rule or principle that would DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 315 Contract # 7546 refer to and apply the substantive law of another state or jurisdiction. All issues arising from this Contract shall be resolved in the courts of Denton County, Texas and the parties agree to submit to the exclusive personal jurisdiction of such courts. The foregoing, however, shall not be construed or interpreted to limit or restrict the right or ability of the City to seek and secure injunctive relief from any competent authority as contemplated herein. 51. INVALIDITY: The invalidity, illegality, or unenforceability of any provision of the Contract shall in no way affect the validity or enforceability of any other portion or provision of the Contract. Any void provision shall be deemed severed from the Contract and the balance of the Contract shall be construed and enforced as if the Contract did not contain the particular portion or provision held to be void. The parties further agree to reform the Contract to replace any stricken provision with a valid provision that comes as close as possible to the intent of the stricken provision. The provisions of this section shall not prevent this entire Contract from being void should a provision which is the essence of the Contract be determined to be void. 52. HOLIDAYS: The following holidays are observed by the City: New Year’s Day (observed) MLK Day Memorial Day 4th of July Labor Day Thanksgiving Day Day After Thanksgiving Christmas Eve (observed) Christmas Day (observed) New Year’s Day (observed) If a Legal Holiday falls on Saturday, it will be observed on the preceding Friday. If a Legal Holiday falls on Sunday, it will be observed on the following Monday. Normal hours of operation shall be between 8:00 am and 4:00 pm, Monday through Friday, excluding City of Denton Holidays. Any scheduled deliveries or work performance not within the normal hours of operation must be approved by the City Manager of Denton, Texas or his authorized designee. 53. SURVIVABILITY OF OBLIGATIONS: All provisions of the Contract that impose continuing obligations on the parties, including but not limited to the warranty, indemnity, and confidentiality obligations of the parties, shall survive the expiration or termination of the Contract. 54. NON-SUSPENSION OR DEBARMENT CERTIFICATION: The City of Denton is prohibited from contracting with or making prime or sub-awards to parties that are suspended or debarred or whose principals are suspended or debarred from Federal, State, or City of Denton Contracts. By accepting a Contract with the City, the Vendor certifies that its firm and its principals are not currently suspended or debarred from doing business with the Federal Government, as indicated by the General Services Administration List of Parties Excluded from Federal Procurement and Non-Procurement Programs, the State of Texas, or the City of Denton. 55. EQUAL OPPORTUNITY A. Equal Employment Opportunity: No Offeror, or Offeror’s agent, shall engage in any discriminatory employment practice. No person shall, on the grounds of race, sex, sexual DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 316 Contract # 7546 orientation, age, disability, creed, color, genetic testing, or national origin, be refused the benefits of, or be otherwise subjected to discrimination under any activities resulting from this RFQ. B. Americans with Disabilities Act (ADA) Compliance: No Offeror, or Offeror’s agent, shall engage in any discriminatory employment practice against individuals with disabilities as defined in the ADA. 56. BUY AMERICAN ACT-SUPPLIES (Applicable to certain federally funded requirements) The following federally funded requirements are applicable. A. Definitions. As used in this paragraph – i. "Component" means an article, material, or supply incorporated directly into an end product. ii. "Cost of components" means - (1) For components purchased by the Contractor, the acquisition cost, including transportation costs to the place of incorporation into the end product (whether or not such costs are paid to a domestic firm), and any applicable duty (whether or not a duty-free entry certificate is issued); or (2) For components manufactured by the Contractor, all costs associated with the manufacture of the component, including transportation costs as described in paragraph (1) of this definition, plus allocable overhead costs, but excluding profit. Cost of components does not include any costs associated with the manufacture of the end product. iii. "Domestic end product" means- (1) An unmanufactured end product mined or produced in the United States; or (2) An end product manufactured in the United States, if the cost of its components mined, produced, or manufactured in the United States exceeds 50 percent of the cost of all its components. Components of foreign origin of the same class or kind as those that the agency determines are not mined, produced, or manufactured in sufficient and reasonably available commercial quantities of a satisfactory quality are treated as domestic. Scrap generated, collected, and prepared for processing in the United States is considered domestic. iv. "End product" means those articles, materials, and supplies to be acquired under the contract for public use. v. "Foreign end product" means an end product other than a domestic end product. vi. "United States" means the 50 States, the District of Columbia, and outlying areas. B. The Buy American Act (41 U.S.C. 10a - 10d) provides a preference for domestic end products for supplies acquired for use in the United States. C. The City does not maintain a list of foreign articles that will be treated as domestic for this Contract; but will consider for approval foreign articles as domestic for this product if the articles are on a list approved by another Governmental Agency. The Offeror shall submit documentation with their Offer demonstrating that the article is on an approved Governmental list. D. The Contractor shall deliver only domestic end products except to the extent that it specified delivery of foreign end products in the provision of the Solicitation entitled "Buy American Act Certificate". 57. RIGHT TO INFORMATION: The City of Denton reserves the right to use any and all information presented in any response to this contract, whether amended or not, except as prohibited by law. Selection of rejection of the submittal does not affect this right. 58. LICENSE FEES OR TAXES: Provided the solicitation requires an awarded contractor or supplier to be licensed by the State of Texas, any and all fees and taxes are the responsibility of the respondent. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 317 Contract # 7546 59. PREVAILING WAGE RATES: The contractor shall comply with prevailing wage rates as defined by the United States Department of Labor Davis-Bacon Wage Determination at http://www.dol.gov/whd/contracts/dbra.htm and at the Wage Determinations website www.wdol.gov for Denton County, Texas (WD-2509). 60. COMPLIANCE WITH ALL STATE, FEDERAL, AND LOCAL LAWS: The contractor or supplier shall comply with all State, Federal, and Local laws and requirements. The Respondent must comply with all applicable laws at all times, including, without limitation, the following: (i) §36.02 of the Texas Penal Code, which prohibits bribery; (ii) §36.09 of the Texas Penal Code, which prohibits the offering or conferring of benefits to public servants. The Respondent shall give all notices and comply with all laws and regulations applicable to furnishing and performance of the Contract. 61. FEDERAL, STATE, AND LOCAL REQUIREMENTS: Respondent shall demonstrate on-site compliance with the Federal Tax Reform Act of 1986, Section 1706, amending Section 530 of the Revenue Act of 1978, dealing with issuance of Form W-2's to common law employees. Respondent is responsible for both federal and State unemployment insurance coverage and standard Workers’ Compensation insurance coverage. Respondent shall ensure compliance with all federal and State tax laws and withholding requirements. The City of Denton shall not be liable to Respondent or its employees for any Unemployment or Workers' Compensation coverage, or federal or State withholding requirements. Contractor shall indemnify the City of Denton and shall pay all costs, penalties, or losses resulting from Respondent's omission or breach of this Section. 62. DRUG FREE WORKPLACE: The contractor shall comply with the applicable provisions of the Drug-Free Work Place Act of 1988 (Public Law 100-690, Title V, Subtitle D; 41 U.S.C. 701 ET SEQ.) and maintain a drug-free work environment; and the final rule, government-wide requirements for drug-free work place (grants), issued by the Office of Management and Budget and the Department of Defense (32 CFR Part 280, Subpart F) to implement the provisions of the Drug-Free Work Place Act of 1988 is incorporated by reference and the contractor shall comply with the relevant provisions thereof, including any amendments to the final rule that may hereafter be issued. 63. RESPONDENT LIABILITY FOR DAMAGE TO GOVERNMENT PROPERTY: The Respondent shall be liable for all damages to government-owned, leased, or occupied property and equipment caused by the Respondent and its employees, agents, subcontractors, and suppliers, including any delivery or cartage company, in connection with any performance pursuant to the Contract. The Respondent shall notify the City of Denton Procurement Manager in writing of any such damage within one (1) calendar day. 64. FORCE MAJEURE: The City of Denton, any Customer, and the Respondent shall not be responsible for performance under the Contract should it be prevented from performance by an act of war, order of legal authority, act of God, or other unavoidable cause not attributable to the fault or negligence of the City of Denton. In the event of an occurrence under this Section, the Respondent will be excused from any further performance or observance of the requirements so affected for as long as such circumstances prevail and the Respondent continues to use commercially reasonable efforts to recommence performance or observance whenever and to whatever extent possible without delay. The Respondent shall immediately notify the City of Denton Procurement Manager by telephone (to be confirmed in writing within five (5) calendar DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 318 Contract # 7546 days of the inception of such occurrence) and describe at a reasonable level of detail the circumstances causing the non-performance or delay in performance. 65. NON-WAIVER OF RIGHTS: Failure of a Party to require performance by another Party under the Contract will not affect the right of such Party to require performance in the future. No delay, failure, or waiver of either Party’s exercise or partial exercise of any right or remedy under the Contract shall operate to limit, impair, preclude, cancel, waive or otherwise affect such right or remedy. A waiver by a Party of any breach of any term of the Contract will not be construed as a waiver of any continuing or succeeding breach. 66. NO WAIVER OF SOVEREIGN IMMUNITY: The Parties expressly agree that no provision of the Contract is in any way intended to constitute a waiver by the City of Denton of any immunities from suit or from liability that the City of Denton may have by operation of law. 67. RECORDS RETENTION: The Respondent shall retain all financial records, supporting documents, statistical records, and any other records or books relating to the performances called for in the Contract. The Respondent shall retain all such records for a period of four (4) years after the expiration of the Contract, or until the CPA or State Auditor's Office is satisfied that all audit and litigation matters are resolved, whichever period is longer. The Respondent shall grant access to all books, records and documents pertinent to the Contract to the CPA, the State Auditor of Texas, and any federal governmental entity that has authority to review records due to federal funds being spent under the Contract. Should a conflict arise between any of the contract documents, it shall be resolved with the following order of precedence (if applicable). In any event, the final negotiated contract shall take precedence over any and all contract documents to the extent of such conflict. 1. Final negotiated contract 2. RFP/Bid documents 3. City’s standard terms and conditions 4. Purchase order 5. Supplier terms and conditions DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 319 Contract # 7546 Exhibit D INSURANCE REQUIREMENTS AND WORKERS’ COMPENSATION REQUIREMENTS Upon contract execution, all insurance requirements shall become contractual obligations, which the successful contractor shall have a duty to maintain throughout the course of this contract. STANDARD PROVISIONS: Without limiting any of the other obligations or liabilities of the Contractor, the Contractor shall provide and maintain until the contracted work has been completed and accepted by the City of Denton, Owner, the minimum insurance coverage as indicated hereinafter. Contractor shall file with the Purchasing Department satisfactory certificates of insurance including any applicable addendum or endorsements, containing the contract number and title of the project. Contractor may, upon written request to the Purchasing Department, ask for clarification of any insurance requirements at any time; however, Contractor shall not commence any work or deliver any material until he or she receives notification that the contract has been accepted, approved, and signed by the City of Denton. All insurance policies proposed or obtained in satisfaction of these requirements shall comply with the following general specifications, and shall be maintained in compliance with these general specifications throughout the duration of the Contract, or longer, if so noted: • Each policy shall be issued by a company authorized to do business in the State of Texas with an A.M. Best Company rating of at least A or better. • Any deductibles or self-insured retentions shall be declared in the proposal. If requested by the City, the insurer shall reduce or eliminate such deductibles or self-insured retentions with respect to the City, its officials, agents, employees and volunteers; or, the contractor shall procure a bond guaranteeing payment of losses and related investigations, claim administration and defense expenses. • Liability policies shall be endorsed to provide the following: ▪ Name as Additional Insured the City of Denton, its Officials, Agents, Employees and volunteers. ▪ That such insurance is primary to any other insurance available to the Additional Insured with respect to claims covered under the policy and that this insurance applies separately to each insured against whom claim is made or suit is brought. The inclusion of more than one insured shall not operate to increase the insurer's limit of liability. ▪ Provide a Waiver of Subrogation in favor of the City of Denton, its officials, agents, employees, and volunteers. • Cancellation: City requires 30 day written notice should any of the policies described on the certificate be cancelled or materially changed before the expiration date. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 320 Contract # 7546 • Should any of the required insurance be provided under a claims made form, Contractor shall maintain such coverage continuously throughout the term of this contract and, without lapse, for a period of three years beyond the contract expiration, such that occurrences arising during the contract term which give rise to claims made after expiration of the contract shall be covered. • Should any of the required insurance be provided under a form of coverage that includes a general annual aggregate limit providing for claims investigation or legal defense costs to be included in the general annual aggregate limit, the Contractor shall either double the occurrence limits or obtain Owners and Contractors Protective Liability Insurance. • Should any required insurance lapse during the contract term, requests for payments originating after such lapse shall not be processed until the City receives satisfactory evidence of reinstated coverage as required by this contract, effective as of the lapse date. If insurance is not reinstated, City may, at its sole option, terminate this agreement effective on the date of the lapse. SPECIFIC ADDITIONAL INSURANCE REQUIREMENTS: All insurance policies proposed or obtained in satisfaction of this Contract shall additionally comply with the following marked specifications, and shall be maintained in compliance with these additional specifications throughout the duration of the Contract, or longer, if so noted: [X] A. General Liability Insurance: General Liability insurance with combined single limits of not less than $2,000,000.00 shall be provided and maintained by the Contractor. The policy shall be written on an occurrence basis either in a single policy or in a combination of underlying and umbrella or excess policies. If the Commercial General Liability form (ISO Form CG 0001 current edition) is used: • Coverage A shall include premises, operations, products, and completed operations, independent contractors, contractual liability covering this contract and broad form property damage coverage. • Coverage B shall include personal injury. • Coverage C, medical payments, is not required. If the Comprehensive General Liability form (ISO Form GL 0002 Current Edition and ISO Form GL 0404) is used, it shall include at least: • Bodily injury and Property Damage Liability for premises, operations, products and completed operations, independent contractors and property damage resulting from explosion, collapse or underground (XCU) exposures. • Broad form contractual liability (preferably by endorsement) covering this contract, personal injury liability and broad form property damage liability. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 321 Contract # 7546 [X] Automobile Liability Insurance: Contractor shall provide Commercial Automobile Liability insurance with Combined Single Limits (CSL) of not less than $500,000 either in a single policy or in a combination of basic and umbrella or excess policies. The policy will include bodily injury and property damage liability arising out of the operation, maintenance and use of all automobiles and mobile equipment used in conjunction with this contract. Satisfaction of the above requirement shall be in the form of a policy endorsement for: • any auto, or • all owned hired and non-owned autos. [ ] Workers’ Compensation Insurance Contractor shall purchase and maintain Workers’ Compensation insurance which, in addition to meeting the minimum statutory requirements for issuance of such insurance, has Employer's Liability limits of at least $100,000 for each accident, $100,000 per each employee, and a $500,000 policy limit for occupational disease. The City need not be named as an "Additional Insured" but the insurer shall agree to waive all rights of subrogation against the City, its officials, agents, employees and volunteers for any work performed for the City by the Named Insured. For building or construction projects, the Contractor shall comply with the provisions of Attachment 1 in accordance with §406.096 of the Texas Labor Code and rule 28TAC 110.110 of the Texas Workers’ Compensation Commission (TWCC). [ ] Owner's and Contractor's Protective Liability Insurance The Contractor shall obtain, pay for and maintain at all times during the prosecution of the work under this contract, an Owner's and Contractor's Protective Liability insurance policy naming the City as insured for property damage and bodily injury which may arise in the prosecution of the work or Contractor's operations under this contract. Coverage shall be on an “occurrence" basis and the policy shall be issued by the same insurance company that carries the Contractor's liability insurance. Policy limits will be at least $500,000.00 combined bodily injury and property damage per occurrence with a $1,000,000.00 aggregate. [ ] Fire Damage Legal Liability Insurance Coverage is required if Broad form General Liability is not provided or is unavailable to the contractor or if a contractor leases or rents a portion of a City building. Limits of not less than each occurrence are required. [X] Professional Liability Insurance Professional liability insurance with limits not less than $1,000,000.00 per claim with respect to negligent acts, errors or omissions in connection with professional services is required under this Agreement. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 322 Contract # 7546 [ ] Builders' Risk Insurance Builders' Risk Insurance, on an All-Risk form for 100% of the completed value shall be provided. Such policy shall include as "Named Insured" the City of Denton and all subcontractors as their interests may appear. [ ] Environmental Liability Insurance Environmental liability insurance for $1,000,000 to cover all hazards contemplated by this contract. [ ] Riggers Insurance The Contractor shall provide coverage for Rigger’s Liability. Said coverage may be provided by a Rigger’s Liability endorsement on the existing CGL coverage; through and Installation Floater covering rigging contractors; or through ISO form IH 00 91 12 11, Rigger’s Liability Coverage form. Said coverage shall mirror the limits provided by the CGL coverage [ ] Commercial Crime Provides coverage for the theft or disappearance of cash or checks, robbery inside/outside the premises, burglary of the premises, and employee fidelity. The employee fidelity portion of this coverage should be written on a “blanket” basis to cover all employees, including new hires. This type insurance should be required if the contractor has access to City funds. Limits of not less than $ each occurrence are required. [ ] Additional Insurance Other insurance may be required on an individual basis for extra hazardous contracts and specific service agreements. If such additional insurance is required for a specific contract, that requirement will be described in the "Specific Conditions" of the contract specifications. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 323 Contract # 7546 ATTACHMENT 1 [ ] Workers’ Compensation Coverage for Building or Construction Projects for Governmental Entities A. Definitions: Certificate of coverage ("certificate")-A copy of a certificate of insurance, a certificate of authority to self-insure issued by the commission, or a coverage agreement (TWCC-81, TWCC-82, TWCC-83, or TWCC-84), showing statutory workers' compensation insurance coverage for the person's or entity's employees providing services on a project, for the duration of the project. Duration of the project - includes the time from the beginning of the work on the project until the contractor's/person's work on the project has been completed and accepted by the governmental entity. Persons providing services on the project ("subcontractor" in §406.096) - includes all persons or entities performing all or part of the services the contractor has undertaken to perform on the project, regardless of whether that person contracted directly with the contractor and regardless of whether that person has employees. This includes, without limitation, independent contractors, subcontractors, leasing companies, motor carriers, owner- operators, employees of any such entity, or employees of any entity which furnishes persons to provide services on the project. "Services" include, without limitation, providing, hauling, or delivering equipment or materials, or providing labor, transportation, or other service related to a project. "Services" does not include activities unrelated to the project, such as food/beverage vendors, office supply deliveries, and delivery of portable toilets. B. The contractor shall provide coverage, based on proper reporting of classification codes and payroll amounts and filing of any overage agreements, which meets the statutory requirements of Texas Labor Code, Section 401.011(44) for all employees of the Contractor providing services on the project, for the duration of the project. C. The Contractor must provide a certificate of coverage to the governmental entity prior to being awarded the contract. D. If the coverage period shown on the contractor's current certificate of coverage ends during the duration of the project, the contractor must, prior to the end of the coverage period, file a new certificate of coverage with the governmental entity showing that coverage has been extended. E. The contractor shall obtain from each person providing services on a project, and provide to the governmental entity: 1. a certificate of coverage, prior to that person beginning work on the DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 324 Contract # 7546 project, so the governmental entity will have on file certificates of coverage showing coverage for all persons providing services on the project; and 2. no later than seven days after receipt by the contractor, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project. F. The contractor shall retain all required certificates of coverage for the duration of the project and for one year thereafter. G. The contractor shall notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the contractor knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project. H. The contractor shall post on each project site a notice, in the text, form and manner prescribed by the Texas Workers' Compensation Commission, informing all persons providing services on the project that they are required to be covered, and stating how a person may verify coverage and report lack of coverage. I. The contractor shall contractually require each person with whom it contracts to provide services on a project, to: 1. provide coverage, based on proper reporting of classification codes and payroll amounts and filing of any coverage agreements, which meets the statutory requirements of Texas Labor Code, Section 401.011(44) for all of its employees providing services on the project, for the duration of the project; 2. provide to the contractor, prior to that person beginning work on the project, a certificate of coverage showing that coverage is being provided for all employees of the person providing services on the project, for the duration of the project; 3. provide the contractor, prior to the end of the coverage period, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project; 4. obtain from each other person with whom it contracts, and provide to the contractor: a. a certificate of coverage, prior to the other person beginning work on the project; and DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 325 Contract # 7546 b. a new certificate of coverage showing extension of coverage, prior to the end of the coverage period, if the coverage period shown on the current certificate of coverage ends during the duration of the project; 5. retain all required certificates of coverage on file for the duration of the project and for one year thereafter; 6. notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the person knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project; and 7. Contractually require each person with whom it contracts, to perform as required by paragraphs (1) - (7), with the certificates of coverage to be provided to the person for whom they are providing services. J. By signing this contract or providing or causing to be provided a certificate of coverage, the contractor is representing to the governmental entity that all employees of the contractor who will provide services on the project will be covered by workers' compensation coverage for the duration of the project, that the coverage will be based on proper reporting of classification codes and payroll amounts, and that all coverage agreements will be filed with the appropriate insurance carrier or, in the case of a self-insured, with the commission's Division of Self-Insurance Regulation. Providing false or misleading information may subject the contractor to administrative penalties, criminal penalties, civil penalties, or other civil actions. K. The contractor’s failure to comply with any of these provisions is a breach of contract by the contractor which entitles the governmental entity to declare the contract void if the contractor does not remedy the breach within ten days after receipt of notice of breach from the governmental entity. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 326 Contract # 7546 Exhibit E Certificate of Interested Parties Electronic Filing In 2015, the Texas Legislature adopted House Bill 1295, which added section 2252.908 of the Government Code. The law states that the City may not enter into this contract unless the Contractor submits a disclosure of interested parties (Form 1295) to the City at the time the Contractor submits the signed contract. The Texas Ethics Commission has adopted rules requiring the business entity to file Form 1295 electronically with the Commission. Contractor will be required to furnish a Certificate of Interest Parties before the contract is awarded, in accordance with Government Code 2252.908. The contractor shall: 1. Log onto the State Ethics Commission Website at : https://www.ethics.state.tx.us/whatsnew/elf_info_form1295.htm 2. Register utilizing the tutorial provided by the State 3. Print a copy of the completed Form 1295 4. Enter the Certificate Number on page 2 of this contract. 5. Complete and sign the Form 1295 6. Email the form to purchasing@cityofdenton.com with the contract number in the subject line. (EX: Contract 1234 – Form 1295) The City must acknowledge the receipt of the filed Form 1295 not later than the 30th day after Council award. Once a Form 1295 is acknowledged, it will be posted to the Texas Ethics Commission’s website within seven business days. DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 327 Line #Description Unit Price 1 SECTION A -BI-ANNUAL MAINTENANCE (2PM visits per year) 2 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033D-D803DU-4; Serial #06-7M71464-01 $2,177.68 3 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033D-A503DU-4; Serial #02-GJW8Q1-02 $1,695.32 4 Annual Preventative Maintenance on Mitsubishi UPS Model #UP2033C-A403SU-2; Serial #00-BU06Q1-05 $2,342.72 5 Annual Preventative Maintenance on GE UPS Model #LP 33; Serial #Q1060-2711-B204B $2,534.84 6 Annual Preventative Maintenance on Toshiba UPS Model #UE3G2L140C61T; Serial #080800603 $1,075.80 7 Annual Preventative Maintenance on PDI PDU Model #PP12-4-100-G-641; Serial #110-1895 $1,306.66 8 Annual Preventative Maintenance on PDI STS Model #STS-FO-STD-2480-150-60; Serial #411-0009 $1,306.66 9 Annual Preventative Maintenance on PDI PDU Model #PPI12-0-050-E-641; Serial #440-0005 $963.48 10 Annual Preventative Maintenance on PDI STS Model #STSSBR-STD-2-480-100-60; Serial #440-0005-1A $963.48 11 Annual Preventative Maintenance on PDI PDU Model #RPP-02-1-441-D3; Serial #180-1672 $805.04 12 SECTION B - BATTERY REPLACEMENT 13 Price per each for 12-300MR Battery-12V (Cost of battery per each only)$155.53 Price per string of 40 for 12-300MR Batteries-12V (Cost of battery per string of 40 only)$6,221.20 Labor to remove,replace and recycle (1) string of 40 $1,200.00 14 Price per each for 150WPC Battery-12V (Cost of battery per each only)$132.00 Price per string of 40 for 150WPC Batteries-12V (Cost of battery per string of 40 only)$5,280.00 Labor to remove,replace and recycle (1) string of 40 $900.00 15 Price per each for 100WPC Battery-12V (Cost of battery per each only)$149.00 Price per string of 30 for 100WPC Batteries-12 (Cost of battery per string of 30 only)$4,470.00 Labor to remove,replace and recycle quantity of 60ea $6,073.00 16 Price per each for 150WPC Battery-12V (Cost of battery per each only)$132.00 Price per string of 24 for 150WPC Batteries-12 (Cost of battery per string of 24 only)$3,168.00 Labor to remove,replace and recycle (48) batteries $677.00 17 Price per each for NPX-35TFR Battery-12V (Cost of battery per each only)$20.00 Price per string of 48 for NPX-35TFR Batteries-12 (Cost of battery per string of 48 only)$960.00 Labor to remove,replace and recycle (48) batteries $575.00 18 Price of Installation and Labor for Battery Replacement (Flat Rate Fee)See Labor Costs above 19 Disposable Fee for Battery Replacement (Price per each battery)Included in labor cost 20 Other Applicable Fees (Please explain) - Freight will be billed as needed/at actual Billed as Needed Exhibit F Battery Replacement on Toshiba UPS Model #UE3G2L140C61T; Serial #080800603 (14kva) Battery Replacement on GE UPS Model #LP 33 Serial #Q1060-2711-B204B (60kva) Battery Replacement on Mitsubishi UPS Model #UP2033D-A503DU-4; Serial #02-GJW8Q1-02 (50kva) Battery Replacement on Mitsubishi UPS Model #UP2033D-D803DU-4; Serial #06-7M71464-01 (80kva) Battery Replacement on Mitsubishi UPS Model #UP2033D-A403SU-2 Serial #00-BU06Q1-05 (40kva) Contract 7546 Exhibit F - Price Sheet DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B 328 Exhibit CONFLICT OF INTEREST QUESTIONNAIRE - FORM CIQ For vendor or other person doing business with local governmental entity This questionnaire reflects changes made to the law by H.B. 23, 84th Leg., Regular Session. This questionnaire is being filed in accordance with Chapter 176, Local Government Code, by a vendor who has a business relationship as defined by Section 176.001(1-a) with a local governmental entity and the vendor meets requirements under Section 176.006(a). By law this questionnaire must be filed with the records administrator of the local government entity not later than the 7th business day after the date the vendor becomes aware of facts that require the statement to be filed. See Section 176.006(a-1), Local Government Code. A vendor commits an offense if the vendor knowingly violates Section 176.006, Local Government Code. An offense under this section is a misdemeanor. 1 Name of vendor who has a business relationship with local governmental entity. 2 Check this box if you are filing an update to a previously filed questionnaire. (The law requires that you file an updated completed questionnaire with the appropriate filing authority not later than the 7th business day after the date on which you became aware that the originally filed questionnaire was incomplete or inaccurate.) 3 Name of local government officer about whom the information in this section is being disclosed. Name of Officer This section, (item 3 including subparts A, B, C & D), must be completed for each officer with whom the vendor has an employment or other business relationship as defined by Section 176.001(1-a), Local Government Code. Attach additional pages to this Form CIQ as necessary. A. Is the local government officer named in this section receiving or likely to receive taxable income, other than investment income, from the vendor? Yes No B. Is the vendor receiving or likely to receive taxable income, other than investment income, from or at the direction of the local government officer named in this section AND the taxable income is not received from the local governmental entity? Yes No C. Is the filer of this questionnaire employed by a corporation or other business entity with respect to which the local government officer serves as an officer or director, or holds an ownership of one percent or more? Yes No D. Describe each employment or business and family relationship with the local government officer named in this section. 4 I have no Conflict of Interest to disclose. 5 Signature of vendor doing business with the governmental entity Date DocuSign Envelope ID: 313A39C9-1B65-4D5F-B9CB-B8480501233B G ON COMPUTER SERVICES, L.L.C., DBA UNIFIED POWER 7/1/2021 329 Certificate Of Completion Envelope Id: 313A39C91B654D5FB9CBB8480501233B Status: Sent Subject: Please DocuSign: City Council Contract 7546 UPS Maintenance Source Envelope: Document Pages: 34 Signatures: 4 Envelope Originator: Certificate Pages: 6 Initials: 1 Cori Power AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 cori.power@cityofdenton.com IP Address: 198.49.140.10 Record Tracking Status: Original 7/1/2021 9:23:06 AM Holder: Cori Power cori.power@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.10 Sent: 7/1/2021 9:28:59 AM Viewed: 7/1/2021 9:29:11 AM Signed: 7/1/2021 9:29:49 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/1/2021 9:29:52 AM Viewed: 7/1/2021 12:22:24 PM Signed: 7/1/2021 12:23:17 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Marcella Lunn marcella.lunn@cityofdenton.com Deputy City Attorney City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/1/2021 12:23:21 PM Viewed: 7/1/2021 4:04:30 PM Signed: 7/1/2021 4:06:51 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Steven Gottlieb steven.gottlieb@unifiedpowerusa.com EVP Sales & Business Development Unified Power Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 12.184.218.61 Signed using mobile Sent: 7/1/2021 4:06:54 PM Viewed: 7/1/2021 6:11:12 PM Signed: 7/1/2021 6:11:44 PM Electronic Record and Signature Disclosure: Accepted: 7/1/2021 6:11:12 PM ID: 197f2fa7-ff1d-4198-914a-a58def61fdcc 330 Signer Events Signature Timestamp Leisha Meine Leisha.Meine@cityofdenton.com Chief Technology Officer City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/1/2021 6:11:48 PM Viewed: 7/2/2021 10:52:49 AM Signed: 7/2/2021 10:58:19 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/2/2021 10:58:22 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Sara Hensley sara.hensley@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Rosa Rios rosa.rios@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Accepted: 7/1/2021 10:36:47 AM ID: f04dd758-be5b-4966-aa99-d198dc46f8f7 In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/1/2021 9:29:52 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Gretna Jones gretna.jones@cityofdenton.com Legal Secretary City of Denton Security Level: Email, Account Authentication (None) Sent: 7/2/2021 10:58:22 AM Viewed: 7/12/2021 3:21:13 PM 331 Carbon Copy Events Status Timestamp Electronic Record and Signature Disclosure: Not Offered via DocuSign City Secretary Office citysecretary@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Curtis Conrad Curtis.Conrad@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Accepted: 6/25/2021 9:49:42 AM ID: df0eb9f9-3de6-4a60-b6cc-3936b46f43a3 Lisa Collaud Lisa.Collaud@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Cheyenne Defee cheyenne.defee@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 7/1/2021 9:28:59 AM Payment Events Status Timestamps Electronic Record and Signature Disclosure 332 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. Electronic Record and Signature Disclosure created on: 7/21/2017 3:59:03 PM Parties agreed to: Steven Gottlieb, Rosa Rios, Curtis Conrad 333 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 334 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 335 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1490,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,a Texas home-rule municipal corporation,authorizing the City Manager,or their designee,to execute a contract with Groggy Dog Sportswear &Graphic Design, LLC for athletic shirts and jerseys for the Parks and Recreation Department;providing for the expenditure of funds therefor;and providing an effective date (RFP 7602 -awarded to Groggy Dog Sportswear &Graphic Design,LLC,for one (1)year,with the option for two (2)additional one (1)year extensions,in the total three (3) year not-to-exceed amount of $120,000.00). City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™336 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Procurement & Compliance ACM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with Groggy Dog Sportswear & Graphic Design, LLC for athletic shirts and jerseys for the Parks and Recreation Department; providing for the expenditure of funds therefor; and providing an effective date (RFP 7602 – awarded to Groggy Dog Sportswear & Graphic Design, LLC, for one (1) year, with the option for two (2) additional one (1) year extensions, in the total three (3) year not-to-exceed amount of $120,000.00). INFORMATION/BACKGROUND The Parks and Recreation Department (PARD) offers various athletic events, tournaments, and programs for youth & adult sports which require unique shirts, jerseys, and other wearable items as a part of program deliverables. It is industry standard to provide such items for these programs, and the item cost is built into the program fee for all registered individuals. These shirts and jerseys require custom graphic design that is unique each season or event. Historically, PARD has spent an average of $20,000 in athletic shirts and jerseys from FY 16-17 to 18-19. The total cost for this contract is considering new programs and cost increase in production and items. This Request for Proposals (RFP) is for the supply, printing, graphic design service, and delivery of shirts and jerseys for athletics leagues and special event deliverables for recreation program participants. The contract bid was divided into two (2) sections. Vendors were offered the opportunity to submit a competitive bid on any individual section or both sections. Section A referenced needs for the Award and Souvenir Shirts. Section B referenced needs for Youth Sports Jerseys. Request for Proposals was sent to 152 prospective suppliers. In addition, specifications were placed on the Materials Management website for prospective suppliers to download and advertised in the local newspaper. Fourteen (14) proposals were received, references were checked, and proposals were evaluated based upon published criteria including price, delivery, compliance with specifications, probable Project Description Estimated 5-Year Expenditure Budgeted Cost for Athletic Shirts & Jerseys – Year 1 $ 30,000 Budgeted Cost for Athletic Shirts & Jerseys – Year 2 $ 30,000 Budgeted Cost for Athletic Shirts & Jerseys – Year 3 $ 30,000 Total: $120,000 City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 337 performance, and schedule. Best and Final Offers (BAFO) were requested from the top firm. Based upon this evaluation, Groggy Dog Sportswear & Graphic Design, LLC was ranked the highest and determined to be the best value for the City. NIGP Code Used for Solicitation: 200 - Clothing: Athletic, Casual, Dress, Uniform, Weather, and Work Related Notifications sent for Solicitation sent in IonWave: 152 Number of Suppliers that viewed Solicitation in IonWave: 38 HUB-Historically Underutilized Business Invitations sent out: 13 SBE-Small Business Enterprise Invitations sent out: 76 Responses from Solicitation: 14 RECOMMENDATION Award a contract with Groggy Dog Sportswear & Graphic Design, LLC, for athletic shirts and jerseys for the Parks and Recreation Department, in a one (1) year, with the option for two (2) additional one (1) year extensions, in the total three (3) year not-to-exceed amount of $120,000. PRINCIPAL PLACE OF BUSINESS Groggy Dog Sportswear & Graphic Design, LLC Denton, TX ESTIMATED SCHEDULE OF PROJECT This is an initial one (1) year contract with options to extend the contract for two (2) additional one (1) year periods, with all terms and conditions remaining the same. FISCAL INFORMATION These items will be funded from Parks and Recreation Operating Funds. The City will only pay for services rendered and is not obligated to pay the full contract amount unless needed. EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Evaluation Sheet Exhibit 3: LLC Members Exhibit 4: Ordinance and Contract Respectfully submitted: Lori Hewell, 940-349-7100 Purchasing Manager For information concerning this acquisition, contact: Chris Escoto, 940-349-8523. Legal point of contact: Marcella Lunn at 940-349-8333. 338 Line #Description QTY UOM Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended 1 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve Sizes: Adult Small - Adult XL 1,000 EA $4.45 $4,450.00 $6.00 $6,000.00 $4.44 $4,440.00 $3.00 $3,000.00 $4.80 $4,800.00 $3.33 $3,330.00 $5.29 $5,290.00 2 Option 1: PROPOSED SHIRT STYLE BRAND/DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve SIZES: ADULT2XL-ADULT4XL 1,000 EA $5.95 $5,950.00 $6.00 $6,000.00 $5.95 $5,950.00 $5.25 $5,250.00 $6.80 $6,800.00 $5.33 $5,330.00 $7.79 $7,790.00 3 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult Small - Adult XL 325 EA $7.45 $2,421.25 $8.00 $2,600.00 $7.44 $2,418.00 $5.75 $1,868.75 $7.90 $2,567.50 $5.77 $1,875.25 $6.79 $2,206.75 4 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult 2XL - Adult 4XL 325 EA $8.95 $2,908.75 $8.00 $2,600.00 $8.95 $2,908.75 $6.75 $2,193.75 $9.90 $3,217.50 $8.77 $2,850.25 $9.29 $3,019.25 6 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult Small- Adult XL 325 EA $14.45 $4,696.25 $12.00 $3,900.00 $14.75 $4,793.75 $10.50 $3,412.50 $16.30 $5,297.50 $9.57 $3,110.25 $11.29 $3,669.25 7 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult 2XL- Adult 4XL 325 EA $15.95 $5,183.75 $12.00 $3,900.00 $15.95 $5,183.75 $13.50 $4,387.50 $18.30 $5,947.50 $15.71 $5,105.75 $13.79 $4,481.75 8 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult Small - Adult XL 325 EA $11.45 $3,721.25 $10.00 $3,250.00 $9.78 $3,178.50 $10.50 $3,412.50 $10.80 $3,510.00 $7.19 $2,336.75 $9.29 $3,019.25 9 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult 2XL- Adult 4XL 325 EA $12.95 $4,208.75 $10.00 $3,250.00 $10.99 $3,571.75 $13.50 $4,387.50 $12.80 $4,160.00 $10.09 $3,279.25 $11.79 $3,831.75 10 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult Small - Adult XL 1,000 EA $7.45 $7,450.00 $7.00 $7,000.00 $7.22 $7,220.00 $5.75 $5,750.00 $6.30 $6,300.00 $4.93 $4,930.00 $6.49 $6,490.00 11 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult 2XL- Adult 4XL 1,000 EA $8.95 $8,950.00 $7.00 $7,000.00 $8.74 $8,740.00 $6.75 $6,750.00 $8.30 $8,300.00 $6.93 $6,930.00 $8.99 $8,990.00 12 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult Small - Adult XL 325 EA $9.45 $3,071.25 $10.00 $3,250.00 $10.71 $3,480.75 $6.75 $2,193.75 $8.90 $2,892.50 $6.93 $2,252.25 $8.49 $2,759.25 13 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult2XL - Adult 4XL 325 EA $10.95 $3,558.75 $10.00 $3,250.00 $12.99 $4,221.75 $7.75 $2,518.75 $10.90 $3,542.50 $8.93 $2,902.25 $10.99 $3,571.75 Item # 1 2 3 4 Line #Description QTY UOM BAFO Extended BAFO Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended 1 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey- YOUTH SIZE Sizes: Youth Small - Youth XL 192 EA $17.70 $3,398.40 $15.00 $2,880.00 $13.34 $2,561.28 $7.91 $1,518.72 $14.00 $2,688.00 $11.50 $2,208.00 $13.90 $2,668.80 2 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey-ADULTSIZE Sizes:AdultSmall -Adult4XL 48 EA $18.20 $873.60 $15.00 $720.00 $15.28 $733.44 $8.39 $402.72 $15.00 $720.00 $12.50 $600.00 $14.90 $715.20 3 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey - YOUTH SIZES Sizes: Youth Small - Youth XL 192 EA $17.70 $3,398.40 $15.00 $2,880.00 $11.84 $2,273.28 $10.09 $1,937.28 $10.00 $1,920.00 $11.00 $2,112.00 $14.90 $2,860.80 4 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey - ADULTSIZES Sizes: Adult Small - Adult 4XL 48 EA $18.70 $897.60 $15.00 $720.00 $13.42 $644.16 $10.57 $507.36 $11.00 $528.00 $12.50 $600.00 $14.90 $715.20 5 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey Youth Size Sizes: Youth Small - Youth XL 408 EA $18.70 $7,629.60 $15.00 $6,120.00 $11.96 $4,879.68 $7.97 $3,251.76 $10.50 $4,284.00 $11.75 $4,794.00 $14.90 $6,079.20 6 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey - ADULT SIZE Sizes: AdultSmall -AdultXL 102 EA $19.70 $2,009.40 $15.00 $1,530.00 $13.46 $1,372.92 $8.89 $906.78 $11.50 $1,173.00 $13.25 $1,351.50 $14.90 $1,519.80 7 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - YOUTH SIZE Sizes: Youth Small - Youth XL 288 EA $19.70 $5,673.60 $18.00 $5,184.00 $15.52 $4,469.76 $9.89 $2,848.32 $12.50 $3,600.00 $10.40 $2,995.20 $15.80 $4,550.40 8 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - ADULTSIZE Sizes: AdultSmall - AdultXL 72 EA $20.20 $1,454.40 $18.00 $1,296.00 $16.32 $1,175.04 $10.27 $739.44 $13.00 $936.00 $15.50 $1,116.00 $15.80 $1,137.60 9 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Coaching Volunteer Shirts- ADULTSIZE Sizes: AdultSmall - Adult4XL 120 EA $7.70 $924.00 $5.00 $600.00 $18.73 $2,247.60 $3.89 $466.80 $2.75 $330.00 $5.25 $630.00 $5.00 $600.00 Item # 1 2 3 4 Exhibit 2 RFP 7602 - Pricing Evaluation for Athletic Shirts and Jerseys Total Contract Amount (3 years):$120,000.00 Respondent's Business Name: Principal Place of Business (City and State): Visual Impact Specialties 67.92 21.12 10.80 25.20 10.80 Mustang Apparel dba Incentive Brands 68.63 26.83 11.40 19.60 10.80 $20,847.00 Plano, TX Arlington, TX Pan Ector Industries 10.80 Ad-Wear & Specialty of Texas 9.00 Universal Sporting Goods 70.21 27.21 10.20 23.80 9.00 73.20 35.00 9.60 19.60 75.03 21.63 13.20 29.40 Denton, TX Pompton Plains, NJHouston, TX San Bay Studio, Inc. 76.68 20.08 13.80 30.80 12.00 Groggy Dog Sportswear 77.77 16.77 15.00 13.80 32.20 Denton, TX Denton, TX SECTION A - AWARD SOUVENIR SHIRTS Total Score: Groggy Dog Sportswear San Bay Studio, Inc.Pan Ector Industries Universal Sporting Goods Visual Impact Specialties Ad-Wear & Specialty of Texas DFW Impression DFW Impression 74.89 28.09 12.60 21.00 13.20 82.31 34.31 10.80 25.20 14.40 29.80 91.00 Pan Ector Industries 13.20 33.60 13.20 27.59 87.59 78.20 Ad-Wear & Specialty of Texas 12.00 16.80 11.40 35.00 75.20 Universal Sporting Goods Visual Impact Specialties 15.00 35.00 15.00 27.40 92.40 13.20 33.60 13.20 26.60 11.40 27.00 12.00Delivery/Project Schedule - 15% Compliance with Specifications - 35 % Probable Performance - 15% Price - 35% Total Section A:$56,570.00 $52,000.00 $56,107.00 Description San Bay Studio, Inc.Groggy Dog Sportswear Denton, TX $45,125.00 $57,335.00 $44,232.00 $55,119.00 Denton, TX Denton, TX Pompton Plains, NJ Arlington, TX Houston, TX Irving, TX SECTION B - YOUTH SPORT JERSEYS Evaluation - Section B Total Section B:$26,259.00 $21,930.00 $20,357.16 $12,579.18 $16,179.00 $16,406.70 Evaluation - Section A Respondent's Business Name: Principal Place of Business (City and State): Total Score: Groggy Dog Sportswear San Bay Studio, Inc.Pan Ector Industries Ad-Wear & Specialty of Texas Universal Sporting Goods Mustang Visual Impact Specialties Description Delivery/Project Schedule - 15% Compliance with Specifications - 35 % Probable Performance - 15% Price - 35% 339 Line #Description QTY UOM 1 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve Sizes: Adult Small - Adult XL 1,000 EA 2 Option 1: PROPOSED SHIRT STYLE BRAND/DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve SIZES: ADULT2XL-ADULT4XL 1,000 EA 3 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult Small - Adult XL 325 EA 4 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult 2XL - Adult 4XL 325 EA 6 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult Small- Adult XL 325 EA 7 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult 2XL- Adult 4XL 325 EA 8 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult Small - Adult XL 325 EA 9 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult 2XL- Adult 4XL 325 EA 10 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult Small - Adult XL 1,000 EA 11 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult 2XL- Adult 4XL 1,000 EA 12 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult Small - Adult XL 325 EA 13 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult2XL - Adult 4XL 325 EA Item # 1 2 3 4 Line #Description QTY UOM 1 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey- YOUTH SIZE Sizes: Youth Small - Youth XL 192 EA 2 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey-ADULTSIZE Sizes:AdultSmall -Adult4XL 48 EA 3 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey - YOUTH SIZES Sizes: Youth Small - Youth XL 192 EA 4 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey - ADULTSIZES Sizes: Adult Small - Adult 4XL 48 EA 5 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey Youth Size Sizes: Youth Small - Youth XL 408 EA 6 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey - ADULT SIZE Sizes: AdultSmall -AdultXL 102 EA 7 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - YOUTH SIZE Sizes: Youth Small - Youth XL 288 EA 8 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - ADULTSIZE Sizes: AdultSmall - AdultXL 72 EA 9 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Coaching Volunteer Shirts- ADULTSIZE Sizes: AdultSmall - Adult4XL 120 EA Item # 1 2 3 4 Exhibit 2 RFP 7602 - Pricing Evaluation for Athletic Shirts and Jerseys Total Contract Amount (3 years): Respondent's Business Name: Principal Place of Business (City and State): SECTION A - AWARD SOUVENIR SHIRTS Total Score: Delivery/Project Schedule - 15% Compliance with Specifications - 35 % Probable Performance - 15% Price - 35% Total Section A: Description SECTION B - YOUTH SPORT JERSEYS Evaluation - Section B Total Section B: Evaluation - Section A Respondent's Business Name: Principal Place of Business (City and State): Total Score: Description Delivery/Project Schedule - 15% Compliance with Specifications - 35 % Probable Performance - 15% Price - 35% Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended $4.50 $4,500.00 $5.25 $5,250.00 $4.00 $4,000.00 $4.35 $4,350.00 $4.65 $4,650.00 $7.10 $7,100.00 $7.45 $7,450.00 $6.00 $6,000.00 $9.25 $9,250.00 $8.00 $8,000.00 $6.35 $6,350.00 $6.65 $6,650.00 $8.20 $8,200.00 $10.38 $10,380.00 $9.00 $2,925.00 $8.25 $2,681.25 $7.25 $2,356.25 $9.56 $3,107.00 $6.95 $2,258.75 $8.30 $2,697.50 $11.14 $3,620.50 $10.50 $3,412.50 $12.25 $3,981.25 $11.25 $3,656.25 $11.56 $3,757.00 $8.95 $2,908.75 $10.25 $3,331.25 $12.20 $3,965.00 $15.00 $4,875.00 $14.00 $4,550.00 $14.25 $4,631.25 $21.30 $6,922.50 $11.95 $3,883.75 $21.20 $6,890.00 $34.31 $11,150.75 $16.50 $5,362.50 $18.25 $5,931.25 $18.25 $5,931.25 $23.30 $7,572.50 $14.95 $4,858.75 $23.45 $7,621.25 $40.83 $13,269.75 $11.00 $3,575.00 $9.00 $2,925.00 $8.50 $2,762.50 $10.79 $3,506.75 $8.95 $2,908.75 $18.40 $5,980.00 $17.45 $5,671.25 $12.50 $4,062.50 $14.25 $4,631.25 $12.50 $4,062.50 $12.79 $4,156.75 $11.95 $3,883.75 $20.90 $6,792.50 $22.21 $7,218.25 $9.00 $9,000.00 $7.75 $7,750.00 $5.75 $5,750.00 $6.76 $6,760.00 $5.95 $5,950.00 $9.25 $9,250.00 $9.57 $9,570.00 $10.50 $10,500.00 $10.75 $10,750.00 $9.75 $9,750.00 $8.76 $8,760.00 $7.95 $7,950.00 $10.25 $10,250.00 $12.24 $12,240.00 $10.00 $3,250.00 $9.00 $2,925.00 $7.85 $2,551.25 $12.76 $4,147.00 $9.25 $3,006.25 $10.20 $3,315.00 $11.14 $3,620.50 $11.50 $3,737.50 $12.00 $3,900.00 $11.85 $3,851.25 $14.76 $4,797.00 $11.25 $3,656.25 $11.20 $3,640.00 $14.04 $4,563.00 Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended Unit Extended $12.95 $2,486.40 $15.16 $2,910.72 $16.79 $3,223.68 $15.45 $2,966.40 No Bid 3166.08 No Bid 3166.08 $16.49 $3,166.08 $13.95 $669.60 $15.16 $727.68 $18.99 $911.52 $14.95 $717.60 No Bid 911.52 No Bid 911.52 $17.82 $855.36 $13.50 $2,592.00 $16.32 $3,133.44 $15.79 $3,031.68 $17.95 $3,446.40 No Bid 4341.12 No Bid 4341.12 $22.61 $4,341.12 $14.50 $696.00 $17.20 $825.60 $16.79 $805.92 $18.45 $885.60 No Bid 912 No Bid 912 $18.08 $867.84 $13.50 $5,508.00 $12.41 $5,063.28 $16.49 $6,727.92 $15.25 $6,222.00 No Bid 7752 No Bid 7752 $17.29 $7,054.32 $14.50 $1,479.00 $12.82 $1,307.64 $17.49 $1,783.98 $16.25 $1,657.50 No Bid 2034.9 No Bid 2034.9 $19.95 $2,034.90 $14.00 $4,032.00 $11.42 $3,288.96 $18.39 $5,296.32 $17.95 $5,169.60 No Bid 5184 No Bid 5184 $11.73 $3,378.24 $14.50 $1,044.00 $13.36 $961.92 $18.99 $1,367.28 $18.95 $1,364.40 No Bid 1589.04 No Bid 1589.04 $22.07 $1,589.04 $4.00 $480.00 $5.99 $718.80 $4.39 $526.80 $7.95 $954.00 $9.25 $1,110.00 No Bid 1236 $10.30 $1,236.00 Exhibit 2 RFP 7602 - Pricing Evaluation for Athletic Shirts and Jerseys Brayco 51.95 17.95 9.60 15.40 9.00 Just Right Products 54.83 16.23 9.60 18.20 10.80 $27,126.66 $24,522.90 Haltom City, TX Abilene, TX DFW Impression 61.80 18.60 12.00 21.00 10.20 Restoration Apparel 55.71 16.31 10.80 19.60 9.00 Promo Solutions 57.43 18.83 9.60 18.20 10.80 $23,675.10 $23,383.50 $27,000.66 Irving, TX Frisco, TX Kansas City, MO TK Printshop 65.39 23.19 11.40 22.40 8.40 Educational Products Inc. 23.25 10.20 19.60 10.20 63.25 $18,987.00 $18,938.04 Denton, TX Houston, TX Educational Products Inc. 12.60 19.60 11.40 24.12 67.72 Just Right Products 13.20 16.80 10.80 27.02 67.82 SECTION A - AWARD SOUVENIR SHIRTS TK Printshop Mustang Apparel dba Incentive Brands Just Right Products Mustang Apparel dba Incentive Brands 13.80 19.60 12.00 23.99 69.39 TK Printshop 10.80 23.80 12.00 25.30 Restoration Apparel Brayco 53.5062.82 20.62 16.70 11.40 10.80 18.20 14.00 12.60 12.00 71.90 14.00 13.20 66.85 29.45 10.20 Educational Products Inc.Promo Solutions Restoration Apparel Brayco $57,302.50 $64,186.50 $52,565.00 $75,067.50 $92,719.00$61,200.00 $64,525.00 Denton, TX Plano, TX Haltom City, TX Promo Solutions Promo Solutions Restoration Apparel Just Right Products Brayco SECTION B - YOUTH SPORT JERSEYS Evaluation - Section B Evaluation - Section A TK Printshop Houston, TX Frisco, TX Kansas City, MO Abilene, TX Educational Products Inc.DFW Impression 340 341 ORDINANCE NO. _________ AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORIZING THE CITY MANAGER, OR THEIR DESIGNEE, TO EXECUTE A CONTRACT WITH GROGGY DOG SPORTSWEAR & GRAPHIC DESIGN, LLC FOR ATHLETIC SHIRTS AND JERSEYS FOR THE PARKS AND RECREATION DEPARTMENT; PROVIDING FOR THE EXPENDITURE OF FUNDS THEREFOR; AND PROVIDING AN EFFECTIVE DATE (RFP 7602 AWARDED TO GROGGY DOG SPORTSWEAR & GRAPHIC DESIGN, LLC, FOR ONE (1) YEAR, WITH THE OPTION FOR TWO (2) ADDITIONAL ONE (1) YEAR EXTENSIONS, IN THE TOTAL THREE (3) YEAR NOT-TO-EXCEED AMOUNT OF $120,000.00). WHEREAS, the City has solicited, received, and evaluated competitive proposals for athletic shirts and jerseys for the Parks and Recreation Department; and WHEREAS, the City Manager, or a designated employee, has received, reviewed, and recommended that the herein described proposals are the most advantageous to the City considering the relative importance of price and the other evaluation factors included in the request for proposals; and WHEREAS, the City Council has provided in the City Budget for the appropriation of funds to be used for the purchase of the materials, equipment, supplies, or services approved and accepted herein; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The items in the following numbered request for proposal for materials, equipment, supplies, Purchasing Agent, are hereby accepted and approved as being the most advantageous to the City considering the relative importance of price and the other evaluation factors included in the request for proposals. RFP NUMBER CONTRACTOR AMOUNT 7602 Groggy Dog Sportswear & Graphic Design, LLC $120,000.00 SECTION 2. That by the acceptance and approval of the above numbered items of the submitted proposals, the City accepts the offer of the persons submitting the proposals for such items and agrees to purchase the materials, equipment, supplies, or services in accordance with the terms, specifications, standards, quantities, and for the specified sums contained in the Proposal Invitations, Proposals, and related documents. SECTION 3. That should the City and person submitting approved and accepted items wish to enter into a formal written agreement as a result of the acceptance, approval, and awarding of the 342 proposals, the City Manager,or their designated representative,is hereby authorized to execute the written contract which shall be attached hereto; provided that the written contract is in accordance with the terms, conditions, specifications, standards, quantities, and specified sums contained in the Proposal and related documents herein approved and accepted. SECTION 4. The City Council of the City of Denton, hereby expressly delegates the authority to take any actions that may be required or permitted to be performed by the City of Denton under this ordinance to the City Manager of the City of Denton, or their designee. SECTION 5. By the acceptance and approval of the above enumerated bids, the City Council hereby authorizes the expenditure of funds therefor in the amount and in accordance with the approved bids. SECTION 6. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. This ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _______ day of ___________________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR 343 ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: _________________________________ 344 Docusign City Council Transmittal Coversheet File Name Purchasing Contact City Council Target Date Piggy Back Option Contract Expiration Ordinance DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 7602RFP Yes PARD Athletic Shirts & Jerseys Erica Garcia 345 Contract 7602 CONTRACT BY AND BETWEEN CITY OF DENTON, TEXAS AND GROGGY DOG SPORTSWEAR & GRAPHIC DESIGN, LLC (Contract #7602 ) THIS CONTRACT is made and entered into this date _______________________, by and between Groggy Dog Sportswear & Graphic Design, LLC a Texas limited liability company, whose address is 4017 Mesa Dr., Denton, TX 76207, hereinafter referred to as "Contractor," and the CITY OF DENTON, TEXAS, a home rule municipal corporation, hereinafter referred to as "City," to be effective upon approval of the Denton City Council and subsequent execution of this Contract by the Denton City Manager or his duly authorized designee. For and in consideration of the covenants and agreements contained herein, and for the mutual benefits to be obtained hereby, the parties agree as follows: SCOPE OF SERVICES Contractor shall provide products in accordance with the City’s RFP 7602 – PARD Athletic Shirts & Jerseys a copy of which is on file at the office of Purchasing Agent and incorporated herein for all purposes. The Contract consists of this written agreement and the following items which are attached hereto, or on file, and incorporated herein by reference: (a) Special Terms and Conditions (Exhibit “A”); (b) City of Denton’s RFP 7602 (Exhibit “B” on file at the office of the Purchasing Agent); (c) City of Denton Standard Terms and Conditions (Exhibit “C”); (d) Certificate of Interested Parties Electronic Filing (Exhibit “D”); (e) Contractor’s Proposal. (Exhibit "E"); (f) Form CIQ – Conflict of Interest Questionnaire (Exhibit "F") These documents make up the Contract documents and what is called for by one shall be as binding as if called for by all. In the event of an inconsistency or conflict in any of the provisions of the Contract documents, the inconsistency or conflict shall be resolved by giving precedence first to the written agreement then to the contract documents in the order in which they are listed above. These documents shall be referred to collectively as “Contract Documents.” Prohibition on Contracts with Companies Boycotting Israel Contractor acknowledges that in accordance with Chapter 2270 of the Texas Government Code, City is prohibited from entering into a contract with a company for goods or services unless the contract contains a written verification from the company that it: (1) does not boycott Israel; and (2) will not boycott Israel during the term of the contract. The terms “boycott Israel” and “company” shall have the meanings ascribed to those terms in Section 808.001 of the Texas Government Code. By signing this agreement, Contractor certifies that Contractor’s signature provides written verification to the City that Contractor: (1) does not boycott Israel; and (2) will not boycott Israel during the term of the agreement. Failure to meet or maintain the requirements under this provision will be considered a material breach. Prohibition On Contracts With Companies Doing Business with Iran, Sudan, or a Foreign Terrorist Organization Section 2252 of the Texas Government Code restricts CITY from contracting with companies that do DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 346 Contract 7602 business with Iran, Sudan, or a foreign terrorist organization. By signing this agreement, Contractor certifies that Contractor’s signature provides written verification to the City that Contractor, pursuant to Chapter 2252, is not ineligible to enter into this agreement and will not become ineligible to receive payments under this agreement by doing business with Iran, Sudan, or a foreign terrorist organization. Failure to meet or maintain the requirements under this provision will be considered a material breach. The parties agree to transact business electronically. Any statutory requirements that certain terms be in writing will be satisfied using electronic documents and signing. Electronic signing of this document will be deemed an original for all legal purposes. IN WITNESS WHEREOF, the parties of these presents have executed this agreement in the year and day first above written. CONTRACTOR BY:______________________________ AUTHORIZED SIGNATURE Printed Name:_____________________ Title:____________________________ __________________________________ PHONE NUMBER _________________________________ EMAIL ADDRESS ___________________________________ TEXAS ETHICS COMMISSION 1295 CERTIFICATE NUMBER CITY OF DENTON, TEXAS BY: _____________________________ ATTEST: ROSA RIOS, CITY SECRETARY BY: _______________________________ APPROVED AS TO LEGAL FORM: BY: _______________________________ THIS AGREEMENT HAS BEEN BOTH REVIEWED AND APPROVED as to financial and operational obligations and business terms. _______________ ________________ SIGNATURE PRINTED NAME __________________________________ TITLE __________________________________ DEPARTMENT DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 2021-70844 mchambers@groggydogonline.com Mary Ann Chambers Operations Manager 940-891-4022 Parks and Recreation Department Director of Parks and Recreation Gary Packan 347 Contract 7602 Exhibit A Special Terms and Conditions 1. The Quantities The quantities indicated on Exhibit E are estimates based upon the best available information. The City reserves the right to increase or decrease the quantities to meet its actual needs without any adjustments in the bid price. Individual purchase orders will be issued on an as needed basis. 2. Product Changes During Contract Term The Contractor shall not change specifications during the contract term without prior approval. Any deviation in the specifications or change in the product must be approved in advance by the City of Denton. Notice of a change shall be submitted in writing to purchasing@cityofdenton.com, with the above file number in the subject line, for review. Products found to have changed specifications without notification, and acceptance, will be returned at the contractor’s expense. Products that have been installed will be replaced at the contractor’s expense. 3. Authorized Distributor The Contractor shall be the manufacturer or authorized distributor of the proposed products. The distributor shall be authorized to sell to the City of Denton, and make available the manufacturer’s representative as needed by the City. 4. Contract Terms The contract term will be one (1) year, effective from date of award. The City and the Contractor shall have the option to renew this contract for an additional two (2) one-year periods. The Contract shall commence upon the issuance of a Notice of Award by the City of Denton and shall automatically renew each year, from the date of award by City Council. The Contractor’s request to not renew the contract must be submitted in writing to the Purchasing Manager at least 60 days prior to the contract renewal date for each year. At the sole option of the City of Denton, the Contract may be further extended as needed, not to exceed a total of six (6) months. 5. Price Escalation and De-escalation On Contractor’s request in the form stated herein, the City will implement an escalation/de- escalation price adjustment annually based on these special terms. Any request for price adjustment must be based on the, U.S Department of Labor, Bureau of Labor Statistics, Producer Price Index (PPI) or the manufacturer published pricing list. The maximum escalation will not exceed +/- 8% for any individual year. The escalation will be determined annually at the renewal date. The price will be increased or decreased based upon the annual percentage change in the PPI or the percentage change in the manufacturer’s price list. Should the PPI or manufacturer price list change exceed a minimum threshold value of +/-1%, then the stated eligible bid prices shall be adjusted in accordance with the percent change not to exceed the 8% limit per year. The Contractor should provide documentation as percentage of each cost associated with the unit prices quoted for consideration. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 348 Contract 7602 Request must be submitted in writing with supporting evidence for need of such increase to the Purchasing Manager at least 60 days prior to contract expiration of each year. Respondent must also provide supporting documentation as justification for the request. If no request is made, then it will be assumed that the current contract price will be in effect. Upon receipt of such request, the City of Denton reserves the right to either: accept the escalation as competitive with the general market price at the time, and become effective upon the renewal date of the contract award or reject the increases within 30 calendar days after receipt of a properly submitted request. If a properly submitted increase is rejected, the Contractor may request cancellation of such items from the Contract by giving the City of Denton written notice. Cancellation will not go into effect for 15 calendar days after a determination has been issued. Pre-price increase prices must be honored on orders dated up to the official date of the City of Denton approval and/or cancellation. The request can be sent by e-mail to: purchasing@cityofdenton.com noting the solicitation number. The City of Denton reserves the right to accept, reject, or negotiate the proposed price changes. 6. Total Contract Amount The contract total for services shall not exceed $120,000. Pricing shall be per Exhibit E attached. 7. Delivery Lead Time Product or services shall be delivered to the City per the days/weeks noted in Exhibit E after receipt of the order. 8. Performance Liquidated Damages The Contractor shall incur contractual payment losses, as initiated by the City for performance that falls short of specified performance standards as outlined below:  Delivery beyond contracted lead times  Performance below contracted levels (services only) The Contractor shall be assessed a one (1%) percent fee each month when any one of the performance standards outlined above are not met in full. The Contractor shall be assessed a two (2%) percent profit fee each month when any two (2) or more performance standards outlined above are not met in full. At the end of each month, the City will review the monthly reports and determine the percentage of penalty to be assessed to the Contractor’s monthly profit margin. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 349 Contract 7602 Exhibit C City of Denton Standard Purchase Terms and Conditions These standard Terms and Conditions and the Terms and Conditions, Specifications, Drawings and other requirements included in the City of Denton’s contract are applicable to contracts/purchase orders issued by the City of Denton hereinafter referred to as the City or Buyer and the Seller or respondent herein after referred to as Contractor or Supplier. Any deviations must be in writing and signed by a representative of the City’s Procurement Department and the Supplier. No Terms and Conditions contained in the seller’s proposal response, invoice or statement shall serve to modify the terms set forth herein. If there is a conflict between the provisions on the face of the contract/purchase order these written provisions will take precedence. The Contractor agrees that the contract shall be governed by the following terms and conditions, unless exceptions are duly noted and fully negotiated. Unless otherwise specified in the contract, Sections 3, 4, 5, 6, 7, 8, 20, 21, and 36 shall apply only to a solicitation to purchase goods, and sections 9, 10, 11, 22 and 32 shall apply only to a solicitation to purchase services to be performed principally at the City’s premises or on public rights-of-way. 1. CONTRACTOR’S OBLIGATIONS. The Contractor shall fully and timely provide all deliverables described in the Solicitation and in the Contractor’s Offer in strict accordance with the terms, covenants, and conditions of the Contract and all applicable Federal, State, and local laws, rules, and regulations. 2. EFFECTIVE DATE/TERM. Unless otherwise specified in the Solicitation, this Contract shall be effective as of the date the contract is signed by the City, and shall continue in effect until all obligations are performed in accordance with the Contract. 3. CONTRACTOR TO PACKAGE DELIVERABLES: The Contractor will package deliverables in accordance with good commercial practice and shall include a packing list showing the description of each item, the quantity and unit price unless otherwise provided in the Specifications or Supplemental Terms and Conditions, each shipping container shall be clearly and permanently marked as follows: (a) The Contractor's name and address, (b) the City’s name, address and purchase order or purchase release number and the price agreement number if applicable, (c) Container number and total number of containers, e.g. box 1 of 4 boxes, and (d) the number of the container bearing the packing list. The Contractor shall bear cost of packaging. Deliverables shall be suitably packed to secure lowest transportation costs and to conform to all the requirements of common carriers and any applicable specification. The City's count or weight shall be final and conclusive on shipments not accompanied by packing lists. 4. SHIPMENT UNDER RESERVATION PROHIBITED: The Contractor is not authorized to ship the deliverables under reservation and no tender of a bill of lading will operate as a tender of deliverables. 5. TITLE & RISK OF LOSS: Title to and risk of loss of the deliverables shall pass to the City only when the City actually receives and accepts the deliverables. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 350 Contract 7602 6. DELIVERY TERMS AND TRANSPORTATION CHARGES: Deliverables shall be shipped F.O.B. point of delivery unless otherwise specified in the Supplemental Terms and Conditions. Unless otherwise stated in the Offer, the Contractor’s price shall be deemed to include all delivery and transportation charges. The City shall have the right to designate what method of transportation shall be used to ship the deliverables. The place of delivery shall be that set forth the purchase order. 7. RIGHT OF INSPECTION AND REJECTION: The City expressly reserves all rights under law, including, but not limited to the Uniform Commercial Code, to inspect the deliverables at delivery before accepting them, and to reject defective or non-conforming deliverables. If the City has the right to inspect the Contractor’s, or the Contractor’s Subcontractor’s, facilities, or the deliverables at the Contractor’s, or the Contractor’s Subcontractor’s, premises, the Contractor shall furnish, or cause to be furnished, without additional charge, all reasonable facilities and assistance to the City to facilitate such inspection. 8. NO REPLACEMENT OF DEFECTIVE TENDER: Every tender or delivery of deliverables must fully comply with all provisions of the Contract as to time of delivery, quality, and quantity. Any non-complying tender shall constitute a breach and the Contractor shall not have the right to substitute a conforming tender; provided, where the time for performance has not yet expired, the Contractor may notify the City of the intention to cure and may then make a conforming tender within the time allotted in the contract. 9. PLACE AND CONDITION OF WORK: The City shall provide the Contractor access to the sites where the Contractor is to perform the services as required in order for the Contractor to perform the services in a timely and efficient manner, in accordance with and subject to the applicable security laws, rules, and regulations. The Contractor acknowledges that it has satisfied itself as to the nature of the City’s service requirements and specifications, the location and essential characteristics of the work sites, the quality and quantity of materials, equipment, labor and facilities necessary to perform the services, and any other condition or state of fact which could in any way affect performance of the Contractor’s obligations under the contract. The Contractor hereby releases and holds the City harmless from and against any liability or claim for damages of any kind or nature if the actual site or service conditions differ from expected conditions. The contractor shall, at all times, exercise reasonable precautions for the safety of their employees, City Staff, participants and others on or near the City’s facilities. 10. WORKFORCE A. The Contractor shall employ only orderly and competent workers, skilled in the performance of the services which they will perform under the Contract. B. The Contractor, its employees, subcontractors, and subcontractor's employees may not while engaged in participating or responding to a solicitation or while in the course and scope of delivering goods or services under a City of Denton contract or on the City's property . i. use or possess a firearm, including a concealed handgun that is licensed under state law, except as required by the terms of the contract; or ii. use or possess alcoholic or other intoxicating beverages, illegal drugs or controlled substances, nor may such workers be intoxicated, or under the influence of alcohol or drugs, on the job. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 351 Contract 7602 C. If the City or the City's representative notifies the Contractor that any worker is incompetent, disorderly or disobedient, has knowingly or repeatedly violated safety regulations, has possessed any firearms, or has possessed or was under the influence of alcohol or drugs on the job, the Contractor shall immediately remove such worker from Contract services, and may not employ such worker again on Contract services without the City's prior written consent. Immigration: The Contractor represents and warrants that it shall comply with the requirements of the Immigration Reform and Control Act of 1986 and 1990 regarding employment verification and retention of verification forms for any individuals hired on or after November 6, 1986, who will perform any labor or services under the Contract and the Illegal Immigration Reform and Immigrant Responsibility Act of 1996 (“IIRIRA) enacted on September 30, 1996. 11. COMPLIANCE WITH HEALTH, SAFETY, AND ENVIRONMENTAL REGULATIONS: The Contractor, it’s Subcontractors, and their respective employees, shall comply fully with all applicable federal, state, and local health, safety, and environmental laws, ordinances, rules and regulations in the performance of the services, including but not limited to those promulgated by the City and by the Occupational Safety and Health Administration (OSHA). In case of conflict, the most stringent safety requirement shall govern. The Contractor shall indemnify and hold the City harmless from and against all claims, demands, suits, actions, judgments, fines, penalties and liability of every kind arising from the breach of the Contractor’s obligations under this paragraph. Environmental Protection: The Respondent shall be in compliance with all applicable standards, orders, or regulations issued pursuant to the mandates of the Clean Air Act (42 U.S.C. §7401 et seq.) and the Federal Water Pollution Control Act, as amended, (33 U.S.C. §1251 et seq.). 12. INVOICES: A. The Contractor shall submit separate invoices in duplicate on each purchase order or purchase release after each delivery. If partial shipments or deliveries are authorized by the City, a separate invoice must be sent for each shipment or delivery made. B. Proper Invoices must include a unique invoice number, the purchase order or delivery order number and the master agreement number if applicable, the Department’s Name, and the name of the point of contact for the Department. Invoices shall be itemized and transportation charges, if any, shall be listed separately. A copy of the bill of lading and the freight waybill, when applicable, shall be attached to the invoice. The Contractor’s name, remittance address and, if applicable, the tax identification number on the invoice must exactly match the information in the Vendor’s registration with the City. Unless otherwise instructed in writing, the City may rely on the remittance address specified on the Contractor’s invoice. C. Invoices for labor shall include a copy of all time-sheets with trade labor rate and deliverables order number clearly identified. Invoices shall also include a tabulation of work-hours at the appropriate rates and grouped by work order number. Time billed for labor shall be limited to hours actually worked at the work site. D. Unless otherwise expressly authorized in the Contract, the Contractor shall pass through all Subcontract and other authorized expenses at actual cost without markup. E. Federal excise taxes, State taxes, or City sales taxes must not be included in the invoiced amount. The City will furnish a tax exemption certificate upon request. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 352 Contract 7602 13. PAYMENT: A. All proper invoices need to be sent to Accounts Payable. Approved invoices will be paid within thirty (30) calendar days of the City’s receipt of the deliverables or of the invoice being received in Accounts Payable, whichever is later. B. If payment is not timely made, (per paragraph A); interest shall accrue on the unpaid balance at the lesser of the rate specified in Texas Government Code Section 2251.025 or the maximum lawful rate; except, if payment is not timely made for a reason for which the City may withhold payment hereunder, interest shall not accrue until ten (10) calendar days after the grounds for withholding payment have been resolved. C. If partial shipments or deliveries are authorized by the City, the Contractor will be paid for the partial shipment or delivery, as stated above, provided that the invoice matches the shipment or delivery. D. The City may withhold or set off the entire payment or part of any payment otherwise due the Contractor to such extent as may be necessary on account of: i. delivery of defective or non-conforming deliverables by the Contractor; ii. third party claims, which are not covered by the insurance which the Contractor is required to provide, are filed or reasonable evidence indicating probable filing of such claims; iii. failure of the Contractor to pay Subcontractors, or for labor, materials or equipment; iv. damage to the property of the City or the City’s agents, employees or contractors, which is not covered by insurance required to be provided by the Contractor; v. reasonable evidence that the Contractor’s obligations will not be completed within the time specified in the Contract, and that the unpaid balance would not be adequate to cover actual or damages for the anticipated delay; vi. failure of the Contractor to submit proper invoices with purchase order number, with all required attachments and supporting documentation; or vii. failure of the Contractor to comply with any material provision of the Contract Documents. E. Notice is hereby given that any awarded firm who is in arrears to the City of Denton for delinquent taxes, the City may offset indebtedness owed the City through payment withholding. F. Payment will be made by check unless the parties mutually agree to payment by credit card or electronic transfer of funds. The Contractor agrees that there shall be no additional charges, surcharges, or penalties to the City for payments made by credit card or electronic funds transfer. G. The awarding or continuation of this contract is dependent upon the availability of funding. The City’s payment obligations are payable only and solely from funds Appropriated and available for this contract. The absence of Appropriated or other lawfully available funds shall render the Contract null and void to the extent funds are not Appropriated or available and any deliverables delivered but unpaid shall be returned to the Contractor. The City shall provide the Contractor written notice of the failure of the City to make an adequate Appropriation for any fiscal year to pay the amounts due under the Contract, or the reduction of any Appropriation to an amount insufficient to permit the City to pay its obligations under the Contract. In the event of none or inadequate appropriation of funds, there will be no penalty nor removal fees charged to the City. 14. TRAVEL EXPENSES: All travel, lodging and per diem expenses in connection with the Contract shall be paid by the Contractor, unless otherwise stated in the contract terms. During the term of this contract, the contractor shall bill and the City shall reimburse contractor for all reasonable and approved out of pocket expenses which are incurred in the connection with the performance of duties hereunder. Notwithstanding the foregoing, expenses for the time spent by DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 353 Contract 7602 the contractor in traveling to and from City facilities shall not be reimbursed, unless otherwise negotiated. 15. FINAL PAYMENT AND CLOSE-OUT: A. If a DBE/MBE/WBE Program Plan is agreed to and the Contractor has identified Subcontractors, the Contractor is required to submit a Contract Close-Out MBE/WBE Compliance Report to the Purchasing Manager no later than the 15th calendar day after completion of all work under the contract. Final payment, retainage, or both may be withheld if the Contractor is not in compliance with the requirements as accepted by the City. B. The making and acceptance of final payment will constitute: i. a waiver of all claims by the City against the Contractor, except claims (1) which have been previously asserted in writing and not yet settled, (2) arising from defective work appearing after final inspection, (3) arising from failure of the Contractor to comply with the Contract or the terms of any warranty specified herein, (4) arising from the Contractor’s continuing obligations under the Contract, including but not limited to indemnity and warranty obligations, or (5) arising under the City’s right to audit; and ii. a waiver of all claims by the Contractor against the City other than those previously asserted in writing and not yet settled. 16. SPECIAL TOOLS & TEST EQUIPMENT: If the price stated on the Offer includes the cost of any special tooling or special test equipment fabricated or required by the Contractor for the purpose of filling this order, such special tooling equipment and any process sheets related thereto shall become the property of the City and shall be identified by the Contractor as such. 17. RIGHT TO AUDIT: A. The City shall have the right to audit and make copies of the books, records and computations pertaining to the Contract. The Contractor shall retain such books, records, documents and other evidence pertaining to the Contract period and five years thereafter, except if an audit is in progress or audit findings are yet unresolved, in which case records shall be kept until all audit tasks are completed and resolved. These books, records, documents and other evidence shall be available, within ten (10) business days of written request. Further, the Contractor shall also require all Subcontractors, material suppliers, and other payees to retain all books, records, documents and other evidence pertaining to the Contract, and to allow the City similar access to those documents. All books and records will be made available within a 50 mile radius of the City of Denton. The cost of the audit will be borne by the City unless the audit reveals an overpayment of 1% or greater. If an overpayment of 1% or greater occurs, the reasonable cost of the audit, including any travel costs, must be borne by the Contractor which must be payable within five (5) business days of receipt of an invoice. B. Failure to comply with the provisions of this section shall be a material breach of the Contract and shall constitute, in the City’s sole discretion, grounds for termination thereof. Each of the terms “books”, “records”, “documents” and “other evidence”, as used above, shall be construed to include drafts and electronic files, even if such drafts or electronic files are subsequently used to generate or prepare a final printed document. 18. SUBCONTRACTORS: A. If the Contractor identified Subcontractors in a DBE/MBE/WBE agreed to Plan, the Contractor shall comply with all requirements approved by the City. The Contractor shall not initially employ any Subcontractor except as provided in the Contractor’s Plan. The Contractor shall not substitute any Subcontractor identified in the Plan, unless the substitute has been accepted by the City in DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 354 Contract 7602 writing. No acceptance by the City of any Subcontractor shall constitute a waiver of any rights or remedies of the City with respect to defective deliverables provided by a Subcontractor. If a Plan has been approved, the Contractor is additionally required to submit a monthly Subcontract Awards and Expenditures Report to the Procurement Manager, no later than the tenth calendar day of each month. B. Work performed for the Contractor by a Subcontractor shall be pursuant to a written contract between the Contractor and Subcontractor. The terms of the subcontract may not conflict with the terms of the Contract, and shall contain provisions that: i. require that all deliverables to be provided by the Subcontractor be provided in strict accordance with the provisions, specifications and terms of the Contract; ii. prohibit the Subcontractor from further subcontracting any portion of the Contract without the prior written consent of the City and the Contractor. The City may require, as a condition to such further subcontracting, that the Subcontractor post a payment bond in form, substance and amount acceptable to the City; iii. require Subcontractors to submit all invoices and applications for payments, including any claims for additional payments, damages or otherwise, to the Contractor in sufficient time to enable the Contractor to include same with its invoice or application for payment to the City in accordance with the terms of the Contract; iv. require that all Subcontractors obtain and maintain, throughout the term of their contract, insurance in the type and amounts specified for the Contractor, with the City being a named insured as its interest shall appear; and v. require that the Subcontractor indemnify and hold the City harmless to the same extent as the Contractor is required to indemnify the City. C. The Contractor shall be fully responsible to the City for all acts and omissions of the Subcontractors just as the Contractor is responsible for the Contractor's own acts and omissions. Nothing in the Contract shall create for the benefit of any such Subcontractor any contractual relationship between the City and any such Subcontractor, nor shall it create any obligation on the part of the City to pay or to see to the payment of any moneys due any such Subcontractor except as may otherwise be required by law. D. The Contractor shall pay each Subcontractor its appropriate share of payments made to the Contractor not later than ten (10) calendar days after receipt of payment from the City. 19. WARRANTY-PRICE: A. The Contractor warrants the prices quoted in the Offer are no higher than the Contractor's current prices on orders by others for like deliverables under similar terms of purchase. B. The Contractor certifies that the prices in the Offer have been arrived at independently without consultation, communication, or agreement for the purpose of restricting competition, as to any matter relating to such fees with any other firm or with any competitor. C. In addition to any other remedy available, the City may deduct from any amounts owed to the Contractor, or otherwise recover, any amounts paid for items in excess of the Contractor's current prices on orders by others for like deliverables under similar terms of purchase. 20. WARRANTY – TITLE: The Contractor warrants that it has good and indefeasible title to all deliverables furnished under the Contract, and that the deliverables are free and clear of all liens, claims, security interests and encumbrances. The Contractor shall indemnify and hold the City harmless from and against all adverse title claims to the deliverables. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 355 Contract 7602 21. WARRANTY – DELIVERABLES: The Contractor warrants and represents that all deliverables sold the City under the Contract shall be free from defects in design, workmanship or manufacture, and conform in all material respects to the specifications, drawings, and descriptions in the Solicitation, to any samples furnished by the Contractor, to the terms, covenants and conditions of the Contract, and to all applicable State, Federal or local laws, rules, and regulations, and industry codes and standards. Unless otherwise stated in the Solicitation, the deliverables shall be new or recycled merchandise, and not used or reconditioned. A. Recycled deliverables shall be clearly identified as such. B. The Contractor may not limit, exclude or disclaim the foregoing warranty or any warranty implied by law; and any attempt to do so shall be without force or effect. C. Unless otherwise specified in the Contract, the warranty period shall be at least one year from the date of acceptance of the deliverables or from the date of acceptance of any replacement deliverables. If during the warranty period, one or more of the above warranties are breached, the Contractor shall promptly upon receipt of demand either repair the non-conforming deliverables, or replace the non-conforming deliverables with fully conforming deliverables, at the City’s option and at no additional cost to the City. All costs incidental to such repair or replacement, including but not limited to, any packaging and shipping costs shall be borne exclusively by the Contractor. The City shall endeavor to give the Contractor written notice of the breach of warranty within thirty (30) calendar days of discovery of the breach of warranty, but failure to give timely notice shall not impair the City’s rights under this section. D. If the Contractor is unable or unwilling to repair or replace defective or non-conforming deliverables as required by the City, then in addition to any other available remedy, the City may reduce the quantity of deliverables it may be required to purchase under the Contract from the Contractor, and purchase conforming deliverables from other sources. In such event, the Contractor shall pay to the City upon demand the increased cost, if any, incurred by the City to procure such deliverables from another source. E. If the Contractor is not the manufacturer, and the deliverables are covered by a separate manufacturer’s warranty, the Contractor shall transfer and assign such manufacturer’s warranty to the City. If for any reason the manufacturer’s warranty cannot be fully transferred to the City, the Contractor shall assist and cooperate with the City to the fullest extent to enforce such manufacturer’s warranty for the benefit of the City. 22. WARRANTY – SERVICES: The Contractor warrants and represents that all services to be provided the City under the Contract will be fully and timely performed in a good and workmanlike manner in accordance with generally accepted industry standards and practices, the terms, conditions, and covenants of the Contract, and all applicable Federal, State and local laws, rules or regulations. A. The Contractor may not limit, exclude or disclaim the foregoing warranty or any warranty implied by law, and any attempt to do so shall be without force or effect. B. Unless otherwise specified in the Contract, the warranty period shall be at least one year from the Acceptance Date. If during the warranty period, one or more of the above warranties are breached, the Contractor shall promptly upon receipt of demand perform the services again in accordance with above standard at no additional cost to the City. All costs incidental to such additional performance shall be borne by the Contractor. The City shall endeavor to give the Contractor written notice of the breach of warranty within thirty (30) calendar days of discovery of the breach warranty, but failure to give timely notice shall not impair the City’s rights under this section. C. If the Contractor is unable or unwilling to perform its services in accordance with the above DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 356 Contract 7602 standard as required by the City, then in addition to any other available remedy, the City may reduce the amount of services it may be required to purchase under the Contract from the Contractor, and purchase conforming services from other sources. In such event, the Contractor shall pay to the City upon demand the increased cost, if any, incurred by the City to procure such services from another source. 23. ACCEPTANCE OF INCOMPLETE OR NON-CONFORMING DELIVERABLES: If, instead of requiring immediate correction or removal and replacement of defective or non- conforming deliverables, the City prefers to accept it, the City may do so. The Contractor shall pay all claims, costs, losses and damages attributable to the City’s evaluation of and determination to accept such defective or non-conforming deliverables. If any such acceptance occurs prior to final payment, the City may deduct such amounts as are necessary to compensate the City for the diminished value of the defective or non-conforming deliverables. If the acceptance occurs after final payment, such amount will be refunded to the City by the Contractor. 24. RIGHT TO ASSURANCE: Whenever one party to the Contract in good faith has reason to question the other party’s intent to perform, demand may be made to the other party for written assurance of the intent to perform. In the event that no assurance is given within the time specified after demand is made, the demanding party may treat this failure as an anticipatory repudiation of the Contract. 25. STOP WORK NOTICE: The City may issue an immediate Stop Work Notice in the event the Contractor is observed performing in a manner that is in violation of Federal, State, or local guidelines, or in a manner that is determined by the City to be unsafe to either life or property. Upon notification, the Contractor will cease all work until notified by the City that the violation or unsafe condition has been corrected. The Contractor shall be liable for all costs incurred by the City as a result of the issuance of such Stop Work Notice. 26. DEFAULT: The Contractor shall be in default under the Contract if the Contractor (a) fails to fully, timely and faithfully perform any of its material obligations under the Contract, (b) fails to provide adequate assurance of performance under Paragraph 24, (c) becomes insolvent or seeks relief under the bankruptcy laws of the United States or (d) makes a material misrepresentation in Contractor’s Offer, or in any report or deliverable required to be submitted by the Contractor to the City. 27. TERMINATION FOR CAUSE: In the event of a default by the Contractor, the City shall have the right to terminate the Contract for cause, by written notice effective ten (10) calendar days, unless otherwise specified, after the date of such notice, unless the Contractor, within such ten (10) day period, cures such default, or provides evidence sufficient to prove to the City’s reasonable satisfaction that such default does not, in fact, exist. In addition to any other remedy available under law or in equity, the City shall be entitled to recover all actual damages, costs, losses and expenses, incurred by the City as a result of the Contractor’s default, including, without limitation, cost of cover, reasonable attorneys’ fees, court costs, and prejudgment and post- judgment interest at the maximum lawful rate. Additionally, in the event of a default by the Contractor, the City may remove the Contractor from the City’s vendor list for three (3) years and any Offer submitted by the Contractor may be disqualified for up to three (3) years. All rights and remedies under the Contract are cumulative and are not exclusive of any other right or remedy provided by law. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 357 Contract 7602 28. TERMINATION WITHOUT CAUSE: The City shall have the right to terminate the Contract, in whole or in part, without cause any time upon thirty (30) calendar days’ prior written notice. Upon receipt of a notice of termination, the Contractor shall promptly cease all further work pursuant to the Contract, with such exceptions, if any, specified in the notice of termination. The City shall pay the Contractor, to the extent of funds Appropriated or otherwise legally available for such purposes, for all goods delivered and services performed and obligations incurred prior to the date of termination in accordance with the terms hereof. 29. FRAUD: Fraudulent statements by the Contractor on any Offer or in any report or deliverable required to be submitted by the Contractor to the City shall be grounds for the termination of the Contract for cause by the City and may result in legal action. 30. DELAYS: A. The City may delay scheduled delivery or other due dates by written notice to the Contractor if the City deems it is in its best interest. If such delay causes an increase in the cost of the work under the Contract, the City and the Contractor shall negotiate an equitable adjustment for costs incurred by the Contractor in the Contract price and execute an amendment to the Contract. The Contractor must assert its right to an adjustment within thirty (30) calendar days from the date of receipt of the notice of delay. Failure to agree on any adjusted price shall be handled under the Dispute Resolution process specified in paragraph 49. However, nothing in this provision shall excuse the Contractor from delaying the delivery as notified. B. Neither party shall be liable for any default or delay in the performance of its obligations under this Contract if, while and to the extent such default or delay is caused by acts of God, fire, riots, civil commotion, labor disruptions, sabotage, sovereign conduct, or any other cause beyond the reasonable control of such Party. In the event of default or delay in contract performance due to any of the foregoing causes, then the time for completion of the services will be extended; provided, however, in such an event, a conference will be held within three (3) business days to establish a mutually agreeable period of time reasonably necessary to overcome the effect of such failure to perform. 31. INDEMNITY: A. Definitions: i. "Indemnified Claims" shall include any and all claims, demands, suits, causes of action, judgments and liability of every character, type or description, including all reasonable costs and expenses of litigation, mediation or other alternate dispute resolution mechanism, including attorney and other professional fees for: (1) damage to or loss of the property of any person (including, but not limited to the City, the Contractor, their respective agents, officers, employees and subcontractors; the officers, agents, and employees of such subcontractors; and third parties); and/or (2) death, bodily injury, illness, disease, worker's compensation, loss of services, or loss of income or wages to any person (including but not limited to the agents, officers and employees of the City, the Contractor, the Contractor’s subcontractors, and third parties), ii. "Fault" shall include the sale of defective or non- conforming deliverables, negligence, willful misconduct or a breach of any legally imposed strict liability standard. B. THE CONTRACTOR SHALL DEFEND (AT THE OPTION OF THE CITY), INDEMNIFY, AND HOLD THE CITY, ITS SUCCESSORS, ASSIGNS, OFFICERS, DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 358 Contract 7602 EMPLOYEES AND ELECTED OFFICIALS HARMLESS FROM AND AGAINST ALL INDEMNIFIED CLAIMS DIRECTLY ARISING OUT OF, INCIDENT TO, CONCERNING OR RESULTING FROM THE FAULT OF THE CONTRACTOR, OR THE CONTRACTOR'S AGENTS, EMPLOYEES OR SUBCONTRACTORS, IN THE PERFORMANCE OF THE CONTRACTOR’S OBLIGATIONS UNDER THE CONTRACT. NOTHING HEREIN SHALL BE DEEMED TO LIMIT THE RIGHTS OF THE CITY OR THE CONTRACTOR (INCLUDING, BUT NOT LIMITED TO, THE RIGHT TO SEEK CONTRIBUTION) AGAINST ANY THIRD PARTY WHO MAY BE LIABLE FOR AN INDEMNIFIED CLAIM. 32. INSURANCE: The following insurance requirements are applicable, in addition to the specific insurance requirements detailed in Appendix A for services only. The successful firm shall procure and maintain insurance of the types and in the minimum amounts acceptable to the City of Denton. The insurance shall be written by a company licensed to do business in the State of Texas and satisfactory to the City of Denton. A. General Requirements: i. The Contractor shall at a minimum carry insurance in the types and amounts indicated and agreed to, as submitted to the City and approved by the City within the procurement process, for the duration of the Contract, including extension options and hold over periods, and during any warranty period. ii. The Contractor shall provide Certificates of Insurance with the coverage’s and endorsements required to the City as verification of coverage prior to contract execution and within fourteen (14) calendar days after written request from the City. Failure to provide the required Certificate of Insurance may subject the Offer to disqualification from consideration for award. The Contractor must also forward a Certificate of Insurance to the City whenever a previously identified policy period has expired, or an extension option or hold over period is exercised, as verification of continuing coverage. iii. The Contractor shall not commence work until the required insurance is obtained and until such insurance has been reviewed by the City. Approval of insurance by the City shall not relieve or decrease the liability of the Contractor hereunder and shall not be construed to be a limitation of liability on the part of the Contractor. iv. The Contractor must submit certificates of insurance to the City for all subcontractors prior to the subcontractors commencing work on the project. v. The Contractor’s and all subcontractors’ insurance coverage shall be written by companies licensed to do business in the State of Texas at the time the policies are issued and shall be written by companies with A.M. Best ratings of A- VII or better. The City will accept workers’ compensation coverage written by the Texas Workers’ Compensation Insurance Fund. vi. All endorsements naming the City as additional insured, waivers, and notices of cancellation endorsements as well as the Certificate of Insurance shall contain the solicitation number and the following information: City of Denton Materials Management Department 901B Texas Street Denton, Texas 76209 vii. The “other” insurance clause shall not apply to the City where the City is an additional insured shown on any policy. It is intended that policies required in the Contract, covering both the City and the Contractor, shall be considered primary coverage as applicable. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 359 Contract 7602 viii. If insurance policies are not written for amounts agreed to with the City, the Contractor shall carry Umbrella or Excess Liability Insurance for any differences in amounts specified. If Excess Liability Insurance is provided, it shall follow the form of the primary coverage. ix. The City shall be entitled, upon request, at an agreed upon location, and without expense, to review certified copies of policies and endorsements thereto and may make any reasonable requests for deletion or revision or modification of particular policy terms, conditions, limitations, or exclusions except where policy provisions are established by law or regulations binding upon either of the parties hereto or the underwriter on any such policies. x. The City reserves the right to review the insurance requirements set forth during the effective period of the Contract and to make reasonable adjustments to insurance coverage, limits, and exclusions when deemed necessary and prudent by the City based upon changes in statutory law, court decisions, the claims history of the industry or financial condition of the insurance company as well as the Contractor. xi. The Contractor shall not cause any insurance to be canceled nor permit any insurance to lapse during the term of the Contract or as required in the Contract. xii. The Contractor shall be responsible for premiums, deductibles and self-insured retentions, if any, stated in policies. All deductibles or self-insured retentions shall be disclosed on the Certificate of Insurance. xiii. The Contractor shall endeavor to provide the City thirty (30) calendar days’ written notice of erosion of the aggregate limits below occurrence limits for all applicable coverage’s indicated within the Contract. xiv. The insurance coverage’s specified in within the solicitation and requirements are required minimums and are not intended to limit the responsibility or liability of the Contractor. B. Specific Coverage Requirements: Specific insurance requirements are contained in the solicitation instrument. 33. CLAIMS: If any claim, demand, suit, or other action is asserted against the Contractor which arises under or concerns the Contract, or which could have a material adverse effect on the Contractor’s ability to perform thereunder, the Contractor shall give written notice thereof to the City within ten (10) calendar days after receipt of notice by the Contractor. Such notice to the City shall state the date of notification of any such claim, demand, suit, or other action; the names and addresses of the claimant(s); the basis thereof; and the name of each person against whom such claim is being asserted. Such notice shall be delivered personally or by mail and shall be sent to the City and to the Denton City Attorney. Personal delivery to the City Attorney shall be to City Hall, 215 East McKinney Street, Denton, Texas 76201. 34. NOTICES: Unless otherwise specified, all notices, requests, or other communications required or appropriate to be given under the Contract shall be in writing and shall be deemed delivered three (3) business days after postmarked if sent by U.S. Postal Service Certified or Registered Mail, Return Receipt Requested. Notices delivered by other means shall be deemed delivered upon receipt by the addressee. Routine communications may be made by first class mail, telefax, or other commercially accepted means. Notices to the Contractor shall be sent to the address specified in the Contractor’s Offer, or at such other address as a party may notify the other in writing. Notices to the City shall be addressed to the City at 901B Texas Street, Denton, Texas 76209 and marked to the attention of the Purchasing Manager. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 360 Contract 7602 35. RIGHTS TO BID, PROPOSAL AND CONTRACTUAL MATERIAL: All material submitted by the Contractor to the City shall become property of the City upon receipt. Any portions of such material claimed by the Contractor to be proprietary must be clearly marked as such. Determination of the public nature of the material is subject to the Texas Public Information Act, Chapter 552, and Texas Government Code. 36. NO WARRANTY BY CITY AGAINST INFRINGEMENTS: The Contractor represents and warrants to the City that: (i) the Contractor shall provide the City good and indefeasible title to the deliverables and (ii) the deliverables supplied by the Contractor in accordance with the specifications in the Contract will not infringe, directly or contributorily, any patent, trademark, copyright, trade secret, or any other intellectual property right of any kind of any third party; that no claims have been made by any person or entity with respect to the ownership or operation of the deliverables and the Contractor does not know of any valid basis for any such claims. The Contractor shall, at its sole expense, defend, indemnify, and hold the City harmless from and against all liability, damages, and costs (including court costs and reasonable fees of attorneys and other professionals) arising out of or resulting from: (i) any claim that the City’s exercise anywhere in the world of the rights associated with the City’s’ ownership, and if applicable, license rights, and its use of the deliverables infringes the intellectual property rights of any third party; or (ii) the Contractor’s breach of any of Contractor’s representations or warranties stated in this Contract. In the event of any such claim, the City shall have the right to monitor such claim or at its option engage its own separate counsel to act as co-counsel on the City’s behalf. Further, Contractor agrees that the City’s specifications regarding the deliverables shall in no way diminish Contractor’s warranties or obligations under this paragraph and the City makes no warranty that the production, development, or delivery of such deliverables will not impact such warranties of Contractor. 37. CONFIDENTIALITY: In order to provide the deliverables to the City, Contractor may require access to certain of the City’s and/or its licensors’ confidential information (including inventions, employee information, trade secrets, confidential know-how, confidential business information, and other information which the City or its licensors consider confidential) (collectively, “Confidential Information”). Contractor acknowledges and agrees that the Confidential Information is the valuable property of the City and/or its licensors and any unauthorized use, disclosure, dissemination, or other release of the Confidential Information will substantially injure the City and/or its licensors. The Contractor (including its employees, subcontractors, agents, or representatives) agrees that it will maintain the Confidential Information in strict confidence and shall not disclose, disseminate, copy, divulge, recreate, or otherwise use the Confidential Information without the prior written consent of the City or in a manner not expressly permitted under this Agreement, unless the Confidential Information is required to be disclosed by law or an order of any court or other governmental authority with proper jurisdiction, provided the Contractor promptly notifies the City before disclosing such information so as to permit the City reasonable time to seek an appropriate protective order. The Contractor agrees to use protective measures no less stringent than the Contractor uses within its own business to protect its own most valuable information, which protective measures shall under all circumstances be at least reasonable measures to ensure the continued confidentiality of the Confidential Information. 38. OWNERSHIP AND USE OF DELIVERABLES: The City shall own all rights, titles, and interests throughout the world in and to the deliverables. A. Patents. As to any patentable subject matter contained in the deliverables, the Contractor agrees DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 361 Contract 7602 to disclose such patentable subject matter to the City. Further, if requested by the City, the Contractor agrees to assign and, if necessary, cause each of its employees to assign the entire right, title, and interest to specific inventions under such patentable subject matter to the City and to execute, acknowledge, and deliver and, if necessary, cause each of its employees to execute, acknowledge, and deliver an assignment of letters patent, in a form to be reasonably approved by the City, to the City upon request by the City. B. Copyrights. As to any deliverables containing copyrightable subject matter, the Contractor agrees that upon their creation, such deliverables shall be considered as work made-for-hire by the Contractor for the City and the City shall own all copyrights in and to such deliverables, provided however, that nothing in this Paragraph 38 shall negate the City’s sole or joint ownership of any such deliverables arising by virtue of the City’s sole or joint authorship of such deliverables. Should by operation of law, such deliverables not be considered works made-for-hire, the Contractor hereby assigns to the City (and agrees to cause each of its employees providing services to the City hereunder to execute, acknowledge, and deliver an assignment to the City of) all worldwide right, title, and interest in and to such deliverables. With respect to such work made- for-hire, the Contractor agrees to execute, acknowledge, and deliver and cause each of its employees providing services to the City hereunder to execute, acknowledge, and deliver a work- made-for-hire agreement, in a form to be reasonably approved by the City, to the City upon delivery of such deliverables to the City or at such other time as the City may request. C. Additional Assignments. The Contractor further agrees to, and if applicable, cause each of its employees to, execute, acknowledge, and deliver all applications, specifications, oaths, assignments, and all other instruments which the City might reasonably deem necessary in order to apply for and obtain copyright protection, mask work registration, trademark registration and/or protection, letters patent, or any similar rights in any and all countries and in order to assign and convey to the City, its successors, assigns and nominees, the sole and exclusive right, title, and interest in and to the deliverables. The Contractor’s obligations to execute, acknowledge, and deliver (or cause to be executed, acknowledged, and delivered) instruments or papers such as those described in this Paragraph 38 a., b., and c. shall continue after the termination of this Contract with respect to such deliverables. In the event the City should not seek to obtain copyright protection, mask work registration or patent protection for any of the deliverables, but should desire to keep the same secret, the Contractor agrees to treat the same as Confidential Information under the terms of Paragraph 37 above. 39. PUBLICATIONS: All published material and written reports submitted under the Contract must be originally developed material unless otherwise specifically provided in the Contract. When material not originally developed is included in a report in any form, the source shall be identified. 40. ADVERTISING: The Contractor shall not advertise or publish, without the City’s prior consent, the fact that the City has entered into the Contract, except to the extent required by law. 41. NO CONTINGENT FEES: The Contractor warrants that no person or selling agency has been employed or retained to solicit or secure the Contract upon any agreement or understanding for commission, percentage, brokerage, or contingent fee, excepting bona fide employees of bona fide established commercial or selling agencies maintained by the Contractor for the purpose of securing business. For breach or violation of this warranty, the City shall have the right, in addition to any other remedy available, to cancel the Contract without liability and to deduct from any amounts owed to the Contractor, or otherwise recover, the full amount of such commission, DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 362 Contract 7602 percentage, brokerage or contingent fee. 42. GRATUITIES: The City may, by written notice to the Contractor, cancel the Contract without liability if it is determined by the City that gratuities were offered or given by the Contractor or any agent or representative of the Contractor to any officer or employee of the City of Denton with a view toward securing the Contract or securing favorable treatment with respect to the awarding or amending or the making of any determinations with respect to the performing of such contract. In the event the Contract is canceled by the City pursuant to this provision, the City shall be entitled, in addition to any other rights and remedies, to recover or withhold the amount of the cost incurred by the Contractor in providing such gratuities. 43. PROHIBITION AGAINST PERSONAL INTEREST IN CONTRACTS: No officer, employee, independent consultant, or elected official of the City who is involved in the development, evaluation, or decision-making process of the performance of any solicitation shall have a financial interest, direct or indirect, in the Contract resulting from that solicitation as defined in the City’s Ethic Ordinance 18-757 and in the City Charter chapter 2 article XI(Ethics). Any willful violation of this section shall constitute impropriety in office, and any officer or employee guilty thereof shall be subject to disciplinary action up to and including dismissal. Any violation of this provision, with the knowledge, expressed or implied, of the Contractor shall render the Contract voidable by the City. The Contractor shall complete and submit the City’s Conflict of Interest Questionnaire. 44. INDEPENDENT CONTRACTOR: The Contract shall not be construed as creating an employer/employee relationship, a partnership, or a joint venture. The Contractor’s services shall be those of an independent contractor. The Contractor agrees and understands that the Contract does not grant any rights or privileges established for employees of the City of Denton, Texas for the purposes of income tax, withholding, social security taxes, vacation or sick leave benefits, worker’s compensation, or any other City employee benefit. The City shall not have supervision and control of the Contractor or any employee of the Contractor, and it is expressly understood that Contractor shall perform the services hereunder according to the attached specifications at the general direction of the City Manager of the City of Denton, Texas, or his designee under this agreement. The contractor is expressly free to advertise and perform services for other parties while performing services for the City. 45. ASSIGNMENT-DELEGATION: The Contract shall be binding upon and ensure to the benefit of the City and the Contractor and their respective successors and assigns, provided however, that no right or interest in the Contract shall be assigned and no obligation shall be delegated by the Contractor without the prior written consent of the City. Any attempted assignment or delegation by the Contractor shall be void unless made in conformity with this paragraph. The Contract is not intended to confer rights or benefits on any person, firm or entity not a party hereto; it being the intention of the parties that there are no third party beneficiaries to the Contract. The Vendor shall notify the City’s Purchasing Manager, in writing, of a company name, ownership, or address change for the purpose of maintaining updated City records. The president of the company or authorized official must sign the letter. A letter indicating changes in a company name or ownership must be accompanied with supporting legal documentation such as an updated W-9, documents filed with the state indicating such change, copy of the board of director’s resolution approving the action, or an executed DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 363 Contract 7602 merger or acquisition agreement. Failure to do so may adversely impact future invoice payments. 46. WAIVER: No claim or right arising out of a breach of the Contract can be discharged in whole or in part by a waiver or renunciation of the claim or right unless the waiver or renunciation is supported by consideration and is in writing signed by the aggrieved party. No waiver by either the Contractor or the City of any one or more events of default by the other party shall operate as, or be construed to be, a permanent waiver of any rights or obligations under the Contract, or an express or implied acceptance of any other existing or future default or defaults, whether of a similar or different character. 47. MODIFICATIONS: The Contract can be modified or amended only by a writing signed by both parties. No pre-printed or similar terms on any the Contractor invoice, order or other document shall have any force or effect to change the terms, covenants, and conditions of the Contract. 48. INTERPRETATION: The Contract is intended by the parties as a final, complete and exclusive statement of the terms of their agreement. No course of prior dealing between the parties or course of performance or usage of the trade shall be relevant to supplement or explain any term used in the Contract. Although the Contract may have been substantially drafted by one party, it is the intent of the parties that all provisions be construed in a manner to be fair to both parties, reading no provisions more strictly against one party or the other. Whenever a term defined by the Uniform Commercial Code, as enacted by the State of Texas, is used in the Contract, the UCC definition shall control, unless otherwise defined in the Contract. 49. DISPUTE RESOLUTION: A. If a dispute arises out of or relates to the Contract, or the breach thereof, the parties agree to negotiate prior to prosecuting a suit for damages. However, this section does not prohibit the filing of a lawsuit to toll the running of a statute of limitations or to seek injunctive relief. Either party may make a written request for a meeting between representatives of each party within fourteen (14) calendar days after receipt of the request or such later period as agreed by the parties. Each party shall include, at a minimum, one (1) senior level individual with decision-making authority regarding the dispute. The purpose of this and any subsequent meeting is to attempt in good faith to negotiate a resolution of the dispute. If, within thirty (30) calendar days after such meeting, the parties have not succeeded in negotiating a resolution of the dispute, they will proceed directly to mediation as described below. Negotiation may be waived by a written agreement signed by both parties, in which event the parties may proceed directly to mediation as described below. B. If the efforts to resolve the dispute through negotiation fail, or the parties waive the negotiation process, the parties may select, within thirty (30) calendar days, a mediator trained in mediation skills to assist with resolution of the dispute. Should they choose this option; the City and the Contractor agree to act in good faith in the selection of the mediator and to give consideration to qualified individuals nominated to act as mediator. Nothing in the Contract prevents the parties from relying on the skills of a person who is trained in the subject matter of the dispute or a contract interpretation expert. If the parties fail to agree on a mediator within thirty (30) calendar days of initiation of the mediation process, the mediator shall be selected by the Denton County Alternative Dispute Resolution Program (DCAP). The parties agree to participate in mediation in good faith for up to thirty (30) calendar days from the date of the first mediation session. The City and the Contractor will share the mediator’s fees equally and the parties will bear their own costs of DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 364 Contract 7602 participation such as fees for any consultants or attorneys they may utilize to represent them or otherwise assist them in the mediation. 50. JURISDICTION AND VENUE: The Contract is made under and shall be governed by the laws of the State of Texas, including, when applicable, the Uniform Commercial Code as adopted in Texas, V.T.C.A., Bus. & Comm. Code, Chapter 1, excluding any rule or principle that would refer to and apply the substantive law of another state or jurisdiction. All issues arising from this Contract shall be resolved in the courts of Denton County, Texas and the parties agree to submit to the exclusive personal jurisdiction of such courts. The foregoing, however, shall not be construed or interpreted to limit or restrict the right or ability of the City to seek and secure injunctive relief from any competent authority as contemplated herein. 51. INVALIDITY: The invalidity, illegality, or unenforceability of any provision of the Contract shall in no way affect the validity or enforceability of any other portion or provision of the Contract. Any void provision shall be deemed severed from the Contract and the balance of the Contract shall be construed and enforced as if the Contract did not contain the particular portion or provision held to be void. The parties further agree to reform the Contract to replace any stricken provision with a valid provision that comes as close as possible to the intent of the stricken provision. The provisions of this section shall not prevent this entire Contract from being void should a provision which is the essence of the Contract be determined to be void. 52. HOLIDAYS: The following holidays are observed by the City: New Year’s Day (observed) MLK Day Memorial Day 4th of July Labor Day Thanksgiving Day Day After Thanksgiving Christmas Eve (observed) Christmas Day (observed) New Year’s Day (observed) If a Legal Holiday falls on Saturday, it will be observed on the preceding Friday. If a Legal Holiday falls on Sunday, it will be observed on the following Monday. Normal hours of operation shall be between 8:00 am and 4:00 pm, Monday through Friday, excluding City of Denton Holidays. Any scheduled deliveries or work performance not within the normal hours of operation must be approved by the City Manager of Denton, Texas or his authorized designee. 53. SURVIVABILITY OF OBLIGATIONS: All provisions of the Contract that impose continuing obligations on the parties, including but not limited to the warranty, indemnity, and confidentiality obligations of the parties, shall survive the expiration or termination of the Contract. 54. NON-SUSPENSION OR DEBARMENT CERTIFICATION: The City of Denton is prohibited from contracting with or making prime or sub-awards to parties that are suspended or debarred or whose principals are suspended or debarred from Federal, State, or City of Denton Contracts. By accepting a Contract with the City, the Vendor certifies that its DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 365 Contract 7602 firm and its principals are not currently suspended or debarred from doing business with the Federal Government, as indicated by the General Services Administration List of Parties Excluded from Federal Procurement and Non-Procurement Programs, the State of Texas, or the City of Denton. 55. EQUAL OPPORTUNITY A. Equal Employment Opportunity: No Offeror, or Offeror’s agent, shall engage in any discriminatory employment practice. No person shall, on the grounds of race, sex, sexual orientation, age, disability, creed, color, genetic testing, or national origin, be refused the benefits of, or be otherwise subjected to discrimination under any activities resulting from this RFQ. B. Americans with Disabilities Act (ADA) Compliance: No Offeror, or Offeror’s agent, shall engage in any discriminatory employment practice against individuals with disabilities as defined in the ADA. 56. BUY AMERICAN ACT-SUPPLIES (Applicable to certain federally funded requirements) The following federally funded requirements are applicable. A. Definitions. As used in this paragraph – i. "Component" means an article, material, or supply incorporated directly into an end product. ii. "Cost of components" means - (1) For components purchased by the Contractor, the acquisition cost, including transportation costs to the place of incorporation into the end product (whether or not such costs are paid to a domestic firm), and any applicable duty (whether or not a duty-free entry certificate is issued); or (2) For components manufactured by the Contractor, all costs associated with the manufacture of the component, including transportation costs as described in paragraph (1) of this definition, plus allocable overhead costs, but excluding profit. Cost of components does not include any costs associated with the manufacture of the end product. iii. "Domestic end product" means- (1) An unmanufactured end product mined or produced in the United States; or (2) An end product manufactured in the United States, if the cost of its components mined, produced, or manufactured in the United States exceeds 50 percent of the cost of all its components. Components of foreign origin of the same class or kind as those that the agency determines are not mined, produced, or manufactured in sufficient and reasonably available commercial quantities of a satisfactory quality are treated as domestic. Scrap generated, collected, and prepared for processing in the United States is considered domestic. iv. "End product" means those articles, materials, and supplies to be acquired under the contract for public use. v. "Foreign end product" means an end product other than a domestic end product. vi. "United States" means the 50 States, the District of Columbia, and outlying areas. B. The Buy American Act (41 U.S.C. 10a - 10d) provides a preference for domestic end products for supplies acquired for use in the United States. C. The City does not maintain a list of foreign articles that will be treated as domestic for this Contract; but will consider for approval foreign articles as domestic for this product if the articles are on a list approved by another Governmental Agency. The Offeror shall submit documentation with their Offer demonstrating that the article is on an approved Governmental list. D. The Contractor shall deliver only domestic end products except to the extent that it specified delivery of foreign end products in the provision of the Solicitation entitled "Buy American Act Certificate". DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 366 Contract 7602 57. RIGHT TO INFORMATION: The City of Denton reserves the right to use any and all information presented in any response to this contract, whether amended or not, except as prohibited by law. Selection of rejection of the submittal does not affect this right. 58. LICENSE FEES OR TAXES: Provided the solicitation requires an awarded contractor or supplier to be licensed by the State of Texas, any and all fees and taxes are the responsibility of the respondent. 59. PREVAILING WAGE RATES: The contractor shall comply with prevailing wage rates as defined by the United States Department of Labor Davis-Bacon Wage Determination at http://www.dol.gov/whd/contracts/dbra.htm and at the Wage Determinations website www.wdol.gov for Denton County, Texas (WD-2509). 60. COMPLIANCE WITH ALL STATE, FEDERAL, AND LOCAL LAWS: The contractor or supplier shall comply with all State, Federal, and Local laws and requirements. The Respondent must comply with all applicable laws at all times, including, without limitation, the following: (i) §36.02 of the Texas Penal Code, which prohibits bribery; (ii) §36.09 of the Texas Penal Code, which prohibits the offering or conferring of benefits to public servants. The Respondent shall give all notices and comply with all laws and regulations applicable to furnishing and performance of the Contract. 61. FEDERAL, STATE, AND LOCAL REQUIREMENTS: Respondent shall demonstrate on- site compliance with the Federal Tax Reform Act of 1986, Section 1706, amending Section 530 of the Revenue Act of 1978, dealing with issuance of Form W-2's to common law employees. Respondent is responsible for both federal and State unemployment insurance coverage and standard Workers’ Compensation insurance coverage. Respondent shall ensure compliance with all federal and State tax laws and withholding requirements. The City of Denton shall not be liable to Respondent or its employees for any Unemployment or Workers' Compensation coverage, or federal or State withholding requirements. Contractor shall indemnify the City of Denton and shall pay all costs, penalties, or losses resulting from Respondent's omission or breach of this Section. 62. DRUG FREE WORKPLACE: The contractor shall comply with the applicable provisions of the Drug-Free Work Place Act of 1988 (Public Law 100-690, Title V, Subtitle D; 41 U.S.C. 701 ET SEQ.) and maintain a drug-free work environment; and the final rule, government-wide requirements for drug-free work place (grants), issued by the Office of Management and Budget and the Department of Defense (32 CFR Part 280, Subpart F) to implement the provisions of the Drug-Free Work Place Act of 1988 is incorporated by reference and the contractor shall comply with the relevant provisions thereof, including any amendments to the final rule that may hereafter be issued. 63. RESPONDENT LIABILITY FOR DAMAGE TO GOVERNMENT PROPERTY: The Respondent shall be liable for all damages to government-owned, leased, or occupied property and equipment caused by the Respondent and its employees, agents, subcontractors, and suppliers, including any delivery or cartage company, in connection with any performance pursuant to the Contract. The Respondent shall notify the City of Denton Procurement Manager in writing of any such damage within one (1) calendar day. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 367 Contract 7602 64. FORCE MAJEURE: The City of Denton, any Customer, and the Respondent shall not be responsible for performance under the Contract should it be prevented from performance by an act of war, order of legal authority, act of God, or other unavoidable cause not attributable to the fault or negligence of the City of Denton. In the event of an occurrence under this Section, the Respondent will be excused from any further performance or observance of the requirements so affected for as long as such circumstances prevail and the Respondent continues to use commercially reasonable efforts to recommence performance or observance whenever and to whatever extent possible without delay. The Respondent shall immediately notify the City of Denton Procurement Manager by telephone (to be confirmed in writing within five (5) calendar days of the inception of such occurrence) and describe at a reasonable level of detail the circumstances causing the non-performance or delay in performance. 65. NON-WAIVER OF RIGHTS: Failure of a Party to require performance by another Party under the Contract will not affect the right of such Party to require performance in the future. No delay, failure, or waiver of either Party’s exercise or partial exercise of any right or remedy under the Contract shall operate to limit, impair, preclude, cancel, waive or otherwise affect such right or remedy. A waiver by a Party of any breach of any term of the Contract will not be construed as a waiver of any continuing or succeeding breach. 66. NO WAIVER OF SOVEREIGN IMMUNITY: The Parties expressly agree that no provision of the Contract is in any way intended to constitute a waiver by the City of Denton of any immunities from suit or from liability that the City of Denton may have by operation of law. 67. RECORDS RETENTION: The Respondent shall retain all financial records, supporting documents, statistical records, and any other records or books relating to the performances called for in the Contract. The Respondent shall retain all such records for a period of four (4) years after the expiration of the Contract, or until the CPA or State Auditor's Office is satisfied that all audit and litigation matters are resolved, whichever period is longer. The Respondent shall grant access to all books, records and documents pertinent to the Contract to the CPA, the State Auditor of Texas, and any federal governmental entity that has authority to review records due to federal funds being spent under the Contract. Should a conflict arise between any of the contract documents, it shall be resolved with the following order of precedence (if applicable). In any event, the final negotiated contract shall take precedence over any and all contract documents to the extent of such conflict. 1. Final negotiated contract 2. RFP/Bid documents 3. City’s standard terms and conditions 4. Purchase order 5. Contractor terms and conditions DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 368 Exhibit D Certificate of Interested Parties Electronic Filing In 2015, the Texas Legislature adopted House Bill 1295, which added section 2252.908 of the Government Code. The law states that the City may not enter into this contract unless the Contractor submits a disclosure of interested parties (Form 1295) to the City at the time the Contractor submits the signed contract. The Texas Ethics Commission has adopted rules requiring the business entity to file Form 1295 electronically with the Commission. Contractor will be required to furnish a Certificate of Interest Parties before the contract is awarded, in accordance with Government Code 2252.908. The contractor shall: 1. Log onto the State Ethics Commission Website at : https://www.ethics.state.tx.us/whatsnew/elf_info_form1295.htm 2. Register utilizing the tutorial provided by the State 3. Print a copy of the completed Form 1295 4. Enter the Certificate Number on page 2 of this contract. 5. Complete and sign the Form 1295 6. Email the form to purchasing@cityofdenton.com with the contract number in the subject line. (EX: Contract 1234 – Form 1295) The City must acknowledge the receipt of the filed Form 1295 not later than the 30th day after Council award. Once a Form 1295 is acknowledged, it will be posted to the Texas Ethics Commission’s website within seven business days. DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 369 Exhibit E Line #Description QTY UOM 1 SECTION A - AWARD SOUVENIR SHIRTS 2 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve Sizes: Adult Small - Adult XL *Gildan 5000 tshirt*1000 EA 3 Option 1: PROPOSED SHIRT STYLE BRAND/DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Short Sleeve SIZES: ADULT2XL-ADULT4XL * Gildan 5000 tshirt*1000 EA 4 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult Small - Adult XL *Gildan 5400 Long Sleeve*325 EA 5 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Long Sleeve Sizes: Adult 2XL - Adult 4XL *Gildean 5400 Long Sleeve*18500 Long Sleeve*325 EA 6 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult Small- Adult XL *Gildan 5400 Hoodie*325 EA 7 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Hoodie Sizes: Adult 2XL- Adult 4XL *Gildan 5400 Hoodie*325 EA 14 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult Small - Adult XL *Gildan 18000 Crew Sweatshirt*325 EA 15 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Cotton Sweatshirt Sizes: Adult 2XL- Adult 4XL *Gildan 18000 Crew Sweatshirt*325 EA 18 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult Small - Adult XL *Sport Tek ST350 Performance Tshirt*1000 EA 19 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Short Sleeve Sizes: Adult 2XL- Adult 4XL *Sport Tek ST350 Performance Tshirt*1000 EA 22 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult Small - Adult XL *Sport Tek ST350LS Performance Long Sleeve*325 EA 23 Option 1: PROPOSED SHIRT STYLE BRAND DESCRIPTIONBY VENDOR (INCLUDES ALL FEES) Performance Long Sleeve Sizes: Adult2XL - Adult 4XL *Sport Tek ST350LS Performance Long Sleeve*325 EA SECTION B - YOUTH SPORT JERSEYS 1 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey- YOUTH SIZE Sizes: Youth Small - Youth XL 192 EA 3 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Basketball Jersey-ADULTSIZE Sizes:AdultSmall -Adult4XL 48 EA 5 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey - YOUTH SIZES Sizes: Youth Small - Youth XL * Cutter Jersey Style Number 1518*192 EA 7 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Flag Football Jersey -ADULTSIZES Sizes: Adult Small - Adult 4XL *Cutter Jersey Style Number 1517*48 EA 9 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey Youth Size Sizes: Youth Small - Youth XL 408 EA 11 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Soccer (Outdoor Futsal) Jersey -ADULT SIZE Sizes: AdultSmall -AdultXL 102 EA 13 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - YOUTH SIZE Sizes: Youth Small - Youth XL 288 EA 15 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Youth Volleyball Jersey - ADULTSIZE Sizes: AdultSmall - AdultXL 72 EA 17 Option 1: MINIMUM STYLE BRAND/ITEM # DESCRIPTION Coaching Volunteer Shirts- ADULTSIZE Sizes: AdultSmall - Adult4XL *Gildan 5000 Tshirt*120 EA RFP 7602 Athletic Shirts and Jerseys 7.45 5.95 4.45 10.95 9.45 8.95 7.45 12.95 11.45 15.95 Groggy Dog Unit Price 14.45 8.95 $7.70 Denton, TXCity and State $18.70 $19.70 $18.20 $17.70 Vendor $18.70 $17.70 $19.70 $20.20 DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 370 Exhibit CONFLICT OF INTEREST QUESTIONNAIRE - FORM CIQ For vendor or other person doing business with local governmental entity This questionnaire reflects changes made to the law by H.B. 23, 84th Leg., Regular Session. This questionnaire is being filed in accordance with Chapter 176, Local Government Code, by a vendor who has a business relationship as defined by Section 176.001(1-a) with a local governmental entity and the vendor meets requirements under Section 176.006(a). By law this questionnaire must be filed with the records administrator of the local government entity not later than the 7th business day after the date the vendor becomes aware of facts that require the statement to be filed. See Section 176.006(a-1), Local Government Code. A vendor commits an offense if the vendor knowingly violates Section 176.006, Local Government Code. An offense under this section is a misdemeanor. 1 Name of vendor who has a business relationship with local governmental entity. 2 Check this box if you are filing an update to a previously filed questionnaire. (The law requires that you file an updated completed questionnaire with the appropriate filing authority not later than the 7th business day after the date on which you became aware that the originally filed questionnaire was incomplete or inaccurate.) 3 Name of local government officer about whom the information in this section is being disclosed. Name of Officer This section, (item 3 including subparts A, B, C & D), must be completed for each officer with whom the vendor has an employment or other business relationship as defined by Section 176.001(1-a), Local Government Code. Attach additional pages to this Form CIQ as necessary. A. Is the local government officer named in this section receiving or likely to receive taxable income, other than investment income, from the vendor? Yes No B. Is the vendor receiving or likely to receive taxable income, other than investment income, from or at the direction of the local government officer named in this section AND the taxable income is not received from the local governmental entity? Yes No C. Is the filer of this questionnaire employed by a corporation or other business entity with respect to which the local government officer serves as an officer or director, or holds an ownership of one percent or more? Yes No D. Describe each employment or business and family relationship with the local government officer named in this section. 4 I have no Conflict of Interest to disclose. 5 Signature of vendor doing business with the governmental entity Date DocuSign Envelope ID: 7D8C0FE1-510A-4C0A-B5C7-D66E9B8616A8 F Groggy Dog Sportswear & Graphic Design, LLC X N/A 7/7/2021 371 Certificate Of Completion Envelope Id: 7D8C0FE1510A4C0AB5C7D66E9B8616A8 Status: Sent Subject: Please DocuSign: City Council Contract 7602 PARD Athletic Shirts & Jerseys Source Envelope: Document Pages: 27 Signatures: 4 Envelope Originator: Certificate Pages: 6 Initials: 1 Erica Garcia AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 erica.garcia@cityofdenton.com IP Address: 198.49.140.10 Record Tracking Status: Original 7/6/2021 3:36:12 PM Holder: Erica Garcia erica.garcia@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Erica Garcia erica.garcia@cityofdenton.com Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.10 Sent: 7/6/2021 4:10:42 PM Viewed: 7/6/2021 4:10:51 PM Signed: 7/6/2021 4:11:35 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/6/2021 4:11:38 PM Viewed: 7/6/2021 4:38:18 PM Signed: 7/6/2021 4:39:06 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Marcella Lunn marcella.lunn@cityofdenton.com Deputy City Attorney City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 68.185.202.16 Sent: 7/6/2021 4:39:08 PM Viewed: 7/6/2021 4:45:26 PM Signed: 7/6/2021 4:50:42 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Mary Ann Chambers mchambers@groggydogonline.com Operations Manager Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 47.190.6.63 Sent: 7/6/2021 4:50:45 PM Viewed: 7/7/2021 8:57:58 AM Signed: 7/7/2021 9:17:30 AM Electronic Record and Signature Disclosure: Accepted: 7/7/2021 8:57:58 AM ID: a5f59a50-ce88-4d65-bdff-1c10edbb8bd1 372 Signer Events Signature Timestamp Gary Packan Gary.Packan@cityofdenton.com Director of Parks and Recreation Parks and Recreation Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/7/2021 9:17:33 AM Viewed: 7/7/2021 9:32:05 AM Signed: 7/7/2021 9:32:29 AM Electronic Record and Signature Disclosure: Accepted: 7/7/2021 9:32:05 AM ID: 6acd29cf-adbe-4080-9f93-4e6b44d6c105 Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/7/2021 9:32:34 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Sara Hensley sara.hensley@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Rosa Rios rosa.rios@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Accepted: 7/1/2021 10:36:47 AM ID: f04dd758-be5b-4966-aa99-d198dc46f8f7 In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/6/2021 4:11:37 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign 373 Carbon Copy Events Status Timestamp Gretna Jones gretna.jones@cityofdenton.com Legal Secretary City of Denton Security Level: Email, Account Authentication (None) Sent: 7/7/2021 9:32:33 AM Viewed: 7/7/2021 9:33:05 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign City Secretary Office citysecretary@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Chris Escoto Chris.Escoto@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 7/6/2021 4:10:42 PM Payment Events Status Timestamps Electronic Record and Signature Disclosure 374 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. Electronic Record and Signature Disclosure created on: 7/21/2017 3:59:03 PM Parties agreed to: Mary Ann Chambers, Gary Packan, Rosa Rios 375 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 376 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 377 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1491,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,a Texas home-rule municipal corporation,authorizing the City Manager,or their designee,to execute a contract with DLT Solutions,LLC,through the Department of Information Resources (DIR)Cooperative Purchasing Network Contract No.DIR-TSO-4236,for AutoCAD AEC Collection Software system subscription,maintenance,and purchase of licenses for the Technology Services Department;providing for the expenditure of funds therefor;and providing an effective date (File 7630 - awarded to DLT Solutions, LLC, in the four (4) year not-to-exceed amount of $228,873.00). City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™378 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Procurement & Compliance ACM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or their designee, to execute a contract with DLT Solutions, LLC, through the Department of Information Resources (DIR) Cooperative Purchasing Network Contract No. DIR-TSO- 4236, for AutoCAD AEC Collection Software system subscription, maintenance, and purchase of licenses for the Technology Services Department; providing for the expenditure of funds therefor; and providing an effective date (File 7630 – awarded to DLT Solutions, LLC, in the four (4) year not-to-exceed amount of $228,873.00). INFORMATION/BACKGROUND The City of Denton uses the AutoCAD Architecture, Engineering, and Construction Collection Software system to allow designers, architects, engineers, and construction professionals to create precise 2D and 3D drawings. This provides the following benefits: design and building of roadways, water, and wastewater systems, electrical wiring systems; creation of high-quality cloud collaboration with design team; high- performance building and infrastructure designs with conceptual and detailed design tools; optimization of projects with integrated analysis; generative design visualization and simulation tools; and predictability in the field with tools that maximize constructability and project coordination. The departments using the AutoCAD Software include Facilities, Engineering, Real Estate, Development Services, Solid Waste, Parks, and Denton Municipal Electric Engineering. The AutoCAD software has been used since 2007. On July 18, 2018, Contract# DIR-TSO-3400 was awarded to DLT Solutions, LLC, a three (3) year not-to-exceed amount of $115,540.71. On June 22, 2020, Contract 5678 was amended for the first time between the City of Denton, Texas, and DLT Solutions, LLC (“Contractor”). The City deemed it necessary to further expand the services provided with additional licenses and Building Information Modeling services (BIM). The terms of the Agreement provide an additional not-to-exceed amount of $28,885 and an aggregate not-to-exceed of $144,425.71. The City of Denton would like to continue to utilize the AutoCAD Software system for another four (4) years to capture the full lifecycle of the product. It is essential for the City of Denton to keep current subscription and maintenance with the software vendor to ensure legal licensing of the software, but the availability of upgrades, software fixes, access knowledge, and support resources. The Technology Services department could not identify any local vendors that provide software maintenance for this application. Therefore, procuring this maintenance from the above vendor is the best value for the City of Denton. City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 379 The budgeted amount for these items is $228,873 and the not-to-exceed amount includes three (3) years of subscription renewals with a 15% contingency added for growth of more license subscriptions. Pricing obtained through the Department of Information Resources (DIR) Cooperative Purchasing Network has been competitively bid and meets the statutory requirements of Texas Local Government Code 271.102. PRIOR ACTION/REVIEW (COUNCIL, BOARDS, COMMISSIONS) On January 28, 2020, Council approved the interlocal agreement with the Department of Information Resources Purchasing Network (Ordinance 20-196). RECOMMENDATION Award a contract with DLT Solutions, LLC, for AutoCAD AEC Collection Software system subscription, maintenance, and purchase of licenses for the Technology Services Department, in a four (4) year not-to- exceed amount of $228,873. PRINCIPAL PLACE OF BUSINESS DLT Solutions, LLC Herndon, VA ESTIMATED SCHEDULE OF PROJECT This is a four (4) year contract. This DIR contract expires on October 18, 2025. Year 1 7/1/21 - 6/30/22 Year 2 7/1/22 - 6/30/23 Year 3 7/1/23 - 6/30/24 Year 4 7/1/24 - 6/30/25 TS GIS AutoCAD - including specialized toolsets AD Government Single-user ELD Annual Subscription Switched From M2S Multi-User 2:1 Trade-In 30 count (Quote 4911812) 9,710 9,710 9,710 9,710 TS GIS Architecture Engineering & Construction Collection Government Single-user Annual Subscription Renewal Switched From Maintenance 8 count (Quote 4911812) 12,398 12,398 12,398 12,398 TS GIS AutoCAD - including specialized toolsets Government Single-user Annual Subscription Renewal 4 count (Quote 4911812) 6,086 6,086 6,086 6,086 TS GIS BIM Collaborate - 10 Subscription CLOUD Government New Single-user 10 Pack Annual Subscription (Quote 4911812) 5,830 5,830 5,830 5,830 Repro Products Training - BIM Collaborate Pro Training (Quote 4911812) - - - TS DME AutoCAD Design &Map (Quote 4932557)$33,657 = $11,219 per year / 3 years = $11,219 per year paid 11,219 11,219 11,219 Subtotal 34,024 45,243 45,243 45,243 15% Contingency 5,104 6,786 6,786 6,786 Total 39,128 63,248 63,248 63,248 Grand Total: 228,873 380 FISCAL INFORMATION These services will be funded from Technology Services Operating Funds. EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Quote Exhibit 3: LLC Members Exhibit 4: Ordinance Respectfully submitted: Lori Hewell, 940-349-7100 Purchasing Manager For information concerning this acquisition, contact: Leisha Meine, 940-349-7823. Legal point of contact: Marcella Lunn at 940-349-8333. 381 To:Mr. Tony Smith Denton City of (TX) 601 E. Hickory Suite A Denton, TX 76205 Phone:(940) 349-8933 Fax: Email:john.smith@cityofdenton.com From:Andrew Daugherty DLT Solutions, LLC 2411 Dulles Corner Park Suite 800 Herndon, VA 20171 Phone:(703) 708-9609 Fax:(703) 708-9609 Email:andrew.daugherty@dlt.com #DLT Part No. Contract [ Contract Price ]Qty Unit Price [ List Price ]Ext. Price 1 9701-0897 S-TX-MVEND-DIR-SW [ $323.66 ] 30 $323.66 [ $342.50 ] $9,709.80 AutoCAD - including specialized toolsets AD Government Single-user ELD Annual Subscription Switched From M2S Multi-User 2:1 Trade-In 110002275576 A-14326745 Network 2 for 1 to Single-user PoP: 7/30/2021 through 7/29/2022 2 9701-1008733 S-TX-MVEND-DIR-SW [ $1,176.53 ] 6 $1,176.53 [ $1,245.00 ] $7,059.18 Architecture Engineering & Construction Collection Government Single-user Annual Subscription Renewal Switched From Maintenance (Switched between May 2019 - May 2020 and Ongoing) 110002275576 A-14326745 PoP: 7/30/2021 through 7/29/2022 3 9701-1004929 S-TX-MVEND-DIR-SW [ $1,521.45 ] 3 $1,521.45 [ $1,610.00 ] $4,564.35 AutoCAD - including specialized toolsets Government Single-user Annual Subscription Renewal 110003040365 A-14326996 PoP: 7/30/2021 through 7/29/2022 4 9701-1001719 S-TX-MVEND-DIR-SW [ $2,669.63 ] 2 $2,669.63 [ $2,825.00 ] $5,339.26 Architecture Engineering & Construction Collection Government Single-user Annual Subscription Renewal 110003101093 A-14326515 PoP: 7/30/2021 through 7/29/2022 5 9701-1004929 S-TX-MVEND-DIR-SW [ $1,521.45 ] 1 $1,521.45 [ $1,610.00 ] $1,521.45 AutoCAD - including specialized toolsets Government Single-user Annual Subscription Renewal 110003135606 A-14327930 PoP: 7/30/2021 through 7/29/2022 6 9701-3575 S-TX-MVEND-DIR-SW [ $5,830.02 ] 1 $5,830.02 [ $6,485.00 ] $5,830.02 BIM Collaborate - 10 Subscription CLOUD Government New Single-user 10 Pack Annual Subscription PoP: 7/30/2021 through 7/29/2022 Price Quotation Quote:4911812 Reference:1615167 Date:07/13/2021 Expires:07/30/2021 Page 1 of 2DLT CONFIDENTIAL 382 Price Quotation Quote:4911812 Reference:1615167 Date:07/13/2021 Expires:07/30/2021 #DLT Part No. Contract [ Contract Price ]Qty Unit Price [ List Price ]Ext. Price 7 9079-0134 OM [ $0.00 ] 1 $1,500.00 [ $1,500.00 ] $1,500.00 Repro Products Training Repro Products Training BIM Collaborate Pro Training PoP: 7/30/2021 through 7/29/2022 Total $35,524.06 This represents a savings of ($1,500.00) [ -4.41% ] off the Total Contract Price $34,024.06. This represents a savings of $2,295.94 [ 6.07% ] off the Total List Price $37,820.00. Contract #: DIR-TSO-4236DUNS #: 78-6468199Federal ID: 54-1599882CAGE Code: 0S0H9FOB: DestinationContract Term: 10/18/2019 - 10/18/2021Ship Via: Fedex Ground/UPSPayment Terms: Net 30 days THIS QUOTE IS SUBJECT TO THE TERMS AND CONDITIONS OF CONTRACT NUMBER DIR-TSO-4236.CUSTOMER IS DIRECTED TO INCORPORATE (BY REFERENCE) THIS QUOTE IN ANY RESULTINGTASK/DELIVERY ORDER OR AWARD. THE TERMS OF THE AFOREMENTIONED CONTRACT ARE THEONLY CONTROLLING TERMS AND ANY TERMS OR CONDITIONS CONTAINED IN AN ORDER, AWARD OROTHER INSTRUMENT OF BUYER, WHICH ARE IN ADDITION TO OR INCONSISTENT WITH ANY OF THETERMS OR CONDITIONS CONTAINED IN THOSE REFERENCED HEREIN, SHALL NOT BE BINDING ON DLTOR ITS MANUFACTURERS AND SHALL NOT APPLY UNLESS SPECIFICALLY AGREED TO IN WRITING BYDLT. CPARs requests should be sent to the attention of AJ Ezersky at cpars@dlt.com. PLEASE REMIT PAYMENT TO: ACH:DLT Solutions, LLC Bank of America ABA # 111000012 Acct # 4451063799 -OR-Mail:DLT Solutions, LLC P.O. Box 743359 Atlanta, GA 30374-3359 Customer orders subject to applicable sales tax. Documentation to be submitted to validate Invoice for payment:a. Authorized Services shall be invoiced with a corresponding time report for the period of performance identifying names,days, and hours worked.b. Authorized reimbursable expenses shall be invoiced with a detailed expense report, documented by copies of supportingreceipts.c. Authorized Education or Training shall be invoiced with a Report identifying date and name of class completed, and whereapplicable the name of attendees. Price Quotation Quote:4911812 Reference:1615167 Date:07/13/2021 Expires:07/30/2021 Page 2 of 2DLT CONFIDENTIAL 383 384 ORDINANCE NO. AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORIZING THE CITY MANAGER, OR THEIR DESIGNEE, TO EXECUTE A CONTRACT WITH DLT SOLUTIONS, LLC, THROUGH THE DEPARTMENT OF INFORMATION RESOURCES (DIR) COOPERATIVE PURCHASING NETWORK CONTRACT NO. DIR-TSO-4236, FOR AUTOCAD AEC COLLECTION SOFTWARE SYSTEM SUBSCRIPTION, MAINTENANCE, AND PURCHASE OF LICENSES FOR THE TECHNOLOGY SERVICES DEPARTMENT; PROVIDING FOR THE EXPENDITURE OF FUNDS THEREFOR; AND PROVIDING AN EFFECTIVE DATE (FILE 7630 AWARDED TO DLT SOLUTIONS, LLC, IN THE FOUR (4) YEAR NOT-TO-EXCEED AMOUNT OF $228,873.00). WHEREAS, pursuant to Ordinance 20-196, the Department of Information Resources has solicited, received, and tabulated competitive bids for the purchase of necessary materials, equipment, supplies or services in accordance with the procedures of state law on behalf of the City of Denton; and WHEREAS, the City Manager, or a designated employee, has reviewed and recommended that the herein described materials, equipment, supplies or services can be purchased by the City through the State of Texas Department of Information Services Go Direct Program at less cost than the City would expend if bidding these items individually; and WHEREAS, the City Council has provided in the City Budget for the appropriation of funds to be used for the purchase of the materials, equipment, supplies or services approved and accepted herein; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The numbered items in the following numbered purchase order for materials, equipment, supplies, or services, shown in the "File Number" listed hereon, and on file in the office of the Purchasing Agent, are hereby approved: FILE NUMBER 7630 VENDOR DLT Solutions, LLC AMOUNT $228,873.00 SECTION 2. By the acceptance and approval of the above numbered items set forth in the attached purchase orders, the City accepts the offer of the persons submitting the bids to the State of TexasDepartment of Information Services Go Direct Program for such items and agrees to purchase the materials, equipment, supplies or services in accordance with the terms, conditions, specifications, standards, quantities and for the specified sums contained in the bid documents, and related documents filed with the State of Texas Department of Information Services Go Direct 385 Program, and the purchase orders issued by the City. SECTION 3. Should the City and persons submitting approved and accepted items set forth inthis ordinance wish to enter into a formal written agreement as a result of the City's ratification of bids awarded by the State of Texas Department of Information Services Go Direct Program, the City Manager, or their designated representative, is hereby authorized to execute the written contract which shall be referenced herein; provided that the written contract is in accordance with the terms, conditions, specifications and standards contained in the Proposal submitted to the State of Texas Department of Information Services Go Direct Program, quantities and specified sums contained in the City's purchase orders, and related documents herein approved and accepted. SECTION 4. By the acceptance and approval of the above enumerated bids, the City Council hereby authorizes the expenditure of funds therefor in the amount and in accordance with the approved bids. SECTION 5. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. This ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _______ day of ___________________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR 386 ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: _________________________________ 387 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1492,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,a Texas home-rule municipal corporation,authorizing the approval of Change Order No.3 to the contract between the City of Denton and MSB Constructors,Inc.,to provide additional services for the Development Services Center Parking Lot Improvements Project;providing for the expenditure of funds therefor;and providing an effective date (File 7452 -Change Order No.3 in the not-to-exceed amount of $45,395.74, for a total contract award aggregated to $1,038,225.83). City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™388 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Procurement and Compliance ACM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the approval of Change Order No. 3 to the contract between the City of Denton and MSB Constructors, Inc., to provide additional services for the Development Services Center Parking Lot Improvements Project; providing for the expenditure of funds therefor; and providing an effective date (File 7452 – Change Order No. 3 in the not-to-exceed amount of $45,395.74, for a total contract award aggregated to $1,038,225.83). INFORMATION/BACKGROUND The Denton Development Services Parking Lot Improvements Project consists of parking lot removal and reconstruction at the new Development Services Center, located at 401 N. Elm in downtown Denton. This project will also include drainage improvements, pavement markings, irrigation, and landscaping. The Denton Development Services Parking Lot Improvements Project was originally intended to be included as part of the building renovation project, but due to the scope and cost of the parking lot, the decision was made to remove it from the original project scope and bid it out as a separate project. The original project of $944,964.30 for the Denton Development Services Parking Lot Improvements Project consisted of a $372,300 total base bid; $527,666 Alternates A, B, D, E; and a $44,998.30 contingency. During site excavation, unforeseen buried structures were found. These structures had to be removed in order to treat subgrade and install electrical and irrigation lines, which lead to the first contract change order. The second change order was the result of discovering an unsuitable subgrade during site excavation. This material had to be removed and suitable material brought in, resulting in additional expenses in asphalt and concrete removal. This third change order is the result of City-requested scope changes including the demolition and replacement of a stairwell, revisions to the electrical plan to power the parking lot lighting directly from the building, and additional minor changes such as modifications to pavement marking and additional asphalt quantities. PRIOR ACTION/REVIEW (COUNCIL, BOARDS, COMMISSIONS) On November 10, 2020, City Council approved a contract with MSB Constructors, Inc., in the not-to-exceed amount of $944,964.30 (Ordinance 20-2223). City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 389 On March 8, 2021, Purchasing approved Change Order 1 with MSB Constructors, Inc., in the not-to-exceed amount of $32,756.49 using contingency funds. On May 6, 2021, Purchasing approved Change Order 2 with MSB Constructors, Inc., in the not-to-exceed amount of $12,241.81 using contingency funds and $47,865.79 in additional funding. RECOMMENDATION Award Change Order No. 3 with MSB Constructors, Inc., to provide additional services for the Development Services Center Parking Lot Improvements Project, in a not-to-exceed amount of $45,395.74 for a total amended contract amount of $1,038,225.83. PRINCIPAL PLACE OF BUSINESS MSB Constructors, Inc. Boyd, TX ESTIMATED SCHEDULE OF PROJECT The project is estimated to be completed within 235 calendar days from Notice to Proceed. The contract end date is July 30, 2021. FISCAL INFORMATION This project will be funded from City of Denton Facilities Certificate of Obligation funds. EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Original Ordinance and Contract Exhibit 3: Change Order 1 Exhibit 4: Change Order 2 Exhibit 5: Ordinance and Change Order 3 Respectfully submitted: Lori Hewell, 940-349-7100 Purchasing Manager For information concerning this acquisition, contact: Trevor Crain at 940-349-7426. Legal point of contact: Marcella Lunn at 940-349-8333. 390 ORDINANCE NO.20-2223 AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORiZING THE CITY MANAGER TO EXECUTE A CONTRACT WITH MSB CONSTRUCTORS, NC., FOR THE CONSTRUCTION OF THE DENTON DEVELOPMENT SERVICES PARKING LOT IMPROVEMENTS PROJECT FOR THE CITY OF DENTON; PROVIDING FOR THE EXPENDITURE OF FUNDS THEREFOR; AND PROVIDING AN EFFECTIVE DATE (IFB 7452 – AWARDED TO MSB CONSTRUCTORS, INC., IN THE NOT-TO-EXCEED AMOUNT OF $944,964.30). WHEREAS, the City has solicited, received, and tabulated competitive bids for the purchase of necessary materials, equipment, supplies or services in accordance with the procedures of State law and City ordinances; and WHEREAS, the City Manager, or a designated employee, has reviewed and recommended that the herein described bids are the lowest responsible bids for the materials, equipment, supplies or services as shown in the "Bid Proposals" submitted therefore; and WHEREAS, the City Council has provided in the City Budget for the appropriation of funds to be used for the purchase of the materials, equipment, supplies, or services approved and accepted herein; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The following competitive bids for the materials, equipment, supplies, or services, as described in the "Bid Invitations", "Bid Proposals" or plans and specifications on file in the Office of the City's Purchasing Agent filed according to the bid number assigned hereto, are hereby accepted and approved as being the lowest responsible bids: BID NUMBER VENDOR AMOUNT 7452 MSB Constructors, Inc.$944,964.30 SECTION 2. That the acceptance and approval of the above competitive bids shall not constitute a contract between the City and the person submitting the bid for such items and agrees to purchase the materials, equipment, supplies or services in accordance with the terms, specifications, standards, quantities and for the specified sums contained in the Bid Invitations, Bid Proposals, and related documents. SECTION 3. Should the City and the winning bidder(s) wish to enter into a formal written agreement as a result of the acceptance, approval, and awarding of the bids, the City Manager, or his designated representative, is hereby authorized to execute a written contract in accordance with the terms, conditions, specifications, standards, quantities and specified sums contained in the Bid Proposal and related documents and to extend that contract as determined to be advantageous to the City of Denton. 391 SECTION 4. The City Council of the City of Denton, hereby expressly delegates the authority to take any actions that may be required or permitted to be performed by the City of Denton under this ordinance to the City Manager of the City of Denton, or his designee. SECTION 5. By the acceptance and approval of the above enumerated bids, the City Council hereby authorizes the expenditure of funds therefor in the amount and in accordance with the approved bids. SECTION 6. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance seconded by 3-W the following vote [L - a] : Aye ,card RucIs R andwas made by the ordinance was passed and approved by9 Nay Abstain Absent Mayor Chris Watts: Gerard Hudspeth, District 1 : Keely G. Briggs, District 2: Jesse Davis, District 3 : John Ryan, District 4: Deb Armintor, At Large Place 5 : Paul Meltzer, At Large Place 6: ./ J7-7-7-7- 392 PASSED AND APPROVED thi, th, latEr day ,f FJOVetnbec , 2020. anTi–G–AfKMrf6R ATTEST: ROSA RIOS, CITY SECRETARY By: Mayor Pro Tem Gerard Hudspeth BY:Z:2/v APPROVED AS TO LEGAL FORM: AARON LEAL, CITY ATTORNEY JOBY: 393 Docusign City Council Transmittal Coversheet File Name Purchasing Contact City Council Target Date Piggy Back Option Contract Expiration Ordinance       # !%"#!' %$  !% "" &##!$! !'#   394 00 52 43 - 1 Agreement Page 1 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 SECTION 00 52 43 1 AGREEMENT 2 THIS AGREEMENT, authorized on ______________is made by and between the City of Denton, 3 a Texas home rule municipality, acting by and through its duly authorized City Manager, (“City”), 4 and MSB Constructors, Inc., authorized to do business in Texas, acting by and through its duly 5 authorized representative, (“Contractor”). 6 City and Contractor, in consideration of the mutual covenants hereinafter set forth, agree as follows: 7 Article 1. WORK 8 Contractor shall complete all Work as specified or indicated in the Contract Documents for the 9 Project identified herein. 10 Article 2. PROJECT 11 The project for which the Work under the Contract Documents may be the whole or only a part is 12 generally described as follows: 13 Denton Development Services Center Parking Lot Improvements 14 Contract No: 7452 15 Article 3. CONTRACT PRICE 16 City agrees to pay Contractor for performance of the Work in accordance with the Contract 17 Documents an amount, in current funds, of Eight hundred ninety-nine thousand nine hundred 18 sixty-six Dollars and 0/100 cents ($899,966). At the sole option of the City, five (5) percent 19 contingency in the amount of Forty-four thousand nine hundred and ninety-eight Dollars and 20 30/100 cents ($44,998.30) may be used for a total not-to-exceed amount of Nine hundred and 21 forty-four thousand nine hundred and sixty-four Dollars and 30/100 cents ($944,964.30). 22 23 Article 4. CONTRACT TIME 24 4.1 Final Acceptance. 25 The Work will be complete for Final Acceptance within 180 days after the date when the 26 Contract Time commences to run, as provided in Paragraph 2.03 of the General Conditions, 27 plus any extension thereof allowed in accordance with Article 12 of the General Conditions. 28 4.2 Liquidated Damages 29 Contractor recognizes that time is of the essence for completion of Milestones, if any, and 30 to achieve Final Acceptance of the Work and City will suffer financial loss if the Work is 31 not completed within the time(s) specified in Paragraph 4.1 above. The Contractor also 32 recognizes the delays, expense and difficulties involved in proving in a legal proceeding, 33 the actual loss suffered by the City if the Work is not completed on time. Accordingly, 34 instead of requiring any such proof, Contractor agrees that as liquidated damages for delay 35 (but not as a penalty), Contractor shall pay City Five Hundred Dollars ($500.00) for each 36 day that expires after the time specified in Paragraph 4.1 for Final Acceptance until the 37 City issues the Final Letter of Acceptance. 38        395 00 52 43 - 2 Agreement Page 2 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 Article 5. CONTRACT DOCUMENTS 1 5.1 CONTENTS: 2 A. The Contract Documents which comprise the entire agreement between City and 3 Contractor concerning the Work consist of the following: 4 1. This Agreement. 5 2. Attachments to this Agreement: 6 a. Bid Form 7 1) Proposal Form 8 2) Vendor Compliance to State Law Non-Resident Bidder 9 b. Current Prevailing Wage Rate Table 10 c. Worker’s Compensation Affidavit 11 d. General Conditions. 12 e. Supplementary Conditions. 13 3. The following located in File 7452 at: 14 https://lfpubweb.cityofdenton.com/MaterialsManagement/Browse.aspx?startid=1915 &row=1&dbid=0: 16 a. Specifications described in the Table of Contents of the Project’s Contract 17 Documents. 18 b. North Central Texas Council of Governments Standard Specifications for Public 19 Works Construction – Fourth Edition, Divisions 200-800, and as amended by 20 City, and described in the Table of Contents of the Project’s Contract Documents. 21 c. Drawings. 22 d. Addenda. 23 e. Documentation submitted by Contractor prior to Notice of Award. 24 4. The following which shall be issued after the Effective Date and delivered to the City 25 within ten (10) days of the Effective Date and before beginning Work: 26 a. Payment Bond 27 b. Performance Bond 28 c. Maintenance Bond 29 d. Power of Attorney for the Bonds 30 e. Form 1295 – Certificate of Interested Parties (email to purchasing) 31 f. Insurance Certificate 32 5. The following which may be delivered or issued after the Effective Date and, if 33 issued, become an incorporated part of the Contract Documents: 34 a. Notice to Proceed. 35 b. Field Orders. 36 c. Change Orders. 37 d. Letter of Final Acceptance. 38 39 40       396 00 52 43 - 3 Agreement Page 3 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 Article 6. INDEMNIFICATION 1 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own 2 expense, the city, its officers, servants and employees, from and against any and all 3 claims arising out of, or alleged to arise out of, the work and services to be performed 4 by the contractor, its officers, agents, employees, subcontractors, licensees or invitees 5 under this contract. This indemnification provision is specifically intended to operate 6 and be effective even if it is alleged or proven that all or some of the damages being 7 sought were caused, in whole or in part, by any act, omission or negligence of the city. 8 This indemnity provision is intended to include, without limitation, indemnity for any 9 and all costs, expenses and legal fees incurred by the city in defending against such 10 claims and causes of actions. 11 12 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, 13 the city, its officers, servants and employees, from and against any and all loss of, 14 damage to, or destruction of, property of the city, arising out of, or alleged to arise out 15 of, the work and services to be performed by the contractor, its officers, agents, 16 employees, subcontractors, licensees or invitees under this contract. This 17 indemnification provision is specifically intended to operate and be effective even if it is 18 alleged or proven that all or some of the damages being sought were caused, in whole or 19 in part, by any act, omission or negligence of the city. 20 21 Article 7. MISCELLANEOUS 22 7.1 Terms. 23 Terms used in this Agreement which are defined in Article 1 of the General Conditions will 24 have the meanings indicated in the General Conditions. 25 7.2 Assignment of Contract. 26 This Agreement, including all of the Contract Documents may not be assigned by the 27 Contractor without the advanced express written consent of the City. 28 7.3 Successors and Assigns. 29 City and Contractor each binds itself, its partners, successors, assigns and legal 30 representatives to the other party hereto, in respect to all covenants, agreements and 31 obligations contained in the Contract Documents. 32 7.4 Severability. 33 Any provision or part of the Contract Documents held to be unconstitutional, void or 34 unenforceable by a court of competent jurisdiction shall be deemed stricken, and all 35 remaining provisions shall continue to be valid and binding upon City and Contractor. 36 7.5 Governing Law and Venue. 37 This Agreement, including all of the Contract Documents is performable in the State of 38 Texas. Venue shall be Denton County, Texas, or the United States District Court for the 39 Eastern District of Texas, Sherman Division. 40       397 00 52 43 - 4 Agreement Page 4 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 7.6 Authority to Sign. 1 Contractor shall attach evidence of authority to sign Agreement if signed by someone other 2 than the duly authorized signatory of the Contractor. 3 4 7.7 Prohibition On Contracts With Companies Boycotting Israel. 5 Contractor acknowledges that in accordance with Chapter 2270 of the Texas Government 6 Code, the City is prohibited from entering into a contract with a company for goods or 7 services unless the contract contains a written verification from the company that it: (1) 8 does not boycott Israel; and (2) will not boycott Israel during the term of the contract. 9 The terms “boycott Israel” and “company” shall have the meanings ascribed to those terms 10 in Section 808.001 of the Texas Government Code. By signing this contract, Contractor 11 certifies that Contractor’s signature provides written verification to the City that 12 Contractor: (1) does not boycott Israel; and (2) will not boycott Israel during the term of 13 the contract. 14 15 7.8 Immigration Nationality Act. 16 Contractor shall verify the identity and employment eligibility of its employees who perform 17 work under this Agreement, including completing the Employment Eligibility Verification 18 Form (I-9). Upon request by City, Contractor shall provide City with copies of all I-9 forms 19 and supporting eligibility documentation for each employee who performs work under this 20 Agreement. Contractor shall adhere to all Federal and State laws as well as establish 21 appropriate procedures and controls so that no services will be performed by any Contractor 22 employee who is not legally eligible to perform such services. CONTRACTOR SHALL 23 INDEMNIFY CITY AND HOLD CITY HARMLESS FROM ANY PENALTIES, 24 LIABILITIES, OR LOSSES DUE TO VIOLATIONS OF THIS PARAGRAPH BY 25 CONTRACTOR, CONTRACTOR’S EMPLOYEES, SUBCONTRACTORS, 26 AGENTS, OR LICENSEES. City, upon written notice to Contractor, shall have the right 27 to immediately terminate this Agreement for violations of this provision by Contractor. 28 29 7.9 No Third-Party Beneficiaries. 30 This Agreement gives no rights or benefits to anyone other than the City and the Contractor 31 and there are no third-party beneficiaries. 32 33 34       398 00 52 43 - 5 Agreement Page 5 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 7.10 No Cause of Action Against Engineer. 1 Contractor, its subcontractors and equipment and materials suppliers on the Project or their 2 sureties, shall maintain no direct action against the Engineer, its officers, employees, and 3 subcontractors, for any claim arising out of, in connection with, or resulting from the engineering 4 services performed. Only the City will be the beneficiary of any undertaking by the Engineer. 5 The presence or duties of the Engineer's personnel at a construction site, whether as on-site 6 representatives or otherwise, do not make the Engineer or its personnel in any way 7 responsible for those duties that belong to the City and/or the City's Contractors or other 8 entities, and do not relieve the Contractors or any other entity of their obligations, duties, and 9 responsibilities, including, but not limited to, all construction methods, means, techniques, 10 sequences, and procedures necessary for coordinating and completing all portions of the 11 construction work in accordance with the Contract Documents and any health or safety 12 precautions required by such construction work. The Engineer and its personnel have no 13 authority to exercise any control over any construction contractor or other entity or their 14 employees in connection with their work or any health or safety precautions. 15 16 SIGNATURE PAGE TO FOLLOW 17 18       399 00 52 43 - 6 Agreement Page 6 of 6 CITY OF DENTON 7452 IFB – Denton Development Services STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Center Parking Lot Improvements Revised September 20, 2018 IN WITNESS WHEREOF, City and Contractor have each executed this Agreement to be effective 1 as of the date subscribed by the City’s designated City Manager (“Effective Date”). 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 ATTEST: 37 ROSA RIOS, CITY SECRETARY 38 39 40 _______________________________________ 41 42 43 APPROVED AS TO LEGAL FORM: 44 AARON LEAL, CITY ATTORNEY 45 46 _______________________________________ 47 CITY OF DENTON BY: ___________________________________ CITY MANAGER CONTRACTOR MSB CONSTRUCTORS, INC. BY: ___________________________________ AUTHORIZED AGENT _______________________________________ NAME _______________________________________ TITLE _______________________________________ PHONE NUMBER _______________________________________ EMAIL ADDRESS THIS AGREEMENT HAS BEEN BOTH REVIEWED AND APPROVED as to financial and operational obligations and business terms. _______________ ________________ SIGNATURE PRINTED NAME __________________________________ TITLE __________________________________ DEPARTMENT       # $! $%#&%!#$ ! #$ % # ##(    ' ( #%!#!"%#!%$%(  # "%#!%$  #  400       401       402       403       404       405       406 "General Decision Number: TX20200025 01/03/2020 Superseded General Decision Number: TX20190025 State: Texas Construction Type: Highway Counties: Archer, Callahan, Clay, Collin, Dallas, Delta, Denton, Ellis, Grayson, Hunt, Johnson, Jones, Kaufman, Parker, Rockwall, Tarrant and Wise Counties in Texas. HIGHWAY CONSTRUCTION PROJECTS (excluding tunnels, building structures in rest area projects & railroad construction; bascule, suspension & spandrel arch bridges designed for commercial navigation, bridges involving marine construction; and other major bridges). Note: Under Executive Order (EO) 13658, an hourly minimum wage of $10.80 for calendar year 2020 applies to all contracts subject to the Davis-Bacon Act for which the contract is awarded (and any solicitation was issued) on or after January 1, 2015. If this contract is covered by the EO, the contractor must pay all workers in any classification listed on this wage determination at least $10.80 per hour (or the applicable wage rate listed on this wage determination, if it is higher) for all hours spent performing on the contract in calendar year 2020. If this contract is covered by the EO and a classification considered necessary for performance of work on the contract does not appear on this wage determination, the contractor must pay workers in that classification at least the wage rate determined through the conformance process set forth in 29 CFR 5.5(a)(1)(ii) (or the EO minimum wage rate, if it is higher than the conformed wage rate). The EO minimum wage rate will be adjusted annually. Please note that this EO applies to the above-mentioned types of contracts entered into by the federal government that are subject       407 to the Davis-Bacon Act itself, but it does not apply to contracts subject only to the Davis-Bacon Related Acts, including those set forth at 29 CFR 5.1(a)(2)-(60). Additional information on contractor requirements and worker protections under the EO is available at www.dol.gov/whd/govcontracts. Modification Number Publication Date 0 01/03/2020 * SUTX2011-007 08/03/2011 Rates Fringes CONCRETE FINISHER (Paving and Structures)......................$ 14.12 ELECTRICIAN......................$ 19.80 FORM BUILDER/FORM SETTER Paving & Curb...............$ 13.16 Structures..................$ 13.84 LABORER Asphalt Raker...............$ 12.69 Flagger.....................$ 10.06 Laborer, Common.............$ 10.72 Laborer, Utility............$ 12.32 Pipelayer...................$ 13.24 Work Zone Barricade Servicer....................$ 11.68 POWER EQUIPMENT OPERATOR: Asphalt Distributor.........$ 15.32 Asphalt Paving Machine......$ 13.99 Broom or Sweeper............$ 11.74 Concrete Pavement Finishing Machine...........$ 16.05 Concrete Saw................$ 14.48 Crane Operator, Lattice Boom 80 Tons or Less........$ 17.27 Crane Operator, Lattice       408 Boom over 80 Tons...........$ 20.52 Crane, Hydraulic 80 Tons or Less.....................$ 18.12 Crawler Tractor.............$ 14.07 Excavator, 50,000 pounds or less.....................$ 17.19 Excavator, over 50,000 pounds......................$ 16.99 Foundation Drill , Truck Mounted.....................$ 21.07 Foundation Drill, Crawler Mounted.....................$ 17.99 Front End Loader 3 CY or Less........................$ 13.69 Front End Loader, over 3 CY.$ 14.72 Loader/Backhoe..............$ 15.18 Mechanic....................$ 17.68 Milling Machine.............$ 14.32 Motor Grader, Fine Grade....$ 17.19 Motor Grader, Rough.........$ 16.02 Pavement Marking Machine....$ 13.63 Reclaimer/Pulverizer........$ 11.01 Roller, Asphalt.............$ 13.08 Roller, Other...............$ 11.51 Scraper.....................$ 12.96 Small Slipform Machine......$ 15.96 Spreader Box................$ 14.73 Servicer.........................$ 14.58 Steel Worker (Reinforcing).......$ 16.18 TRUCK DRIVER Lowboy-Float................$ 16.24 Off Road Hauler.............$ 12.25 Single Axle.................$ 12.31 Single or Tandem Axle Dump Truck.......................$ 12.62 Tandem Axle Tractor with Semi Trailer................$ 12.86 Transit-Mix.................$ 14.14 WELDER...........................$ 14.84 ----------------------------------------------------------------       409 WELDERS - Receive rate prescribed for craft performing operation to which welding is incidental. ================================================================ Note: Executive Order (EO) 13706, Establishing Paid Sick Leave for Federal Contractors applies to all contracts subject to the Davis-Bacon Act for which the contract is awarded (and any solicitation was issued) on or after January 1, 2017. If this contract is covered by the EO, the contractor must provide employees with 1 hour of paid sick leave for every 30 hours they work, up to 56 hours of paid sick leave each year. Employees must be permitted to use paid sick leave for their own illness, injury or other health-related needs, including preventive care; to assist a family member (or person who is like family to the employee) who is ill, injured, or has other health-related needs, including preventive care; or for reasons resulting from, or to assist a family member (or person who is like family to the employee) who is a victim of, domestic violence, sexual assault, or stalking. Additional information on contractor requirements and worker protections under the EO is available at www.dol.gov/whd/govcontracts. Unlisted classifications needed for work not included within the scope of the classifications listed may be added after award only as provided in the labor standards contract clauses (29CFR 5.5 (a) (1) (ii)). ---------------------------------------------------------------- The body of each wage determination lists the classification and wage rates that have been found to be prevailing for the cited type(s) of construction in the area covered by the wage determination. The classifications are listed in alphabetical order of ""identifiers"" that indicate whether the particular rate is a union rate (current union negotiated rate for local), a survey rate (weighted average rate) or a union average rate (weighted union average rate). Union Rate Identifiers A four letter classification abbreviation identifier enclosed in dotted lines beginning with characters other than ""SU"" or       410 ""UAVG"" denotes that the union classification and rate were prevailing for that classification in the survey. Example: PLUM0198-005 07/01/2014. PLUM is an abbreviation identifier of the union which prevailed in the survey for this classification, which in this example would be Plumbers. 0198 indicates the local union number or district council number where applicable, i.e., Plumbers Local 0198. The next number, 005 in the example, is an internal number used in processing the wage determination. 07/01/2014 is the effective date of the most current negotiated rate, which in this example is July 1, 2014. Union prevailing wage rates are updated to reflect all rate changes in the collective bargaining agreement (CBA) governing this classification and rate. Survey Rate Identifiers Classifications listed under the ""SU"" identifier indicate that no one rate prevailed for this classification in the survey and the published rate is derived by computing a weighted average rate based on all the rates reported in the survey for that classification. As this weighted average rate includes all rates reported in the survey, it may include both union and non-union rates. Example: SULA2012-007 5/13/2014. SU indicates the rates are survey rates based on a weighted average calculation of rates and are not majority rates. LA indicates the State of Louisiana. 2012 is the year of survey on which these classifications and rates are based. The next number, 007 in the example, is an internal number used in producing the wage determination. 5/13/2014 indicates the survey completion date for the classifications and rates under that identifier. Survey wage rates are not updated and remain in effect until a new survey is conducted. Union Average Rate Identifiers Classification(s) listed under the UAVG identifier indicate that no single majority rate prevailed for those classifications; however, 100% of the data reported for the classifications was union data. EXAMPLE: UAVG-OH-0010 08/29/2014. UAVG indicates that the rate is a weighted union average rate. OH indicates the state. The next number, 0010 in the example, is an internal number used in producing the wage       411 determination. 08/29/2014 indicates the survey completion date for the classifications and rates under that identifier. A UAVG rate will be updated once a year, usually in January of each year, to reflect a weighted average of the current negotiated/CBA rate of the union locals from which the rate is based. ---------------------------------------------------------------- WAGE DETERMINATION APPEALS PROCESS 1.) Has there been an initial decision in the matter? This can be: * an existing published wage determination * a survey underlying a wage determination * a Wage and Hour Division letter setting forth a position on a wage determination matter * a conformance (additional classification and rate) ruling On survey related matters, initial contact, including requests for summaries of surveys, should be with the Wage and Hour Regional Office for the area in which the survey was conducted because those Regional Offices have responsibility for the Davis-Bacon survey program. If the response from this initial contact is not satisfactory, then the process described in 2.) and 3.) should be followed. With regard to any other matter not yet ripe for the formal process described here, initial contact should be with the Branch of Construction Wage Determinations. Write to: Branch of Construction Wage Determinations Wage and Hour Division U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 2.) If the answer to the question in 1.) is yes, then an interested party (those affected by the action) can request review and reconsideration from the Wage and Hour Administrator (See 29 CFR Part 1.8 and 29 CFR Part 7). Write to:       412 Wage and Hour Administrator U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 The request should be accompanied by a full statement of the interested party's position and by any information (wage payment data, project description, area practice material, etc.) that the requestor considers relevant to the issue. 3.) If the decision of the Administrator is not favorable, an interested party may appeal directly to the Administrative Review Board (formerly the Wage Appeals Board). Write to: Administrative Review Board U.S. Department of Labor 200 Constitution Avenue, N.W. Washington, DC 20210 4.) All decisions by the Administrative Review Board are final. ================================================================ END OF GENERAL DECISION "       413       414     &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 67$1'$5'*(1(5$/&21',7,2162)7+( &216758&7,21&2175$&7  7$%/(2)&217(176  3DJH  $UWLFOH±'HILQLWLRQVDQG7HUPLQRORJ\  'HILQHG7HUPV  7HUPLQRORJ\  $UWLFOH±3UHOLPLQDU\0DWWHUV  &RSLHVRI'RFXPHQWV  &RPPHQFHPHQWRI&RQWUDFW7LPH1RWLFHWR3URFHHG  6WDUWLQJWKH:RUN  %HIRUH6WDUWLQJ&RQVWUXFWLRQ  3UHFRQVWUXFWLRQ&RQIHUHQFH  3XEOLF0HHWLQJ  ,QLWLDO$FFHSWDQFHRI6FKHGXOHV  (OHFWURQLF6XEPLWWDOV  $UWLFOH±&RQWUDFW'RFXPHQWV,QWHQW$PHQGLQJ5HXVH  ,QWHQW  5HIHUHQFH6WDQGDUGV  5HSRUWLQJDQG5HVROYLQJ'LVFUHSDQFLHV  $PHQGLQJDQG6XSSOHPHQWLQJ&RQWUDFW'RFXPHQWV  5HXVHRI'RFXPHQWV  (OHFWURQLF'DWD  $UWLFOH±$YDLODELOLW\RI/DQGV6XEVXUIDFHDQG3K\VLFDO&RQGLWLRQV+D]DUGRXV(QYLURQPHQWDO &RQGLWLRQV5HIHUHQFH3RLQWV  $YDLODELOLW\RI/DQGV  6XEVXUIDFHDQG3K\VLFDO&RQGLWLRQV  'LIIHULQJ6XEVXUIDFHRU3K\VLFDO&RQGLWLRQV  8QGHUJURXQG)DFLOLWLHV  +D]DUGRXV(QYLURQPHQWDO&RQGLWLRQDW6LWH  $UWLFOH±%RQGVDQG,QVXUDQFH  /LFHQVHG6XUHWLHVDQG,QVXUHUV  3HUIRUPDQFH3D\PHQWDQG0DLQWHQDQFH%RQGV  &HUWLILFDWHVRI,QVXUDQFH  &RQWUDFWRU¶V,QVXUDQFH  $FFHSWDQFHRI%RQGVDQG,QVXUDQFH2SWLRQWR5HSODFH  $UWLFOH±&RQWUDFWRU¶V5HVSRQVLELOLWLHV  6XSHUYLVLRQDQG6XSHULQWHQGHQFH       415     &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  /DERU:RUNLQJ+RXUV  6HUYLFHV0DWHULDOVDQG(TXLSPHQW  3URMHFW6FKHGXOH  6XEVWLWXWHVDQG³2U(TXDOV´  &RQFHUQLQJ6XEFRQWUDFWRUV6XSSOLHUVDQG2WKHUV  :DJH5DWHV  3DWHQW)HHVDQG5R\DOWLHV  3HUPLWVDQG8WLOLWLHV  /DZVDQG5HJXODWLRQV  7D[HV  8VHRI6LWHDQG2WKHU$UHDV  5HFRUG'RFXPHQWV  6DIHW\DQG3URWHFWLRQ  6DIHW\5HSUHVHQWDWLYH  +D]DUG&RPPXQLFDWLRQ3URJUDPV  (PHUJHQFLHVDQGRU5HFWLILFDWLRQ  6XEPLWWDOV  &RQWLQXLQJWKH:RUN  &RQWUDFWRU¶V*HQHUDO:DUUDQW\DQG*XDUDQWHH ,QGHPQLILFDWLRQ  'HOHJDWLRQRI3URIHVVLRQDO'HVLJQ6HUYLFHV  5LJKWWR$XGLW  1RQGLVFULPLQDWLRQ  $UWLFOH±2WKHU:RUNDWWKH6LWH  5HODWHG:RUNDW6LWH  &RRUGLQDWLRQ  $UWLFOH±&LW\¶V5HVSRQVLELOLWLHV  &RPPXQLFDWLRQVWR&RQWUDFWRU  )XUQLVK'DWD  3D\:KHQ'XH  /DQGVDQG(DVHPHQWV5HSRUWVDQG7HVWV  &KDQJH2UGHUV  ,QVSHFWLRQV7HVWVDQG$SSURYDOV  /LPLWDWLRQVRQ&LW\¶V5HVSRQVLELOLWLHV  8QGLVFORVHG+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQ  &RPSOLDQFHZLWK6DIHW\3URJUDP  $UWLFOH±&LW\¶V2EVHUYDWLRQ6WDWXV'XULQJ&RQVWUXFWLRQ  &LW\¶V3URMHFW0DQDJHU««  9LVLWVWR6LWH  $XWKRUL]HG9DULDWLRQVLQ:RUN  5HMHFWLQJ'HIHFWLYH:RUN  'HWHUPLQDWLRQVIRU:RUN3HUIRUPHG  'HFLVLRQVRQ5HTXLUHPHQWVRI&RQWUDFW'RFXPHQWVDQG$FFHSWDELOLW\RI:RUN       416     &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 $UWLFOH±&KDQJHVLQWKH:RUN&ODLPV([WUD:RUN $XWKRUL]HG&KDQJHVLQWKH:RUN 8QDXWKRUL]HG&KDQJHVLQWKH:RUN ([HFXWLRQRI&KDQJH2UGHUV ([WUD:RUN 1RWLILFDWLRQWR6XUHW\ &RQWUDFW&ODLPV3URFHVV  $UWLFOH±&RVWRIWKH:RUN$OORZDQFHV8QLW3ULFH:RUN3ODQV4XDQWLW\0HDVXUHPHQW &RVWRIWKH:RUN $OORZDQFHV 8QLW3ULFH:RUN 3ODQV4XDQWLW\0HDVXUHPHQW  $UWLFOH±&KDQJHRI&RQWUDFW3ULFH&KDQJHRI&RQWUDFW7LPH &KDQJHRI&RQWUDFW3ULFH &KDQJHRI&RQWUDFW7LPH 'HOD\V  $UWLFOH±7HVWVDQG,QVSHFWLRQV&RUUHFWLRQ5HPRYDORU$FFHSWDQFHRI'HIHFWLYH:RUN 1RWLFHRI'HIHFWV $FFHVVWR:RUN 7HVWVDQG,QVSHFWLRQV 8QFRYHULQJ:RUN &LW\0D\6WRSWKH:RUN &RUUHFWLRQRU5HPRYDORI'HIHFWLYH:RUN &RUUHFWLRQ3HULRG $FFHSWDQFHRI'HIHFWLYH:RUN &LW\0D\&RUUHFW'HIHFWLYH:RUN  $UWLFOH±3D\PHQWVWR&RQWUDFWRUDQG&RPSOHWLRQ 6FKHGXOHRI9DOXHV 3URJUHVV3D\PHQWV &RQWUDFWRU¶V:DUUDQW\RI7LWOH 3DUWLDO8WLOL]DWLRQ )LQDO,QVSHFWLRQ )LQDO$FFHSWDQFH )LQDO3D\PHQW )LQDO&RPSOHWLRQ'HOD\HGDQG3DUWLDO5HWDLQDJH5HOHDVH :DLYHURI&ODLPV  $UWLFOH±6XVSHQVLRQRI:RUNDQG7HUPLQDWLRQ &LW\0D\6XVSHQG:RUN &LW\0D\7HUPLQDWHIRU&DXVH &LW\0D\7HUPLQDWH)RU&RQYHQLHQFH        417     &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 $UWLFOH±'LVSXWH5HVROXWLRQ 0HWKRGVDQG3URFHGXUHV $UWLFOH±0LVFHOODQHRXV *LYLQJ1RWLFH &RPSXWDWLRQRI7LPHV &XPXODWLYH5HPHGLHV 6XUYLYDORI2EOLJDWLRQV +HDGLQJV       418   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  $57,&/(±'(),1,7,216$1'7(50,12/2*<  Defined Terms  $:KHUHYHUXVHGLQWKHVH*HQHUDO&RQGLWLRQVRULQRWKHU&RQWUDFW'RFXPHQWVWKHWHUPVOLVWHG EHORZKDYHWKHPHDQLQJVLQGLFDWHGZKLFKDUHDSSOLFDEOHWRERWKWKHVLQJXODUDQGSOXUDOWKHUHRI DQGZRUGVGHQRWLQJJHQGHUVKDOOLQFOXGHWKHPDVFXOLQHIHPLQLQHDQGQHXWHU6DLGWHUPVDUH JHQHUDOO\FDSLWDOL]HGRUZULWWHQLQLWDOLFVEXWQRWDOZD\V:KHQXVHGLQDFRQWH[WFRQVLVWHQWZLWK WKHGHILQLWLRQRIDOLVWHGGHILQHGWHUPWKHWHUPVKDOOKDYHDPHDQLQJDVGHILQHGEHORZZKHWKHU FDSLWDOL]HGRULWDOLFL]HGRURWKHUZLVH,QDGGLWLRQWRWHUPVVSHFLILFDOO\GHILQHGWHUPVZLWKLQLWLDO FDSLWDOOHWWHUVLQWKH&RQWUDFW'RFXPHQWVLQFOXGHUHIHUHQFHVWRLGHQWLILHGDUWLFOHVDQGSDUDJUDSKV DQGWKHWLWOHVRIRWKHUGRFXPHQWVRUIRUPV  Addenda—:ULWWHQRUJUDSKLFLQVWUXPHQWVLVVXHGSULRUWRWKHRSHQLQJRI%LGVZKLFKFODULI\ FRUUHFWRUFKDQJHWKH%LGGLQJ5HTXLUHPHQWVRUWKHSURSRVHG&RQWUDFW'RFXPHQWV  Agreement—7KHZULWWHQLQVWUXPHQWZKLFKLVHYLGHQFHRIWKHDJUHHPHQWEHWZHHQ&LW\DQG &RQWUDFWRUFRYHULQJWKH:RUN  Application for Payment—7KHIRUPDFFHSWDEOHWR&LW\ZKLFKLVWREHXVHGE\&RQWUDFWRU GXULQJWKHFRXUVHRIWKH:RUNLQUHTXHVWLQJSURJUHVVRUILQDOSD\PHQWVDQGZKLFKLVWREH DFFRPSDQLHGE\VXFKVXSSRUWLQJGRFXPHQWDWLRQDVLVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV  Asbestos—$Q\PDWHULDOWKDWFRQWDLQVPRUHWKDQRQHSHUFHQWDVEHVWRVDQGLVIULDEOHRULV UHOHDVLQJDVEHVWRVILEHUVLQWRWKHDLUDERYHFXUUHQWDFWLRQOHYHOVHVWDEOLVKHGE\WKH8QLWHG 6WDWHV2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ  Award ±$XWKRUL]DWLRQE\WKH&LW\&RXQFLOIRUWKH&LW\WRHQWHULQWRDQ$JUHHPHQW  Bid—7KHRIIHURUSURSRVDORID%LGGHUVXEPLWWHGRQWKHSUHVFULEHGIRUPVHWWLQJIRUWKWKH SULFHVIRUWKH:RUNWREHSHUIRUPHG  Bidder—7KHLQGLYLGXDORUHQWLW\ZKRVXEPLWVD%LGGLUHFWO\WR&LW\  Bidding Documents—7KH%LGGLQJ5HTXLUHPHQWVDQGWKH SURSRVHG &RQWUDFW 'RFXPHQWV LQFOXGLQJDOO$GGHQGD   Bidding Requirements—7KHDGYHUWLVHPHQWRU,QYLWDWLRQWR%LG,QVWUXFWLRQVWR%LGGHUV%LG VHFXULW\RIDFFHSWDEOHIRUPLIDQ\DQGWKH%LG)RUPZLWKDQ\VXSSOHPHQWV  Business Day – $EXVLQHVVGD\LVGHILQHGDVDGD\WKDWWKH&LW\FRQGXFWVQRUPDOEXVLQHVV JHQHUDOO\0RQGD\WKURXJK)ULGD\H[FHSWIRUIHGHUDORUVWDWHKROLGD\VREVHUYHGE\WKH&LW\  Calendar Day ±$GD\FRQVLVWLQJRIKRXUVPHDVXUHGIURPPLGQLJKWWRWKHQH[WPLGQLJKW       419   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  Change Order—$GRFXPHQWZKLFKLVSUHSDUHGDQGDSSURYHGE\WKH&LW\ZKLFKLVVLJQHG E\&RQWUDFWRUDQG&LW\DQGDXWKRUL]HVDQDGGLWLRQGHOHWLRQRUUHYLVLRQLQWKH:RUNRUDQ DGMXVWPHQWLQWKH&RQWUDFW3ULFHRUWKH&RQWUDFW7LPHLVVXHGRQRUDIWHUWKH(IIHFWLYH'DWH RIWKH$JUHHPHQW  City— 7KH&LW\RI'HQWRQLVD7H[DVKRPHUXOHPXQLFLSDOFRUSRUDWLRQDFWLQJE\LWV&LW\ &RXQFLOWKURXJKLWV&LW\0DQDJHURUKLVGHVLJQHH  City Attorney ±7KHRIILFLDOO\DSSRLQWHG&LW\$WWRUQH\RIWKH&LW\RI'HQWRQ7H[DVRUKLV GXO\DXWKRUL]HGUHSUHVHQWDWLYH  City Council  7KH GXO\ HOHFWHG DQG TXDOLILHG JRYHUQLQJ ERG\ RI WKH &LW\ RI'HQWRQ 7H[DV  City Manager ±7KHRIILFLDOO\DSSRLQWHGDQGDXWKRUL]HG&LW\0DQDJHURIWKH&LW\RI 'HQWRQ7H[DVRUKLVGXO\DXWKRUL]HGUHSUHVHQWDWLYH  Contract Claim—$GHPDQGRUDVVHUWLRQE\&LW\RU&RQWUDFWRUVHHNLQJDQDGMXVWPHQWRI &RQWUDFW3ULFHRU&RQWUDFW7LPHRUERWKRURWKHUUHOLHIZLWKUHVSHFWWRWKHWHUPVRIWKH &RQWUDFW$GHPDQGIRUPRQH\RUVHUYLFHVE\DWKLUGSDUW\LVQRWD&RQWUDFW&ODLP  Contract—7KH HQWLUH DQG LQWHJUDWHG ZULWWHQ GRFXPHQW EHWZHHQ WKH &LW\ DQG &RQWUDFWRU FRQFHUQLQJWKH:RUN7KH&RQWUDFWFRQWDLQVWKH$JUHHPHQWDQGDOO&RQWUDFW'RFXPHQWVDQG VXSHUVHGHVSULRUQHJRWLDWLRQVUHSUHVHQWDWLRQVRUDJUHHPHQWVZKHWKHUZULWWHQRURUDO  Contract Documents—7KRVHLWHPVVRGHVLJQDWHGLQWKH$JUHHPHQW$OOLWHPVOLVWHGLQWKH $JUHHPHQWDUH&RQWUDFW'RFXPHQWV$SSURYHG6XEPLWWDOVRWKHU&RQWUDFWRUVXEPLWWDOVDQG WKHUHSRUWVDQGGUDZLQJVRIVXEVXUIDFHDQGSK\VLFDOFRQGLWLRQVDUHQRW&RQWUDFW'RFXPHQWV  Contract Price—7KHPRQH\VSD\DEOHE\&LW\WR&RQWUDFWRUIRUFRPSOHWLRQRIWKH:RUNLQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV DV VWDWHG LQ WKH $JUHHPHQW VXEMHFW WR WKH SURYLVLRQVRI3DUDJUDSKLQWKHFDVHRI8QLW3ULFH:RUN   Contract Time—7KHQXPEHURIGD\VRUWKHGDWHVVWDWHGLQWKH$JUHHPHQWWR L DFKLHYH 0LOHVWRQHVLIDQ\DQG LL FRPSOHWHWKH:RUNVRWKDWLWLVUHDG\IRU)LQDO$FFHSWDQFH  Contractor—7KHLQGLYLGXDORUHQWLW\ZLWKZKRP&LW\KDVHQWHUHGLQWRWKH$JUHHPHQW  Cost of the Work—6HH3DUDJUDSKRIWKHVH*HQHUDO&RQGLWLRQVIRUGHILQLWLRQ       420   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  Damage Claims – $GHPDQGIRUPRQH\RUVHUYLFHVDULVLQJIURPWKH3URMHFWRU6LWHIURPD WKLUGSDUW\&LW\RU&RQWUDFWRUH[FOXVLYHRID&RQWUDFW&ODLP  Day RUGD\±$GD\XQOHVVRWKHUZLVHGHILQHGVKDOOPHDQD&DOHQGDU'D\  Drawings—7KDWSDUWRIWKH&RQWUDFW'RFXPHQWVSUHSDUHGRUDSSURYHGE\(QJLQHHUZKLFK JUDSKLFDOO\ VKRZV WKH VFRSH H[WHQW DQG FKDUDFWHU RI WKH :RUNWR EH SHUIRUPHG E\ &RQWUDFWRU6XEPLWWDOVDUHQRW'UDZLQJVDVVRGHILQHG  Effective Date of the Agreement—7KHGDWHLQGLFDWHGLQWKH$JUHHPHQWRQZKLFKLWEHFRPHV HIIHFWLYHEXWLIQRVXFKGDWHLVLQGLFDWHGLWPHDQVWKHGDWHRQZKLFKWKH$JUHHPHQWLVVLJQHG DQGGHOLYHUHGE\WKHODVWRIWKHWZRSDUWLHVWRVLJQDQGGHOLYHU  Engineer—7KHOLFHQVHGSURIHVVLRQDOHQJLQHHURUHQJLQHHULQJILUPUHJLVWHUHGLQWKH6WDWHRI 7H[DVSHUIRUPLQJSURIHVVLRQDOVHUYLFHVIRUWKH&LW\  Extra Work – $GGLWLRQDOZRUNPDGHQHFHVVDU\E\FKDQJHVRUDOWHUDWLRQVRIWKH&RQWUDFW 'RFXPHQWV RU TXDQWLWLHV RU IRU RWKHU UHDVRQV IRU ZKLFK QR SULFHV DUH SURYLGHG LQ WKH &RQWUDFW'RFXPHQWV([WUDZRUNVKDOOEHSDUWRIWKH:RUN  Field Order — $ZULWWHQRUGHULVVXHGE\&LW\ZKLFKUHTXLUHVFKDQJHVLQWKH:RUNEXW ZKLFKGRHVQRWLQYROYHDFKDQJHLQWKH&RQWUDFW3ULFH&RQWUDFW7LPHRUWKHLQWHQWRIWKH (QJLQHHU  Final Acceptance – 7KHZULWWHQQRWLFHJLYHQE\WKH&LW\WRWKH&RQWUDFWRUWKDWWKH:RUN VSHFLILHGLQWKH&RQWUDFW'RFXPHQWVKDVEHHQFRPSOHWHGWRWKHVDWLVIDFWLRQRIWKH&LW\  Final Inspection – ,QVSHFWLRQ FDUULHG RXW E\ WKH &LW\ WR YHULI\ WKDW WKH &RQWUDFWRU KDV FRPSOHWHGWKH:RUNDQGHDFKDQGHYHU\SDUWRUDSSXUWHQDQFHWKHUHRIIXOO\HQWLUHO\DQGLQ FRQIRUPDQFHZLWKWKH&RQWUDFW'RFXPHQWV  General Requirements—6HFWLRQVRI'LYLVLRQRIWKH&RQWUDFW'RFXPHQWV  Hazardous Environmental Condition — 7KH SUHVHQFH DW WKH 6LWH RI $VEHVWRV 3&%V 3HWUROHXP+D]DUGRXV:DVWH5DGLRDFWLYH0DWHULDORURWKHUPDWHULDOVLQVXFKTXDQWLWLHVRU FLUFXPVWDQFHVWKDWPD\SUHVHQWDVXEVWDQWLDOGDQJHUWRSHUVRQVRUSURSHUW\H[SRVHGWKHUHWR  Hazardous Waste—+D]DUGRXVZDVWHLVGHILQHGDVDQ\VROLGZDVWHOLVWHGDVKD]DUGRXVRU SRVVHVVHVRQHRUPRUHKD]DUGRXVFKDUDFWHULVWLFVDVGHILQHGLQWKHIHGHUDOZDVWHUHJXODWLRQV DVDPHQGHGIURPWLPHWRWLPH  Incidental – :RUNLWHPVWKDWWKH&RQWUDFWRULVQRWSDLGIRUGLUHFWO\EXWFRVWVIRUZKLFKDUH LQFOXGHGXQGHUWKHYDULRXVELGLWHPVRIWKH3URMHFW        421   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Laws and Regulations—$Q\DQGDOODSSOLFDEOHODZVUXOHVUHJXODWLRQVRUGLQDQFHVFRGHV DQG RUGHUV RI DQ\ DQG DOO JRYHUQPHQWDO ERGLHV DJHQFLHV DXWKRULWLHV DQG FRXUWV KDYLQJ MXULVGLFWLRQ  Liens—&KDUJHVVHFXULW\LQWHUHVWVRUHQFXPEUDQFHVXSRQ3URMHFWIXQGVUHDOSURSHUW\RU SHUVRQDOSURSHUW\  Major Item – $Q,WHPRIZRUNLQFOXGHGLQWKH&RQWUDFW'RFXPHQWVWKDWKDVDWRWDOFRVWHTXDO WRRUJUHDWHUWKDQRIWKHRULJLQDO&RQWUDFW3ULFHRUZKLFKHYHULVOHVV  Milestone—$SULQFLSDOHYHQWVSHFLILHGLQWKH&RQWUDFW'RFXPHQWVUHODWLQJWRDQLQWHUPHGLDWH &RQWUDFW7LPHSULRUWR)LQDO$FFHSWDQFHRIWKH:RUN  Notice of Award—7KHZULWWHQQRWLFHE\&LW\WRWKH6XFFHVVIXO%LGGHUVWDWLQJWKDWXSRQ WLPHO\FRPSOLDQFHE\WKH6XFFHVVIXO%LGGHUZLWKWKHFRQGLWLRQVSUHFHGHQWOLVWHGWKHUHLQ&LW\ ZLOOVLJQDQGGHOLYHUWKH$JUHHPHQW  Notice to Proceed—$ZULWWHQQRWLFHJLYHQE\&LW\WR&RQWUDFWRUIL[LQJWKHGDWHRQZKLFKWKH &RQWUDFW7LPHZLOOFRPPHQFHWRUXQDQGRQZKLFK&RQWUDFWRUVKDOOVWDUWWRSHUIRUPWKH :RUNVSHFLILHGLQ&RQWUDFW'RFXPHQWV  PCBs—3RO\FKORULQDWHGELSKHQ\OV  Petroleum—3HWUROHXPLQFOXGLQJFUXGHRLORUDQ\IUDFWLRQWKHUHRIZKLFKLVOLTXLGDWVWDQGDUG FRQGLWLRQVRIWHPSHUDWXUHDQGSUHVVXUH GHJUHHV)DKUHQKHLWDQGSRXQGVSHUVTXDUH LQFKDEVROXWH VXFKDVRLOSHWUROHXPIXHORLORLOVOXGJHRLOUHIXVHJDVROLQHNHURVHQHDQG RLOPL[HGZLWKRWKHUQRQ+D]DUGRXV:DVWHDQGFUXGHRLOV  Plans – 6HHGHILQLWLRQRI'UDZLQJV  Project Schedule—$VFKHGXOHSUHSDUHGDQGPDLQWDLQHGE\&RQWUDFWRULQDFFRUGDQFHZLWK WKH*HQHUDO5HTXLUHPHQWVGHVFULELQJWKHVHTXHQFHDQGGXUDWLRQRIWKHDFWLYLWLHVFRPSULVLQJ WKH&RQWUDFWRU¶VSODQWRDFFRPSOLVKWKH:RUNZLWKLQWKH&RQWUDFW7LPH  Project—7KH:RUNWREHSHUIRUPHGXQGHUWKH&RQWUDFW'RFXPHQWV  Project Manager —7KHDXWKRUL]HGUHSUHVHQWDWLYHRIWKH&LW\ZKRZLOOEHDVVLJQHGWRWKH 3URMHFW  Project Manual ± 7KH GRFXPHQWDU\ LQIRUPDWLRQ SUHSDUHG IRU ELGGLQJ DQG IXUQLVKLQJ WKH :RUN$OLVWLQJRIWKHFRQWHQWVRIWKH3URMHFW0DQXDOLVFRQWDLQHGLQLWV7DEOHRI&RQWHQWV  Public Meeting – $QDQQRXQFHGPHHWLQJFRQGXFWHGE\WKH&LW\WRIDFLOLWDWHSXEOLF SDUWLFLSDWLRQDQGWRDVVLVWWKHSXEOLFLQJDLQLQJDQLQIRUPHGYLHZRIWKH3URMHFW        422   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Radioactive Material—6RXUFH VSHFLDO QXFOHDU RU E\SURGXFW PDWHULDO DV GHILQHG E\ WKH $WRPLF(QHUJ\$FWRI 86&6HFWLRQHWVHT DVDPHQGHGIURPWLPHWRWLPH  Regular Working Hours – ([FOXGLQJOHJDOKROLGD\VUHJXODUZRUNLQJKRXUVVKDOOEH0RQGD\ WKUX)ULGD\EHWZHHQDPDQGSPIURP-XQHWR6HSWHPEHUDQGEHWZHHQ DPDQGSPIURP2FWREHUWR0D\  Samples—3K\VLFDOH[DPSOHVRIPDWHULDOVHTXLSPHQWRUZRUNPDQVKLSWKDWDUH UHSUHVHQWDWLYHRIVRPHSRUWLRQRIWKH:RUNDQGZKLFKHVWDEOLVKWKHVWDQGDUGVE\ZKLFKVXFK SRUWLRQRIWKH:RUNZLOOEHMXGJHG  Schedule of Submittals—$VFKHGXOHSUHSDUHGDQGPDLQWDLQHGE\&RQWUDFWRURIUHTXLUHG VXEPLWWDOV DQG WKH WLPH UHTXLUHPHQWV WR VXSSRUW VFKHGXOHG SHUIRUPDQFH RI UHODWHG FRQVWUXFWLRQDFWLYLWLHV  Schedule of Values—$VFKHGXOHSUHSDUHGDQGPDLQWDLQHGE\&RQWUDFWRUDOORFDWLQJSRUWLRQV RIWKH&RQWUDFW3ULFHWRYDULRXVSRUWLRQVRIWKH:RUNDQGXVHGDVWKHEDVLVIRUUHYLHZLQJ &RQWUDFWRU¶V$SSOLFDWLRQVIRU3D\PHQW  Site—/DQGVRUDUHDVLQGLFDWHGLQWKH&RQWUDFW'RFXPHQWVDVEHLQJIXUQLVKHGE\&LW\XSRQ ZKLFKWKH:RUNLVWREHSHUIRUPHGLQFOXGLQJULJKWVRIZD\SHUPLWVDQGHDVHPHQWVIRU DFFHVVWKHUHWRDQGVXFKRWKHUODQGVIXUQLVKHGE\&LW\ZKLFKDUHGHVLJQDWHGIRUWKHXVHRI &RQWUDFWRU  Specifications—7KDWSDUWRIWKH&RQWUDFW'RFXPHQWVFRQVLVWLQJRIZULWWHQUHTXLUHPHQWVIRU PDWHULDOV HTXLSPHQW V\VWHPV VWDQGDUGV DQG ZRUNPDQVKLS DV DSSOLHG WR WKH :RUN DQG FHUWDLQDGPLQLVWUDWLYHUHTXLUHPHQWVDQGSURFHGXUDOPDWWHUVDSSOLFDEOHWKHUHWR6SHFLILFDWLRQV PD\EHVSHFLILFDOO\PDGHDSDUWRIWKH&RQWUDFW'RFXPHQWVE\DWWDFKPHQWRULIQRWDWWDFKHG PD\EHLQFRUSRUDWHGE\UHIHUHQFHDVLQGLFDWHGLQWKH7DEOHRI&RQWHQWV 'LYLVLRQ  RIHDFK3URMHFW  Subcontractor—$QLQGLYLGXDORUHQWLW\KDYLQJDGLUHFWFRQWUDFWZLWK&RQWUDFWRURUZLWKDQ\ RWKHU6XEFRQWUDFWRUIRUWKHSHUIRUPDQFHRIDSDUWRIWKH:RUNDWWKH6LWH  Submittals—$OOGUDZLQJVGLDJUDPVLOOXVWUDWLRQVVFKHGXOHVDQGRWKHUGDWDRULQIRUPDWLRQ ZKLFK DUH VSHFLILFDOO\ SUHSDUHG RU DVVHPEOHG E\ RU IRU &RQWUDFWRU DQG VXEPLWWHG E\ &RQWUDFWRUWRLOOXVWUDWHVRPHSRUWLRQRIWKH:RUN  Subsidiary – 6HHGHILQLWLRQRI,QFLGHQWDO  Successful Bidder—7KH%LGGHUVXEPLWWLQJWKHORZHVWDQGPRVWUHVSRQVLYH%LGWRZKRP&LW\ PDNHVDQ$ZDUG  Superintendent – 7KHUHSUHVHQWDWLYHRIWKH&RQWUDFWRUZKRLVDYDLODEOHDWDOOWLPHVDQGDEOH WRUHFHLYHLQVWUXFWLRQVIURPWKH&LW\DQGWRDFWIRUWKH&RQWUDFWRU        423   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Supplementary Conditions—7KDW SDUW RI WKH &RQWUDFW 'RFXPHQWV ZKLFK DPHQGV RU VXSSOHPHQWVWKHVH*HQHUDO&RQGLWLRQV  Supplier—$PDQXIDFWXUHUIDEULFDWRUVXSSOLHUGLVWULEXWRUPDWHULDOPDQRUYHQGRUKDYLQJD GLUHFWFRQWUDFWZLWK&RQWUDFWRURUZLWKDQ\6XEFRQWUDFWRUWRIXUQLVKPDWHULDOVRUHTXLSPHQW WREHLQFRUSRUDWHGLQWKH:RUNE\&RQWUDFWRURU6XEFRQWUDFWRU  Underground Facilities—$OOXQGHUJURXQGSLSHOLQHVFRQGXLWVGXFWVFDEOHVZLUHV PDQKROHVYDXOWVWDQNVWXQQHOVRURWKHUVXFKIDFLOLWLHVRUDWWDFKPHQWVDQGDQ\HQFDVHPHQWV FRQWDLQLQJVXFKIDFLOLWLHVLQFOXGLQJEXWQRWOLPLWHGWRWKRVHWKDWFRQYH\HOHFWULFLW\JDVHV VWHDPOLTXLGSHWUROHXPSURGXFWVWHOHSKRQHRURWKHUFRPPXQLFDWLRQVFDEOHWHOHYLVLRQ ZDWHUZDVWHZDWHUVWRUPZDWHURWKHUOLTXLGVRUFKHPLFDOVRUWUDIILFRURWKHUFRQWUROV\VWHPV  Unit Price Work—6HH3DUDJUDSKRIWKHVH*HQHUDO&RQGLWLRQVIRUGHILQLWLRQ  Weekend Working Hours – +RXUVEHWZHHQDPDQGSP6DWXUGD\DQGEHWZHHQ SPDQGSP6XQGD\RUOHJDOKROLGD\DVDSSURYHGLQDGYDQFHE\WKH&LW\  Work—7KHHQWLUHFRQVWUXFWLRQRUWKHYDULRXVVHSDUDWHO\LGHQWLILDEOHSDUWVWKHUHRIUHTXLUHGWR EHSURYLGHGXQGHUWKH&RQWUDFW'RFXPHQWV:RUNLQFOXGHVDQGLVWKHUHVXOWRISHUIRUPLQJRU SURYLGLQJ DOO ODERU VHUYLFHV DQG GRFXPHQWDWLRQ QHFHVVDU\ WR SURGXFH VXFK FRQVWUXFWLRQ LQFOXGLQJDQ\&KDQJH2UGHURU)LHOG2UGHUDQGIXUQLVKLQJLQVWDOOLQJDQGLQFRUSRUDWLQJDOO PDWHULDOVDQGHTXLSPHQWLQWRVXFKFRQVWUXFWLRQDOODVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV  Working Day ±$ZRUNLQJGD\LVGHILQHGDVDGD\QRWLQFOXGLQJ6DWXUGD\V6XQGD\VRUOHJDO KROLGD\VDXWKRUL]HGE\WKH&LW\IRUFRQWUDFWSXUSRVHVLQZKLFKZHDWKHURURWKHUFRQGLWLRQV QRWXQGHUWKHFRQWURORIWKH&RQWUDFWRUZLOOSHUPLWWKHSHUIRUPDQFHRIWKHSULQFLSDOXQLWRI ZRUNXQGHUZD\IRUDFRQWLQXRXVSHULRGRIQRWOHVVWKDQKRXUVEHWZHHQDPDQGSP  Terminology  $7KHZRUGVDQGWHUPVGLVFXVVHGLQ3DUDJUDSK%WKURXJK(DUHQRWGHILQHGEXWZKHQXVHGLQ WKH%LGGLQJ5HTXLUHPHQWVRU&RQWUDFW'RFXPHQWVKDYHWKHLQGLFDWHGPHDQLQJ  %Intent of Certain Terms or Adjectives:  7KH&RQWUDFW'RFXPHQWVLQFOXGHWKHWHUPV³DVDOORZHG´³DVDSSURYHG´³DVRUGHUHG´³DV GLUHFWHG´RUWHUPVRIOLNHHIIHFWRULPSRUWWRDXWKRUL]HDQH[HUFLVHRIMXGJPHQWE\&LW\,Q DGGLWLRQWKHDGMHFWLYHV³UHDVRQDEOH´³VXLWDEOH´³DFFHSWDEOH´³SURSHU´³VDWLVIDFWRU\´RU DGMHFWLYHVRIOLNHHIIHFWRULPSRUWDUHXVHGWRGHVFULEHDQDFWLRQRUGHWHUPLQDWLRQRI&LW\DVWR WKH:RUN,WLVLQWHQGHGWKDWVXFKH[HUFLVHRISURIHVVLRQDOMXGJPHQWDFWLRQRUGHWHUPLQDWLRQ ZLOOEHVROHO\WRHYDOXDWHLQJHQHUDOWKH:RUNIRUFRPSOLDQFHZLWKWKHLQIRUPDWLRQLQWKH &RQWUDFW'RFXPHQWVDQGZLWKWKHGHVLJQFRQFHSWRIWKH3URMHFWDVDIXQFWLRQLQJZKROHDV VKRZQRULQGLFDWHGLQWKH&RQWUDFW'RFXPHQWV XQOHVVWKHUHLVDVSHFLILFVWDWHPHQWLQGLFDWLQJ RWKHUZLVH         424   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &Defective:  7KH ZRUG ³GHIHFWLYH´ ZKHQ PRGLI\LQJ WKHZRUG³:RUN´UHIHUVWR:RUNWKDWLV XQVDWLVIDFWRU\IDXOW\RUGHILFLHQWLQWKDWLW  DGRHVQRWFRQIRUPWRWKH&RQWUDFW'RFXPHQWVRU  EGRHVQRWPHHWWKHUHTXLUHPHQWVRIDQ\DSSOLFDEOHLQVSHFWLRQUHIHUHQFHVWDQGDUGWHVWRU DSSURYDOUHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWVRU  FKDVEHHQGDPDJHGSULRUWR&LW\¶VZULWWHQDFFHSWDQFH 'Furnish, Install, Perform, Provide:  7KHZRUG³)XUQLVK´RUWKHZRUG³,QVWDOO´RUWKHZRUG³3HUIRUP´RUWKHZRUG³3URYLGH´RU WKHZRUG³6XSSO\´RUDQ\FRPELQDWLRQRUVLPLODUGLUHFWLYHRUXVDJHWKHUHRIVKDOOPHDQ IXUQLVKLQJDQGLQFRUSRUDWLQJLQWKH:RUNLQFOXGLQJDOOQHFHVVDU\ODERUPDWHULDOVHTXLSPHQW DQGHYHU\WKLQJQHFHVVDU\WRSHUIRUPWKH:RUNLQGLFDWHGXQOHVVVSHFLILFDOO\OLPLWHGLQWKH FRQWH[WXVHG  (8QOHVVVWDWHGRWKHUZLVHLQWKH&RQWUDFW'RFXPHQWVZRUGVRUSKUDVHVWKDWKDYHDZHOONQRZQ WHFKQLFDO RU FRQVWUXFWLRQ LQGXVWU\ RU WUDGH PHDQLQJ DUH XVHG LQ WKH &RQWUDFW 'RFXPHQWV LQ DFFRUGDQFHZLWKVXFKUHFRJQL]HGPHDQLQJ  $57,&/(±35(/,0,1$5<0$77(56  Copies of Documents  &LW\VKDOOIXUQLVKWR&RQWUDFWRURQH  RULJLQDOH[HFXWHGFRS\DQGRQH  HOHFWURQLFFRS\RIWKH &RQWUDFW'RFXPHQWVDQGWKUHH  DGGLWLRQDOFRSLHVRIWKH'UDZLQJV$GGLWLRQDOFRSLHVZLOOEH IXUQLVKHGXSRQUHTXHVWDWWKHFRVWRIUHSURGXFWLRQ  Commencement of Contract Time; Notice to Proceed  7KH&RQWUDFW7LPHZLOOFRPPHQFHWRUXQRQWKHGD\LQGLFDWHGLQWKH1RWLFHWR3URFHHG$1RWLFHWR 3URFHHGPD\EHJLYHQDWDQ\WLPHZLWKLQGD\VDIWHUWKH(IIHFWLYH'DWHRIWKH$JUHHPHQW  Starting the Work  &RQWUDFWRUVKDOOVWDUWWRSHUIRUPWKH:RUNRQWKHGDWHZKHQWKH&RQWUDFW7LPHFRPPHQFHVWRUXQ 1R:RUNVKDOOEHGRQHDWWKH6LWHSULRUWRWKHGDWHRQZKLFKWKH&RQWUDFW7LPHFRPPHQFHVWRUXQ  Before Starting Construction  Baseline Schedules: 6XEPLWLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVDQGSULRUWRVWDUWLQJWKH :RUN        425   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Preconstruction Conference  %HIRUHDQ\:RUNDWWKH6LWHLVVWDUWHGWKH&RQWUDFWRUVKDOODWWHQGD3UHFRQVWUXFWLRQ&RQIHUHQFHDV VSHFLILHGLQWKH&RQWUDFW'RFXPHQWV  Public Meeting  &RQWUDFWRUPD\QRWPRELOL]HDQ\HTXLSPHQWPDWHULDOVRUUHVRXUFHVWRWKH6LWHSULRUWR&RQWUDFWRU DWWHQGLQJWKH3XEOLF0HHWLQJDVVFKHGXOHGE\WKH&LW\  Initial Acceptance of Schedules  1RSURJUHVVSD\PHQWVKDOOEHPDGHWR&RQWUDFWRUXQWLODFFHSWDEOHVFKHGXOHVDUHVXEPLWWHGWR&LW\LQ DFFRUGDQFHZLWKWKH6FKHGXOH6SHFLILFDWLRQDVSURYLGHGLQWKH&RQWUDFW'RFXPHQWV  Electronic Submittals  $([FHSWDVRWKHUZLVHVWDWHGHOVHZKHUHLQWKH&RQWUDFWWKH&LW\DQG&RQWUDFWRUPD\WUDQVPLWDQG VKDOODFFHSW3URMHFWUHODWHGFRUUHVSRQGHQFHWH[WGDWDGRFXPHQWVGUDZLQJVLQIRUPDWLRQDQG JUDSKLFVLQFOXGLQJEXWQRWOLPLWHGWR6KRS'UDZLQJVDQGRWKHUVXEPLWWDOVLQHOHFWURQLFPHGLDRU GLJLWDOIRUPDW  %:KHQWUDQVPLWWLQJLWHPVLQHOHFWURQLFPHGLDRUGLJLWDOIRUPDWWKHWUDQVPLWWLQJSDUW\PDNHVQR UHSUHVHQWDWLRQVDVWRORQJWHUPFRPSDWLELOLW\XVDELOLW\RUUHDGDELOLW\RIWKHLWHPVUHVXOWLQJIURP WKHUHFLSLHQW¶VXVHRIVRIWZDUHDSSOLFDWLRQSDFNDJHVRSHUDWLQJV\VWHPVRUFRPSXWHUKDUGZDUH GLIIHULQJIURPWKRVHXVHGLQWKHGUDIWLQJRUWUDQVPLWWDORIWKHLWHPVRUIURPWKRVHHVWDEOLVKHGLQ DSSOLFDEOHWUDQVPLWWDOSURWRFROV   $57,&/(±&2175$&7'2&80(176 ,17(17$0(1',1*5(86(  Intent  $7KH&RQWUDFW'RFXPHQWVDUHFRPSOHPHQWDU\ZKDWLVUHTXLUHGE\RQHLVDVELQGLQJDVLIUHTXLUHG E\DOO  %,WLVWKHLQWHQWRIWKH&RQWUDFW'RFXPHQWVWRGHVFULEHDIXQFWLRQDOO\FRPSOHWHSURMHFW RUSDUW WKHUHRI  WR EH FRQVWUXFWHG LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV $Q\ ODERU GRFXPHQWDWLRQ VHUYLFHV PDWHULDOV RU HTXLSPHQW WKDW UHDVRQDEO\ PD\ EH LQIHUUHG IURP WKH &RQWUDFW'RFXPHQWVRUIURPSUHYDLOLQJFXVWRPRUWUDGHXVDJHDVEHLQJUHTXLUHGWRSURGXFHWKH LQGLFDWHGUHVXOWZLOOEHSURYLGHGZKHWKHURUQRWVSHFLILFDOO\FDOOHGIRUDWQRDGGLWLRQDOFRVWWR &LW\  &&ODULILFDWLRQVDQGLQWHUSUHWDWLRQVRIWKH&RQWUDFW'RFXPHQWVVKDOOEHLVVXHGE\&LW\  '7KH6SHFLILFDWLRQVPD\YDU\LQIRUPIRUPDWDQGVW\OH6RPH6SHFLILFDWLRQVHFWLRQVPD\EH ZULWWHQLQYDU\LQJGHJUHHVRIVWUHDPOLQHGRUGHFODUDWLYHVW\OHDQGVRPHVHFWLRQVPD\EH       426   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 UHODWLYHO\ QDUUDWLYH E\ FRPSDULVRQ 2PLVVLRQ RI VXFK ZRUGV DQGSKUDVHV DV ³WKH &RQWUDFWRU VKDOO´³LQFRQIRUPLW\ZLWK´³DVVKRZQ´RU³DVVSHFLILHG´DUHLQWHQWLRQDOLQVWUHDPOLQHG VHFWLRQV2PLWWHGZRUGVDQGSKUDVHVVKDOOEHVXSSOLHGE\LQIHUHQFH6LPLODUW\SHVRISURYLVLRQV PD\DSSHDULQYDULRXVSDUWVRIDVHFWLRQRUDUWLFOHVZLWKLQDSDUWGHSHQGLQJRQWKHIRUPDWRIWKH VHFWLRQ7KH&RQWUDFWRUVKDOOQRWWDNHDGYDQWDJHRIDQ\YDULDWLRQRIIRUPIRUPDWRUVW\OHLQ PDNLQJ&RQWUDFW&ODLPV  (7KHFURVVUHIHUHQFLQJRIVSHFLILFDWLRQVHFWLRQVXQGHUWKHVXESDUDJUDSKKHDGLQJ³5HODWHG 6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR´DQGHOVHZKHUHZLWKLQHDFK6SHFLILFDWLRQ VHFWLRQLVSURYLGHGDVDQDLGDQGFRQYHQLHQFHWRWKH&RQWUDFWRU7KH&RQWUDFWRUVKDOOQRWUHO\RQ WKHFURVVUHIHUHQFLQJSURYLGHGDQGVKDOOEHUHVSRQVLEOHWRFRRUGLQDWHWKHHQWLUH:RUNXQGHUWKH &RQWUDFW'RFXPHQWVDQGSURYLGHDFRPSOHWH3URMHFWZKHWKHURUQRWWKHFURVVUHIHUHQFLQJLV SURYLGHGLQHDFKVHFWLRQRUZKHWKHURUQRWWKHFURVVUHIHUHQFLQJLVFRPSOHWH  Reference Standards  $6WDQGDUGV6SHFLILFDWLRQV&RGHV/DZVDQG5HJXODWLRQV  5HIHUHQFH WR VWDQGDUGV VSHFLILFDWLRQV PDQXDOV RU FRGHV RI DQ\ WHFKQLFDO VRFLHW\ RUJDQL]DWLRQRUDVVRFLDWLRQRUWR/DZVRU5HJXODWLRQVZKHWKHUVXFKUHIHUHQFHEHVSHFLILFRU E\LPSOLFDWLRQVKDOOPHDQWKHVWDQGDUGVSHFLILFDWLRQPDQXDOFRGHRU/DZVRU5HJXODWLRQV LQHIIHFWDWWKHWLPHRIRSHQLQJRI%LGV RURQWKH(IIHFWLYH'DWHRIWKH$JUHHPHQWLIWKHUH ZHUHQR%LGV H[FHSWDVPD\EHRWKHUZLVHVSHFLILFDOO\VWDWHGLQWKH&RQWUDFW'RFXPHQWV  1RSURYLVLRQRIDQ\VXFKVWDQGDUGVSHFLILFDWLRQPDQXDORUFRGHRUDQ\LQVWUXFWLRQRID 6XSSOLHUVKDOOEHHIIHFWLYHWRFKDQJHWKHGXWLHVRUUHVSRQVLELOLWLHVRI&LW\&RQWUDFWRURUDQ\ RIWKHLUVXEFRQWUDFWRUVFRQVXOWDQWVDJHQWVRUHPSOR\HHVIURPWKRVHVHWIRUWKLQWKH&RQWUDFW 'RFXPHQWV1RVXFKSURYLVLRQRULQVWUXFWLRQVKDOOEHHIIHFWLYHWRDVVLJQWR&LW\RUDQ\RILWV RIILFHUVGLUHFWRUVPHPEHUVSDUWQHUVHPSOR\HHVDJHQWVFRQVXOWDQWVRUVXEFRQWUDFWRUVDQ\ GXW\RUDXWKRULW\WRVXSHUYLVHRUGLUHFWWKHSHUIRUPDQFHRIWKH:RUNRUDQ\GXW\RUDXWKRULW\ WRXQGHUWDNHUHVSRQVLELOLW\LQFRQVLVWHQWZLWKWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWV  Reporting and Resolving Discrepancies  $Reporting Discrepancies:  Contractor’s Review of Contract Documents Before Starting Work %HIRUHXQGHUWDNLQJHDFK SDUWRIWKH:RUN&RQWUDFWRUVKDOOFDUHIXOO\VWXG\DQGFRPSDUHWKH&RQWUDFW'RFXPHQWVDQG FKHFN DQG YHULI\ SHUWLQHQW ILJXUHV WKHUHLQ DJDLQVW DOO DSSOLFDEOH ILHOG PHDVXUHPHQWV DQG FRQGLWLRQV&RQWUDFWRUVKDOOSURPSWO\UHSRUWLQZULWLQJWR&LW\DQ\FRQIOLFWHUURUDPELJXLW\ RUGLVFUHSDQF\ZKLFK&RQWUDFWRUGLVFRYHUVRUKDVDFWXDONQRZOHGJHRIDQGVKDOOREWDLQD ZULWWHQLQWHUSUHWDWLRQRUFODULILFDWLRQIURP&LW\EHIRUHSURFHHGLQJZLWKDQ\:RUNDIIHFWHG WKHUHE\  Contractor’s Review of Contract Documents During Performance of Work:,IGXULQJWKH SHUIRUPDQFHRIWKH:RUN&RQWUDFWRUGLVFRYHUVDQ\FRQIOLFWHUURUDPELJXLW\RUGLVFUHSDQF\       427   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 ZLWKLQWKH&RQWUDFW'RFXPHQWVRUEHWZHHQWKH&RQWUDFW'RFXPHQWVDQG D DQ\DSSOLFDEOH /DZRU5HJXODWLRQ E DQ\VWDQGDUGVSHFLILFDWLRQPDQXDORUFRGHRU F DQ\LQVWUXFWLRQRI DQ\6XSSOLHUWKHQ&RQWUDFWRUVKDOOSURPSWO\UHSRUWLWWR&LW\LQZULWLQJ&RQWUDFWRUVKDOOQRW SURFHHGZLWKWKH:RUNDIIHFWHGWKHUHE\ H[FHSWLQDQHPHUJHQF\DVUHTXLUHGE\3DUDJUDSK $ XQWLODQDPHQGPHQWRUVXSSOHPHQWWRWKH&RQWUDFW'RFXPHQWVKDVEHHQLVVXHGE\RQH RIWKHPHWKRGVLQGLFDWHGLQ3DUDJUDSK  &RQWUDFWRUVKDOOQRWEHOLDEOHWR&LW\IRUIDLOXUHWRUHSRUWDQ\FRQIOLFWHUURUDPELJXLW\RU GLVFUHSDQF\LQWKH&RQWUDFW'RFXPHQWVXQOHVV&RQWUDFWRUKDGDFWXDONQRZOHGJHWKHUHRI  %Resolving Discrepancies:  ([FHSWDVPD\EHRWKHUZLVHVSHFLILFDOO\VWDWHGLQWKH&RQWUDFW'RFXPHQWVWKHSURYLVLRQVRI WKH&RQWUDFW'RFXPHQWVVKDOOWDNHSUHFHGHQFHLQUHVROYLQJDQ\FRQIOLFWHUURUDPELJXLW\RU GLVFUHSDQF\EHWZHHQWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVDQGWKHSURYLVLRQVRIDQ\ VWDQGDUGVSHFLILFDWLRQPDQXDORUWKHLQVWUXFWLRQRIDQ\6XSSOLHU ZKHWKHURUQRWVSHFLILFDOO\ LQFRUSRUDWHGE\UHIHUHQFHLQWKH&RQWUDFW'RFXPHQWV   ,QFDVHRIGLVFUHSDQFLHVILJXUHGGLPHQVLRQVVKDOOJRYHUQRYHUVFDOHGGLPHQVLRQV'UDZLQJV VKDOOJRYHUQRYHU6SHFLILFDWLRQVDQG6XSSOHPHQWDU\&RQGLWLRQVVKDOOJRYHUQRYHU*HQHUDO &RQGLWLRQVDQG6SHFLILFDWLRQV  Amending and Supplementing Contract Documents  $7KH&RQWUDFW'RFXPHQWVPD\EHDPHQGHGWRSURYLGHIRUDGGLWLRQVGHOHWLRQVDQGUHYLVLRQVLQ WKH:RUNRUWRPRGLI\WKHWHUPVDQGFRQGLWLRQVWKHUHRIE\D&KDQJH2UGHU  %7KHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVPD\EHVXSSOHPHQWHGDQGPLQRUYDULDWLRQVDQG GHYLDWLRQVLQWKH:RUNQRWLQYROYLQJDFKDQJHLQ&RQWUDFW3ULFHRU&RQWUDFW7LPHPD\EH DXWKRUL]HGE\RQHRUPRUHRIWKHIROORZLQJZD\V  $)LHOG2UGHU  &LW\¶VUHYLHZRID6XEPLWWDO VXEMHFWWRWKHSURYLVLRQVRI3DUDJUDSK& RU  &LW\¶VZULWWHQLQWHUSUHWDWLRQRUFODULILFDWLRQ  Reuse of Documents  $&RQWUDFWRUDQGDQ\6XEFRQWUDFWRURU6XSSOLHUVKDOOQRW  KDYHRUDFTXLUHDQ\WLWOHWRRURZQHUVKLSULJKWVLQDQ\RIWKH'UDZLQJV6SHFLILFDWLRQVRU RWKHUGRFXPHQWV RUFRSLHVRIDQ\WKHUHRI SUHSDUHGE\RUEHDULQJWKHVHDORI(QJLQHHU LQFOXGLQJHOHFWURQLFPHGLDHGLWLRQVRU  UHXVHDQ\VXFK'UDZLQJV6SHFLILFDWLRQVRWKHUGRFXPHQWVRUFRSLHVWKHUHRIRQH[WHQVLRQVRI WKH 3URMHFW RU DQ\ RWKHU SURMHFW ZLWKRXW ZULWWHQ FRQVHQW RI &LW\ DQG VSHFLILF ZULWWHQ       428   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 YHULILFDWLRQRUDGDSWDWLRQE\(QJLQHHU  %7KHSURKLELWLRQVRIWKLV3DUDJUDSKZLOOVXUYLYHILQDOSD\PHQWRUWHUPLQDWLRQRIWKH &RQWUDFW 1RWKLQJ KHUHLQ VKDOO SUHFOXGH &RQWUDFWRU IURP UHWDLQLQJ FRSLHV RI WKH &RQWUDFW 'RFXPHQWVIRUUHFRUGSXUSRVHV  Electronic Data  $8QOHVVRWKHUZLVHVWDWHGLQWKH6XSSOHPHQWDU\&RQGLWLRQVWKHGDWDIXUQLVKHGE\&LW\RU(QJLQHHU WR&RQWUDFWRURUE\&RQWUDFWRUWR&LW\RU(QJLQHHUWKDWPD\EHUHOLHGXSRQDUHOLPLWHGWRWKH SULQWHG FRSLHV LQFOXGHG LQ WKH &RQWUDFW 'RFXPHQWV DOVR NQRZQ DV KDUG FRSLHV  )LOHV LQ HOHFWURQLF PHGLD IRUPDW RI WH[W GDWD JUDSKLFV RU RWKHU W\SHVDUHIXUQLVKHGRQO\IRUWKH FRQYHQLHQFHRIWKHUHFHLYLQJSDUW\$Q\FRQFOXVLRQRULQIRUPDWLRQREWDLQHGRUGHULYHGIURP VXFK HOHFWURQLF ILOHV ZLOO EH DW WKH XVHU¶V VROH ULVN ,I WKHUH LV D GLVFUHSDQF\ EHWZHHQ WKH HOHFWURQLFILOHVDQGWKHKDUGFRSLHVWKHKDUGFRSLHVJRYHUQ  %:KHQ WUDQVIHUULQJ GRFXPHQWV LQ HOHFWURQLF PHGLD IRUPDW WKH WUDQVIHUULQJ SDUW\ PDNHV QR UHSUHVHQWDWLRQVDVWRORQJWHUPFRPSDWLELOLW\XVDELOLW\RUUHDGDELOLW\RIGRFXPHQWVUHVXOWLQJ IURP WKH XVH RI VRIWZDUH DSSOLFDWLRQ SDFNDJHV RSHUDWLQJ V\VWHPV RU FRPSXWHU KDUGZDUH GLIIHULQJIURPWKRVHXVHGE\WKHGDWD¶VFUHDWRU  $57,&/(±$9$,/$%,/,7<2)/$1'668%685)$&($1'3+<6,&$/&21',7,216 +$=$5'286(19,5210(17$/&21',7,2165()(5(1&(32,176  Availability of Lands  $&LW\VKDOOIXUQLVKWKH6LWH&LW\VKDOOQRWLI\&RQWUDFWRURIDQ\HQFXPEUDQFHVRUUHVWULFWLRQVQRWRI JHQHUDODSSOLFDWLRQEXWVSHFLILFDOO\UHODWHGWRXVHRIWKH6LWHZLWKZKLFK&RQWUDFWRUPXVWFRPSO\ LQ SHUIRUPLQJ WKH :RUN &LW\ ZLOO REWDLQ LQ D WLPHO\ PDQQHU DQGSD\IRUHDVHPHQWVIRU SHUPDQHQWVWUXFWXUHVRUSHUPDQHQWFKDQJHVLQH[LVWLQJIDFLOLWLHV  7KH &LW\ KDV REWDLQHG RU DQWLFLSDWHV DFTXLVLWLRQRIDQGRUDFFHVVWRULJKWRIZD\DQGRU HDVHPHQWV$Q\RXWVWDQGLQJULJKWRIZD\DQGRUHDVHPHQWVDUHDQWLFLSDWHGWREHDFTXLUHGLQ DFFRUGDQFH ZLWK WKH VFKHGXOH VHW IRUWK LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV 7KH 3URMHFW 6FKHGXOH VXEPLWWHG E\ WKH &RQWUDFWRU LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV PXVW FRQVLGHUDQ\RXWVWDQGLQJULJKWRIZD\DQGRUHDVHPHQWV  7KH&LW\KDVRUDQWLFLSDWHVUHPRYLQJDQGRUUHORFDWLQJXWLOLWLHVDQGREVWUXFWLRQVWRWKH6LWH $Q\RXWVWDQGLQJUHPRYDORUUHORFDWLRQRIXWLOLWLHVRUREVWUXFWLRQVLVDQWLFLSDWHGLQDFFRUGDQFH ZLWKWKHVFKHGXOHVHWIRUWKLQWKH6XSSOHPHQWDU\&RQGLWLRQV7KH3URMHFW6FKHGXOHVXEPLWWHG E\WKH&RQWUDFWRULQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVPXVWFRQVLGHUDQ\RXWVWDQGLQJ XWLOLWLHVRUREVWUXFWLRQVWREHUHPRYHGDGMXVWHGDQGRUUHORFDWHGE\RWKHUV  %8SRQUHDVRQDEOHZULWWHQUHTXHVW&LW\VKDOOIXUQLVK&RQWUDFWRUZLWKDFXUUHQWVWDWHPHQWRIUHFRUG OHJDOWLWOHDQGOHJDOGHVFULSWLRQRIWKHODQGVXSRQZKLFKWKH:RUNLVWREHSHUIRUPHG        429   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &&RQWUDFWRUVKDOOSURYLGHIRUDOODGGLWLRQDOODQGVDQGDFFHVVWKHUHWRWKDWPD\EHUHTXLUHGIRU FRQVWUXFWLRQIDFLOLWLHVRUVWRUDJHRIPDWHULDOVDQGHTXLSPHQW  Subsurface and Physical Conditions  $Reports and Drawings: 7KH6XSSOHPHQWDU\&RQGLWLRQVLGHQWLI\  WKRVHUHSRUWVNQRZQWR&LW\RIH[SORUDWLRQVDQGWHVWVRIVXEVXUIDFHFRQGLWLRQVDWRU FRQWLJXRXVWRWKH6LWH DQG  WKRVHGUDZLQJVNQRZQWR&LW\RISK\VLFDOFRQGLWLRQVUHODWLQJWRH[LVWLQJVXUIDFHRU VXEVXUIDFHVWUXFWXUHVDWWKH6LWH H[FHSW8QGHUJURXQG)DFLOLWLHV   %Limited Reliance by Contractor on Technical Data Authorized: &RQWUDFWRUPD\UHO\XSRQWKH DFFXUDF\RIWKH³WHFKQLFDOGDWD´FRQWDLQHGLQVXFKUHSRUWVDQGGUDZLQJVEXWVXFKUHSRUWVDQG GUDZLQJVDUHQRW&RQWUDFW'RFXPHQWV6XFK³WHFKQLFDOGDWD´LVLGHQWLILHGLQWKH6XSSOHPHQWDU\ &RQGLWLRQV&RQWUDFWRUPD\QRWPDNHDQ\&RQWUDFW&ODLPDJDLQVW&LW\RUDQ\RIWKHLURIILFHUV GLUHFWRUVPHPEHUVSDUWQHUVHPSOR\HHVDJHQWVFRQVXOWDQWVRUVXEFRQWUDFWRUVZLWKUHVSHFWWR  WKHFRPSOHWHQHVVRIVXFKUHSRUWVDQGGUDZLQJVIRU&RQWUDFWRU¶VSXUSRVHVLQFOXGLQJEXWQRW OLPLWHGWRDQ\DVSHFWVRIWKHPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRI FRQVWUXFWLRQWREHHPSOR\HGE\&RQWUDFWRUDQGVDIHW\SUHFDXWLRQVDQGSURJUDPVLQFLGHQW WKHUHWRRU  RWKHUGDWDLQWHUSUHWDWLRQVRSLQLRQVDQGLQIRUPDWLRQFRQWDLQHGLQVXFKUHSRUWVRUVKRZQRU LQGLFDWHGLQVXFKGUDZLQJVRU  DQ\&RQWUDFWRULQWHUSUHWDWLRQRIRUFRQFOXVLRQGUDZQIURPDQ\³WHFKQLFDOGDWD´RUDQ\VXFK RWKHUGDWDLQWHUSUHWDWLRQVRSLQLRQVRULQIRUPDWLRQ  Differing Subsurface or Physical Conditions  $Notice: ,I&RQWUDFWRUEHOLHYHVWKDWDQ\VXEVXUIDFHRUSK\VLFDOFRQGLWLRQWKDWLVXQFRYHUHGRU UHYHDOHGHLWKHU  LVRIVXFKDQDWXUHDVWRHVWDEOLVKWKDWDQ\³WHFKQLFDOGDWD´RQZKLFK&RQWUDFWRULVHQWLWOHGWR UHO\DVSURYLGHGLQ3DUDJUDSKLVPDWHULDOO\LQDFFXUDWHRU  LVRIVXFKDQDWXUHDVWRUHTXLUHDFKDQJHLQWKH&RQWUDFW'RFXPHQWVRU  GLIIHUVPDWHULDOO\IURPWKDWVKRZQRULQGLFDWHGLQWKH&RQWUDFW'RFXPHQWVRU  LVRIDQXQXVXDOQDWXUHDQGGLIIHUVPDWHULDOO\IURPFRQGLWLRQVRUGLQDULO\HQFRXQWHUHGDQG JHQHUDOO\ UHFRJQL]HG DV LQKHUHQW LQ ZRUN RI WKH FKDUDFWHU SURYLGHG IRU LQ WKH &RQWUDFW 'RFXPHQWV  WKHQ&RQWUDFWRUVKDOOSURPSWO\DIWHUEHFRPLQJDZDUHWKHUHRIDQGEHIRUHIXUWKHUGLVWXUELQJWKH       430   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 VXEVXUIDFHRUSK\VLFDOFRQGLWLRQVRUSHUIRUPLQJDQ\:RUNLQFRQQHFWLRQWKHUHZLWK H[FHSWLQDQ HPHUJHQF\DVUHTXLUHGE\3DUDJUDSK$ QRWLI\&LW\LQZULWLQJDERXWVXFKFRQGLWLRQ  %Possible Price and Time Adjustments  &RQWUDFWRUVKDOOQRWEHHQWLWOHGWRDQ\DGMXVWPHQWLQWKH&RQWUDFW3ULFHRU&RQWUDFW7LPHLI  &RQWUDFWRUNQHZRIWKHH[LVWHQFHRIVXFKFRQGLWLRQVDWWKHWLPH&RQWUDFWRUPDGHDILQDO FRPPLWPHQWWR&LW\ZLWKUHVSHFWWR&RQWUDFW3ULFHDQG&RQWUDFW7LPHE\WKHVXEPLVVLRQRID %LGRUEHFRPLQJERXQGXQGHUDQHJRWLDWHGFRQWUDFWRU  WKHH[LVWHQFHRIVXFKFRQGLWLRQFRXOGUHDVRQDEO\KDYHEHHQGLVFRYHUHGRUUHYHDOHGDVDUHVXOW RIWKHH[DPLQDWLRQRIWKH&RQWUDFW'RFXPHQWVRUWKH6LWHRU  &RQWUDFWRUIDLOHGWRJLYHWKHZULWWHQQRWLFHDVUHTXLUHGE\3DUDJUDSK$  Underground Facilities  $Shown or Indicated: 7KHLQIRUPDWLRQDQGGDWDVKRZQRULQGLFDWHGLQWKH&RQWUDFW'RFXPHQWV ZLWK UHVSHFW WR H[LVWLQJ 8QGHUJURXQG )DFLOLWLHV DW RU FRQWLJXRXVWRWKH6LWHLVEDVHGRQ LQIRUPDWLRQDQGGDWDIXUQLVKHGWR&LW\RU(QJLQHHUE\WKHRZQHUVRIVXFK8QGHUJURXQG )DFLOLWLHV LQFOXGLQJ &LW\ RU E\ RWKHUV 8QOHVV LW LV RWKHUZLVH H[SUHVVO\ SURYLGHG LQ WKH 6XSSOHPHQWDU\&RQGLWLRQV  &LW\DQG(QJLQHHUVKDOOQRWEHUHVSRQVLEOHIRUWKHDFFXUDF\RUFRPSOHWHQHVVRIDQ\VXFK LQIRUPDWLRQRUGDWDSURYLGHGE\RWKHUVDQG  WKHFRVWRIDOORIWKHIROORZLQJZLOOEHLQFOXGHGLQWKH&RQWUDFW3ULFHDQG&RQWUDFWRUVKDOO KDYHIXOOUHVSRQVLELOLW\IRU  DUHYLHZLQJDQGFKHFNLQJDOOVXFKLQIRUPDWLRQDQGGDWD  EORFDWLQJDOO8QGHUJURXQG)DFLOLWLHVVKRZQRULQGLFDWHGLQWKH&RQWUDFW'RFXPHQWV  FFRRUGLQDWLRQDQGDGMXVWPHQWRIWKH:RUNZLWKWKHRZQHUVRIVXFK8QGHUJURXQG )DFLOLWLHVLQFOXGLQJ&LW\GXULQJFRQVWUXFWLRQDQG  GWKHVDIHW\DQGSURWHFWLRQRIDOOVXFK8QGHUJURXQG)DFLOLWLHVDQGUHSDLULQJDQ\GDPDJH WKHUHWRUHVXOWLQJIURPWKH:RUN  %Not Shown or Indicated:  ,IDQ8QGHUJURXQG)DFLOLW\ZKLFKFRQIOLFWVZLWKWKH:RUNLVXQFRYHUHGRUUHYHDOHGDWRU FRQWLJXRXVWRWKH6LWHZKLFKZDVQRWVKRZQRULQGLFDWHGRUQRWVKRZQRULQGLFDWHGZLWK UHDVRQDEOHDFFXUDF\LQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOSURPSWO\DIWHUEHFRPLQJ DZDUHWKHUHRIDQGEHIRUHIXUWKHUGLVWXUELQJFRQGLWLRQVDIIHFWHGWKHUHE\RUSHUIRUPLQJDQ\ :RUNLQFRQQHFWLRQWKHUHZLWK H[FHSWLQDQHPHUJHQF\DVUHTXLUHGE\3DUDJUDSK$        431   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 LGHQWLI\WKHRZQHURIVXFK8QGHUJURXQG)DFLOLW\DQGJLYHQRWLFHWRWKDWRZQHUDQGWR&LW\ &LW\ZLOOUHYLHZWKHGLVFRYHUHG8QGHUJURXQG)DFLOLW\DQGGHWHUPLQHWKHH[WHQWLIDQ\WR ZKLFKDFKDQJHPD\EHUHTXLUHGLQWKH&RQWUDFW'RFXPHQWVWRUHIOHFWDQGGRFXPHQWWKH FRQVHTXHQFHVRIWKHH[LVWHQFHRUORFDWLRQRIWKH8QGHUJURXQG)DFLOLW\&RQWUDFWRUVKDOOEH UHVSRQVLEOHIRUWKHVDIHW\DQGSURWHFWLRQRIVXFKGLVFRYHUHG8QGHUJURXQG)DFLOLW\  ,I&LW\FRQFOXGHVWKDWDFKDQJHLQWKH&RQWUDFW'RFXPHQWVLVUHTXLUHGD&KDQJH2UGHUPD\ EHLVVXHGWRUHIOHFWDQGGRFXPHQWVXFKFRQVHTXHQFHV  9HULILFDWLRQRIH[LVWLQJXWLOLWLHVVWUXFWXUHVDQGVHUYLFHOLQHVVKDOOLQFOXGHQRWLILFDWLRQRIDOO XWLOLW\FRPSDQLHVDPLQLPXPRIKRXUVLQDGYDQFHRIFRQVWUXFWLRQLQFOXGLQJH[SORUDWRU\ H[FDYDWLRQLIQHFHVVDU\  Hazardous Environmental Condition at Site  $Reports and Drawings: 7KH6XSSOHPHQWDU\&RQGLWLRQVLGHQWLI\WKRVHUHSRUWVDQGGUDZLQJV NQRZQWR&LW\UHODWLQJWR+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQVWKDWKDYHEHHQLGHQWLILHGDWWKH 6LWH  %Limited Reliance by Contractor on Technical Data Authorized: &RQWUDFWRUPD\UHO\XSRQWKH DFFXUDF\RIWKH³WHFKQLFDOGDWD´FRQWDLQHGLQVXFKUHSRUWVDQGGUDZLQJVEXWVXFKUHSRUWVDQG GUDZLQJVDUHQRW&RQWUDFW'RFXPHQWV6XFK³WHFKQLFDOGDWD´LVLGHQWLILHGLQWKH6XSSOHPHQWDU\ &RQGLWLRQV&RQWUDFWRUPD\QRWPDNHDQ\&RQWUDFW&ODLPDJDLQVW&LW\RUDQ\RIWKHLURIILFHUV GLUHFWRUVPHPEHUVSDUWQHUVHPSOR\HHVDJHQWVFRQVXOWDQWVRUVXEFRQWUDFWRUVZLWKUHVSHFWWR  WKHFRPSOHWHQHVVRIVXFKUHSRUWVDQGGUDZLQJVIRU&RQWUDFWRU¶VSXUSRVHVLQFOXGLQJEXWQRW OLPLWHGWRDQ\DVSHFWV RIWKH PHDQV PHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRI FRQVWUXFWLRQWREHHPSOR\HGE\&RQWUDFWRUDQGVDIHW\SUHFDXWLRQVDQGSURJUDPVLQFLGHQW WKHUHWRRU  RWKHUGDWDLQWHUSUHWDWLRQVRSLQLRQVDQGLQIRUPDWLRQFRQWDLQHGLQVXFKUHSRUWVRUVKRZQRU LQGLFDWHGLQVXFKGUDZLQJVRU  DQ\&RQWUDFWRULQWHUSUHWDWLRQRIRUFRQFOXVLRQGUDZQIURPDQ\³WHFKQLFDOGDWD´RUDQ\VXFK RWKHUGDWDLQWHUSUHWDWLRQVRSLQLRQVRULQIRUPDWLRQ  &&RQWUDFWRUVKDOOQRWEHUHVSRQVLEOHIRUDQ\+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQXQFRYHUHGRU UHYHDOHGDWWKH6LWHZKLFKZDVQRWVKRZQRULQGLFDWHGLQ'UDZLQJVRU6SHFLILFDWLRQVRULGHQWLILHG LQWKH&RQWUDFW'RFXPHQWVWREHZLWKLQWKHVFRSHRIWKH:RUN&RQWUDFWRUVKDOOEHUHVSRQVLEOH IRUD+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQFUHDWHGZLWKDQ\PDWHULDOVEURXJKWWRWKH6LWHE\ &RQWUDFWRU6XEFRQWUDFWRUV6XSSOLHUVRUDQ\RQHHOVHIRUZKRP&RQWUDFWRULVUHVSRQVLEOH  ',I&RQWUDFWRUHQFRXQWHUVD+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQRULI&RQWUDFWRURUDQ\RQHIRU ZKRP&RQWUDFWRULVUHVSRQVLEOHFUHDWHVD+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQ&RQWUDFWRUVKDOO LPPHGLDWHO\ L VHFXUHRURWKHUZLVHLVRODWHVXFKFRQGLWLRQ LL VWRSDOO:RUNLQFRQQHFWLRQZLWK VXFK FRQGLWLRQ DQG LQ DQ\ DUHD DIIHFWHG WKHUHE\ H[FHSW LQ DQ HPHUJHQF\ DV UHTXLUHG E\       432   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 3DUDJUDSK$ DQG LLL QRWLI\&LW\ DQGSURPSWO\WKHUHDIWHUFRQILUPVXFKQRWLFHLQZULWLQJ  &LW\PD\FRQVLGHUWKHQHFHVVLW\WRUHWDLQDTXDOLILHGH[SHUWWRHYDOXDWHVXFKFRQGLWLRQRUWDNH FRUUHFWLYHDFWLRQLIDQ\  (&RQWUDFWRUVKDOOQRWEHUHTXLUHGWRUHVXPH:RUNLQFRQQHFWLRQZLWKVXFKFRQGLWLRQRULQDQ\ DIIHFWHGDUHDXQWLODIWHU&LW\KDVREWDLQHGDQ\UHTXLUHGSHUPLWVUHODWHGWKHUHWRDQGGHOLYHUHG ZULWWHQQRWLFHWR&RQWUDFWRU L VSHFLI\LQJWKDWVXFKFRQGLWLRQDQGDQ\DIIHFWHGDUHDLVRUKDV EHHQUHQGHUHGVXLWDEOHIRUWKHUHVXPSWLRQRI:RUNRU LL VSHFLI\LQJDQ\VSHFLDOFRQGLWLRQV XQGHUZKLFKVXFK:RUNPD\EHUHVXPHG  ),IDIWHUUHFHLSWRIVXFKZULWWHQQRWLFH&RQWUDFWRUGRHVQRWDJUHHWRUHVXPHVXFK:RUNEDVHGRQD UHDVRQDEOH EHOLHI LW LV XQVDIH RU GRHV QRW DJUHH WR UHVXPH VXFK :RUN XQGHU VXFK VSHFLDO FRQGLWLRQVWKHQ&LW\PD\RUGHUWKHSRUWLRQRIWKH:RUNWKDWLVLQWKHDUHDDIIHFWHGE\VXFK FRQGLWLRQ WR EH GHOHWHG IURP WKH :RUN &LW\ PD\ KDYH VXFK GHOHWHG SRUWLRQ RI WKH :RUN SHUIRUPHGE\&LW\¶VRZQIRUFHVRURWKHUV  *To the fullest extent permitted by Laws and Regulations, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to a Hazardous Environmental Condition created by Contractor or by anyone for whom Contractor is responsible. Nothing in this Paragraph 4.06.G shall obligate Contractor to indemnify any individual or entity from and against the consequences of that individual’s or entity’s own negligence.  +7KHSURYLVLRQVRI3DUDJUDSKVDQGGRQRWDSSO\WRD+D]DUGRXV(QYLURQPHQWDO &RQGLWLRQXQFRYHUHGRUUHYHDOHGDWWKH6LWH  $57,&/(±%21'6$1',1685$1&(  Licensed Sureties and Insurers  $OOERQGVDQGLQVXUDQFHUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVWREHSXUFKDVHGDQGPDLQWDLQHGE\ &RQWUDFWRUVKDOOEHREWDLQHGIURPVXUHW\RULQVXUDQFHFRPSDQLHVWKDWDUHGXO\OLFHQVHGRUDXWKRUL]HG LQWKH6WDWHRI7H[DVWRLVVXHERQGVRULQVXUDQFHSROLFLHVIRUWKHOLPLWVDQGFRYHUDJHVVRUHTXLUHG 6XFKVXUHW\DQGLQVXUDQFHFRPSDQLHVVKDOODOVRPHHWVXFKDGGLWLRQDOUHTXLUHPHQWVDQGTXDOLILFDWLRQV DVPD\EHSURYLGHGLQWKH6XSSOHPHQWDU\&RQGLWLRQV  Performance, Payment, and Maintenance Bonds  $&RQWUDFWRUVKDOOIXUQLVKSHUIRUPDQFHDQGSD\PHQWERQGVLQDFFRUGDQFHZLWK7H[DV*RYHUQPHQW &RGH &KDSWHU  RU VXFFHVVRU VWDWXWH HDFK LQ DQ DPRXQW HTXDOWRWKH&RQWUDFW3ULFHDV VHFXULW\IRUWKHIDLWKIXOSHUIRUPDQFHDQGSD\PHQWRIDOORI&RQWUDFWRU¶VREOLJDWLRQVXQGHUWKH &RQWUDFW'RFXPHQWV  %&RQWUDFWRUVKDOOIXUQLVKPDLQWHQDQFHERQGVLQDQDPRXQWHTXDOWRWKH&RQWUDFW3ULFHDVVHFXULW\       433   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 WRSURWHFWWKH&LW\DJDLQVWDQ\GHIHFWVLQDQ\SRUWLRQRIWKH:RUNGHVFULEHGLQWKH&RQWUDFW 'RFXPHQWV0DLQWHQDQFHERQGVVKDOOUHPDLQLQHIIHFWIRUWZR  \HDUVDIWHUWKHGDWHRI)LQDO $FFHSWDQFHE\WKH&LW\  &$OO ERQGV VKDOO EH LQ WKH IRUP SUHVFULEHG E\ WKH &RQWUDFW 'RFXPHQWV H[FHSW DV SURYLGHG RWKHUZLVHE\/DZVRU5HJXODWLRQVDQGVKDOOEHH[HFXWHGE\VXFKVXUHWLHVDVDUHQDPHGLQWKHOLVW RI³&RPSDQLHV+ROGLQJ&HUWLILFDWHVRI$XWKRULW\DV$FFHSWDEOH6XUHWLHVRQ)HGHUDO%RQGVDQG DV$FFHSWDEOH5HLQVXULQJ&RPSDQLHV´DVSXEOLVKHGLQ&LUFXODU DPHQGHG E\WKH)LQDQFLDO 0DQDJHPHQW6HUYLFH6XUHW\%RQG%UDQFK86'HSDUWPHQWRIWKH7UHDVXU\$OOERQGVVLJQHG E\DQDJHQWRUDWWRUQH\LQIDFWPXVWEHDFFRPSDQLHGE\DVHDOHGDQGGDWHGSRZHURIDWWRUQH\ ZKLFKVKDOOVKRZWKDWLWLVHIIHFWLYHRQWKHGDWHWKHDJHQWRUDWWRUQH\LQIDFWVLJQHGHDFKERQG 7KHERQGVPXVWEHGDWHGRQRUDIWHUWKHGDWHRIWKH&RQWUDFW  ',IWKHVXUHW\RQDQ\ERQGIXUQLVKHGE\&RQWUDFWRULVGHFODUHGEDQNUXSWRUEHFRPHVLQVROYHQWRU LWVULJKWWRGREXVLQHVVLVWHUPLQDWHGLQWKH6WDWHRI7H[DVRULWFHDVHVWRPHHWWKHUHTXLUHPHQWVRI 3DUDJUDSK&&RQWUDFWRUVKDOOSURPSWO\QRWLI\&LW\DQGVKDOOZLWKLQGD\VDIWHUWKHHYHQW JLYLQJULVHWRVXFKQRWLILFDWLRQSURYLGHDQRWKHUERQGDQGVXUHW\ERWKRIZKLFKVKDOOFRPSO\ ZLWKWKHUHTXLUHPHQWVRI3DUDJUDSKVDQG&  Certificates of Insurance  $&RQWUDFWRUVKDOOGHOLYHUWR&LW\ZLWKFRSLHVWRHDFKDGGLWLRQDOLQVXUHGDQGORVVSD\HHLGHQWLILHG LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV FHUWLILFDWHV RI LQVXUDQFH DQG RWKHU HYLGHQFH RI LQVXUDQFH UHTXHVWHGE\&LW\RUDQ\RWKHUDGGLWLRQDOLQVXUHG ZKLFK&RQWUDFWRULVUHTXLUHGWRSXUFKDVHDQG PDLQWDLQ  7KHFHUWLILFDWHRILQVXUDQFHVKDOOGRFXPHQWWKH&LW\DQGDOOLGHQWLILHGHQWLWLHVQDPHGLQWKH 6XSSOHPHQWDU\&RQGLWLRQVDV³$GGLWLRQDO,QVXUHG´RQDOOOLDELOLW\SROLFLHV  7KH&RQWUDFWRU¶VJHQHUDOOLDELOLW\LQVXUDQFHVKDOOLQFOXGHD³SHUSURMHFW´RU³SHUORFDWLRQ´ HQGRUVHPHQWZKLFKVKDOOEHLGHQWLILHGLQWKHFHUWLILFDWHRILQVXUDQFHSURYLGHGWRWKH&LW\  7KHFHUWLILFDWHVKDOOEHVLJQHGE\DQDJHQWDXWKRUL]HGWRELQGFRYHUDJHRQEHKDOIRIWKH LQVXUHGEHFRPSOHWHLQLWVHQWLUHW\DQGVKRZFRPSOHWHLQVXUDQFHFDUULHUQDPHVDVOLVWHGLQ WKHFXUUHQW$0%HVW3URSHUW\ &DVXDOW\*XLGH  7KHLQVXUHUVIRUDOOSROLFLHVPXVWEHOLFHQVHGDQGRUDSSURYHGWRGREXVLQHVVLQWKH6WDWHRI 7H[DV([FHSWIRUZRUNHUV¶FRPSHQVDWLRQDOOLQVXUHUVPXVWKDYHDPLQLPXPUDWLQJRI$ 9,,LQWKHFXUUHQW$0%HVW.H\5DWLQJ*XLGHRUKDYHUHDVRQDEO\HTXLYDOHQWILQDQFLDO VWUHQJWKDQGVROYHQF\WRWKHVDWLVIDFWLRQRI5LVN0DQDJHPHQW,IWKHUDWLQJLVEHORZWKDW UHTXLUHGZULWWHQDSSURYDORI&LW\LVUHTXLUHG  $OODSSOLFDEOHSROLFLHVVKDOOLQFOXGHD:DLYHURI6XEURJDWLRQ 5LJKWVRI5HFRYHU\ LQIDYRU RIWKH&LW\,QDGGLWLRQWKH&RQWUDFWRUDJUHHVWRZDLYHDOOULJKWVRIVXEURJDWLRQDJDLQVWWKH (QJLQHHU LI DSSOLFDEOH  DQG HDFK DGGLWLRQDO LQVXUHG LGHQWLILHG LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV       434   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  )DLOXUHRIWKH&LW\WRGHPDQGVXFKFHUWLILFDWHVRURWKHUHYLGHQFHRIIXOOFRPSOLDQFHZLWKWKH LQVXUDQFHUHTXLUHPHQWVRUIDLOXUHRIWKH&LW\WRLGHQWLI\DGHILFLHQF\IURPHYLGHQFHWKDWLV SURYLGHGVKDOOQRWEHFRQVWUXHGDVDZDLYHURI&RQWUDFWRU¶VREOLJDWLRQWRPDLQWDLQVXFKOLQHV RILQVXUDQFHFRYHUDJH  ,ILQVXUDQFHSROLFLHVDUHQRWZULWWHQIRUVSHFLILHGFRYHUDJHOLPLWVDQ8PEUHOODRU([FHVV /LDELOLW\LQVXUDQFHIRUDQ\GLIIHUHQFHVLVUHTXLUHG([FHVV/LDELOLW\VKDOOIROORZIRUPRIWKH SULPDU\FRYHUDJH  8QOHVVRWKHUZLVHVWDWHGDOOUHTXLUHGLQVXUDQFHVKDOOEHZULWWHQRQWKH³RFFXUUHQFHEDVLV´,I FRYHUDJHLVXQGHUZULWWHQRQDFODLPVPDGHEDVLVWKHUHWURDFWLYHGDWHVKDOOEHFRLQFLGHQWZLWK RUSULRUWRWKHGDWHRIWKHHIIHFWLYHGDWHRIWKHDJUHHPHQWDQGWKHFHUWLILFDWHRILQVXUDQFHVKDOO VWDWHWKDWWKHFRYHUDJHLVFODLPVPDGHDQGWKHUHWURDFWLYHGDWH7KHLQVXUDQFHFRYHUDJHVKDOO EH PDLQWDLQHG IRU WKH GXUDWLRQ RI WKH &RQWUDFW DQG IRU WKUHH  \HDUV IROORZLQJ )LQDO $FFHSWDQFHSURYLGHGXQGHUWKH&RQWUDFW'RFXPHQWVRUIRUWKHZDUUDQW\SHULRGZKLFKHYHULV ORQJHU $QDQQXDOFHUWLILFDWHRILQVXUDQFHVXEPLWWHGWRWKH&LW\VKDOOHYLGHQFHVXFK LQVXUDQFHFRYHUDJH  3ROLFLHV VKDOO KDYH QR H[FOXVLRQV E\ HQGRUVHPHQWV ZKLFK QHLWKHU QXOOLI\ RU DPHQG WKH UHTXLUHGOLQHVRIFRYHUDJHQRUGHFUHDVHWKHOLPLWVRIVDLGFRYHUDJHXQOHVVVXFKHQGRUVHPHQWV DUHDSSURYHGLQZULWLQJE\WKH&LW\,QWKHHYHQWD&RQWUDFWKDVEHHQELGRUH[HFXWHGDQGWKH H[FOXVLRQV DUH GHWHUPLQHG WR EH XQDFFHSWDEOH RU WKH &LW\ GHVLUHV DGGLWLRQDO LQVXUDQFH FRYHUDJHDQGWKH&LW\GHVLUHVWKHFRQWUDFWRUHQJLQHHUWRREWDLQVXFKFRYHUDJHWKHFRQWUDFW SULFHVKDOOEHDGMXVWHGE\WKHFRVWRIWKHSUHPLXPIRUVXFKDGGLWLRQDOFRYHUDJHSOXV  $Q\VHOILQVXUHGUHWHQWLRQ 6,5 LQH[FHVVRIDIIHFWLQJUHTXLUHGLQVXUDQFH FRYHUDJHVKDOOEHDSSURYHGE\WKH&LW\LQUHJDUGVWRDVVHWYDOXHDQGVWRFNKROGHUV HTXLW\,Q OLHXRIWUDGLWLRQDOLQVXUDQFHDOWHUQDWLYHFRYHUDJHPDLQWDLQHGWKURXJKLQVXUDQFHSRROVRUULVN UHWHQWLRQJURXSVRUVHOIIXQGLQJPXVWDOVREHDSSURYHGE\&LW\  $Q\GHGXFWLEOHLQH[FHVVRIIRUDQ\SROLF\WKDWGRHVQRWSURYLGHFRYHUDJHRQD ILUVWGROODUEDVLVPXVWEHDFFHSWDEOHWRDQGDSSURYHGE\WKH&LW\  &LW\DWLWVVROHGLVFUHWLRQUHVHUYHVWKHULJKWWRUHYLHZWKHLQVXUDQFHUHTXLUHPHQWVDQGWR PDNH UHDVRQDEOH DGMXVWPHQWV WR LQVXUDQFH FRYHUDJH¶V DQG WKHLU OLPLWV ZKHQ GHHPHG QHFHVVDU\DQGSUXGHQWE\WKH&LW\EDVHGXSRQWKHVFRSHRIWKH:RUNFKDQJHVLQVWDWXWRU\ ODZFRXUWGHFLVLRQRUWKHFODLPVKLVWRU\RIWKHLQGXVWU\DVZHOODVRIWKHFRQWUDFWLQJSDUW\WR WKH&LW\7KH&LW\VKDOOEHUHTXLUHGWRSURYLGHSULRUQRWLFHRIGD\VDQGWKHLQVXUDQFH DGMXVWPHQWVVKDOOEHLQFRUSRUDWHGLQWRWKH:RUNE\&KDQJH2UGHU  &LW\VKDOOEHHQWLWOHGXSRQZULWWHQUHTXHVWDQGZLWKRXWH[SHQVHWRUHFHLYHFRSLHVRISROLFLHV DQGHQGRUVHPHQWVWKHUHWRDQGPD\PDNHDQ\UHDVRQDEOHUHTXHVWVIRUGHOHWLRQRUUHYLVLRQRU PRGLILFDWLRQVRISDUWLFXODUSROLF\WHUPVFRQGLWLRQVOLPLWDWLRQVRUH[FOXVLRQVQHFHVVDU\WR FRQIRUP WKH SROLF\ DQG HQGRUVHPHQWV WR WKH UHTXLUHPHQWV RI WKH&RQWUDFW 'HOHWLRQV UHYLVLRQVRUPRGLILFDWLRQVVKDOOQRWEHUHTXLUHGZKHUHSROLF\SURYLVLRQVDUHHVWDEOLVKHGE\       435   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 ODZRUUHJXODWLRQVELQGLQJXSRQHLWKHUSDUW\RUWKHXQGHUZULWHURQDQ\VXFKSROLFLHV  &LW\VKDOOQRWEHUHVSRQVLEOHIRUWKHGLUHFWSD\PHQWRILQVXUDQFHSUHPLXPFRVWVIRU &RQWUDFWRU¶VLQVXUDQFH  Contractor’s Insurance  $Workers Compensation and Employers’ Liability. &RQWUDFWRUVKDOOSXUFKDVHDQGPDLQWDLQVXFK LQVXUDQFHFRYHUDJHZLWKOLPLWVFRQVLVWHQWZLWKVWDWXWRU\EHQHILWVRXWOLQHGLQWKH7H[DV:RUNHUV¶ &RPSHQVDWLRQ $FW 7H[DV /DERU &RGH &K  DV DPHQGHG  DQG PLQLPXP OLPLWV IRU (PSOR\HUV¶ /LDELOLW\ DV LV DSSURSULDWH IRU WKH :RUN EHLQJ SHUIRUPHG DQG DV ZLOO SURYLGH SURWHFWLRQ IURP FODLPV VHW IRUWK EHORZ ZKLFK PD\ DULVH RXW RI RU UHVXOW IURP &RQWUDFWRU¶V SHUIRUPDQFH RI WKH :RUN DQG &RQWUDFWRU¶V RWKHUREOLJDWLRQVXQGHUWKH&RQWUDFW'RFXPHQWV ZKHWKHULWLVWREHSHUIRUPHGE\&RQWUDFWRUDQ\6XEFRQWUDFWRURU6XSSOLHURUE\DQ\RQHGLUHFWO\ RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH:RUNRUE\DQ\RQHIRUZKRVHDFWV DQ\RIWKHPPD\EHOLDEOH  FODLPVXQGHUZRUNHUV¶FRPSHQVDWLRQGLVDELOLW\EHQHILWVDQGRWKHUVLPLODUHPSOR\HHEHQHILW DFWV  FODLPVIRUGDPDJHVEHFDXVHRIERGLO\LQMXU\RFFXSDWLRQDOVLFNQHVVRUGLVHDVHRUGHDWKRI &RQWUDFWRU¶VHPSOR\HHV  %Commercial General Liability. &RYHUDJHVKDOOLQFOXGHEXWQRWEHOLPLWHGWRFRYHULQJOLDELOLW\ ERGLO\LQMXU\RUSURSHUW\GDPDJH DULVLQJIURPSUHPLVHVRSHUDWLRQVLQGHSHQGHQWFRQWUDFWRUV SURGXFWVFRPSOHWHG RSHUDWLRQV SHUVRQDO LQMXU\ OLDELOLW\ XQGHU DQ LQVXUHG FRQWUDFW DQG H[SORVLRQFROODSVHXQGHUJURXQG ZKHUHWKRVHH[SRVXUHVH[LVW ,QVXUDQFHVKDOOEHSURYLGHGRQDQ RFFXUUHQFHEDVLVDQGDVFRPSUHKHQVLYHDVWKHFXUUHQW,QVXUDQFH6HUYLFHV2IILFH ,62 SROLF\ 7KLVLQVXUDQFHVKDOODSSO\DVSULPDU\LQVXUDQFHZLWKUHVSHFWWRDQ\RWKHU LQVXUDQFHRUVHOILQVXUDQFHSURJUDPVDIIRUGHGWRWKH&LW\7KH&RPPHUFLDO*HQHUDO/LDELOLW\ SROLF\VKDOOKDYHQRH[FOXVLRQVE\HQGRUVHPHQWVWKDWZRXOGDOWHURIQXOOLI\SUHPLVHVRSHUDWLRQV SURGXFWVFRPSOHWHG RSHUDWLRQV FRQWUDFWXDO SHUVRQDO LQMXU\ RU DGYHUWLVLQJ LQMXU\ ZKLFK DUH QRUPDOO\FRQWDLQHGZLWKWKHSROLF\XQOHVVWKH&LW\DSSURYHVVXFKH[FOXVLRQVLQZULWLQJ  )RUFRQVWUXFWLRQSURMHFWVWKDWSUHVHQWDVXEVWDQWLDOFRPSOHWHGRSHUDWLRQH[SRVXUHWKH&LW\PD\ UHTXLUHWKHFRQWUDFWRUWRPDLQWDLQFRPSOHWHGRSHUDWLRQVFRYHUDJHIRUDPLQLPXPRIQROHVVWKDQ WKUHH   \HDUV IROORZLQJ WKH FRPSOHWLRQ RI WKH SURMHFW LI LGHQWLILHG LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV   &Automobile Liability. $FRPPHUFLDOEXVLQHVVDXWRSROLF\VKDOOSURYLGHFRYHUDJHRQ³DQ\DXWR´ GHILQHGDVDXWRVRZQHGKLUHGDQGQRQRZQHGDQGSURYLGHLQGHPQLW\IRUFODLPVIRUGDPDJHV EHFDXVHERGLO\LQMXU\RUGHDWKRIDQ\SHUVRQDQGRUSURSHUW\GDPDJHDULVLQJRXWRIWKHZRUN PDLQWHQDQFHRUXVHRIDQ\PRWRUYHKLFOHE\WKH&RQWUDFWRUDQ\6XEFRQWUDFWRURU6XSSOLHURUE\ DQ\RQHGLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH:RUNRUE\DQ\RQH IRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOH        436   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 'Railroad Protective Liability. ,IDQ\RIWKHZRUNRUDQ\ZDUUDQW\ZRUNLVZLWKLQWKHOLPLWVRI UDLOURDG ULJKWRIZD\ WKH &RQWUDFWRU VKDOO FRPSO\ ZLWK WKH UHTXLUHPHQWV LGHQWLILHG LQ WKH 6XSSOHPHQWDU\&RQGLWLRQV  (Notification of Policy Cancellation: &RQWUDFWRUVKDOOLPPHGLDWHO\QRWLI\&LW\XSRQFDQFHOODWLRQ RURWKHUORVVRILQVXUDQFHFRYHUDJH&RQWUDFWRUVKDOOVWRSZRUNXQWLOUHSODFHPHQWLQVXUDQFHKDV EHHQSURFXUHG7KHUHVKDOOEHQRWLPHFUHGLWIRUGD\VQRWZRUNHGSXUVXDQWWRWKLVVHFWLRQ  Acceptance of Bonds and Insurance; Option to Replace  ,I&LW\KDVDQ\REMHFWLRQWRWKHFRYHUDJHDIIRUGHGE\RURWKHUSURYLVLRQVRIWKHERQGVRULQVXUDQFH UHTXLUHGWREHSXUFKDVHGDQGPDLQWDLQHGE\WKH&RQWUDFWRULQDFFRUGDQFHZLWK$UWLFOHRQWKHEDVLV RIQRQFRQIRUPDQFHZLWKWKH&RQWUDFW'RFXPHQWVWKH&LW\VKDOOVRQRWLI\WKH&RQWUDFWRULQZULWLQJ ZLWKLQ%XVLQHVV'D\VDIWHUUHFHLSWRIWKHFHUWLILFDWHV RURWKHUHYLGHQFHUHTXHVWHG &RQWUDFWRU VKDOOSURYLGHWRWKH&LW\VXFKDGGLWLRQDOLQIRUPDWLRQLQUHVSHFWRILQVXUDQFHSURYLGHGDVWKH&LW\PD\ UHDVRQDEO\ UHTXHVW ,I &RQWUDFWRU GRHV QRW SXUFKDVH RU PDLQWDLQ DOO RI WKH ERQGV DQG LQVXUDQFH UHTXLUHGE\WKH&RQWUDFW'RFXPHQWVWKH&LW\VKDOOQRWLI\WKH&RQWUDFWRULQZULWLQJRIVXFKIDLOXUH SULRUWRWKHVWDUWRIWKH:RUNRURIVXFKIDLOXUHWRPDLQWDLQSULRUWRDQ\FKDQJHLQWKHUHTXLUHG FRYHUDJH  $57,&/(±&2175$&725¶65(63216,%,/,7,(6  Supervision and Superintendence  $&RQWUDFWRUVKDOOVXSHUYLVHLQVSHFWDQGGLUHFWWKH:RUNFRPSHWHQWO\DQGHIILFLHQWO\GHYRWLQJ VXFKDWWHQWLRQWKHUHWRDQGDSSO\LQJVXFKVNLOOVDQGH[SHUWLVHDVPD\EHQHFHVVDU\WRSHUIRUPWKH :RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOEHVROHO\UHVSRQVLEOHIRUWKH PHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRIFRQVWUXFWLRQ  %$W DOO WLPHV GXULQJ WKH SURJUHVV RI WKH :RUN &RQWUDFWRU VKDOODVVLJQ D FRPSHWHQW 6XSHULQWHQGHQWZKRLVSURILFLHQWLQ(QJOLVKDQGZKRVKDOOQRWEHUHSODFHGZLWKRXWZULWWHQ QRWLFHWR&LW\,IDWDQ\WLPHWKH6XSHULQWHQGHQWLVQRWVDWLVIDFWRU\WRWKH&LW\&RQWUDFWRUVKDOOLI UHTXHVWHGE\&LW\UHSODFHWKH6XSHULQWHQGHQWZLWKDQRWKHUVDWLVIDFWRU\WR&LW\  &&RQWUDFWRU VKDOO QRWLI\ WKH &LW\  KRXUV SULRU WR PRYLQJ DUHDV GXULQJ WKH VHTXHQFH RI FRQVWUXFWLRQ  Labor; Working Hours  $&RQWUDFWRU VKDOO SURYLGH FRPSHWHQW VXLWDEO\ TXDOLILHG SHUVRQQHO WR SHUIRUP FRQVWUXFWLRQ DV UHTXLUHGE\WKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOODWDOOWLPHVPDLQWDLQJRRGGLVFLSOLQHDQG RUGHUDWWKH6LWH  %([FHSWDVRWKHUZLVHUHTXLUHGIRUWKHVDIHW\RUSURWHFWLRQRISHUVRQVRUWKH:RUNRUSURSHUW\DW WKH6LWHRUDGMDFHQWWKHUHWRDQGH[FHSWDVRWKHUZLVHVWDWHGLQWKH&RQWUDFW'RFXPHQWVDOO:RUN DWWKH6LWHVKDOOEHSHUIRUPHGGXULQJ5HJXODU:RUNLQJ+RXUV&RQWUDFWRUZLOOQRWSHUPLWWKH       437   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 SHUIRUPDQFHRI:RUNEH\RQG5HJXODU:RUNLQJ+RXUVRUIRU:HHNHQG:RUNLQJ+RXUVZLWKRXW &LW\¶VZULWWHQFRQVHQW ZKLFKZLOOQRWEHXQUHDVRQDEO\ZLWKKHOG :ULWWHQUHTXHVW E\OHWWHURU HOHFWURQLFFRPPXQLFDWLRQ WRSHUIRUP:RUN  IRUEH\RQG5HJXODU:RUNLQJ+RXUVUHTXHVWPXVWEHPDGHE\QRRQDWOHDVWWZR  %XVLQHVV 'D\VSULRU  IRU:HHNHQG:RUNLQJ+RXUVUHTXHVWPXVWEHPDGHE\QRRQRIWKHSUHFHGLQJ:HGQHVGD\  IRU OHJDO KROLGD\V UHTXHVW PXVW EH PDGH E\ QRRQ VHYHQ 'D\V SULRU WR WKH OHJDO KROLGD\  Services, Materials, and Equipment  $8QOHVVRWKHUZLVHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOSURYLGHDQGDVVXPHIXOO UHVSRQVLELOLW\IRUDOOVHUYLFHVPDWHULDOVHTXLSPHQWODERUWUDQVSRUWDWLRQFRQVWUXFWLRQHTXLSPHQW DQGPDFKLQHU\WRROVDSSOLDQFHVIXHOSRZHUOLJKWKHDWWHOHSKRQHZDWHUVDQLWDU\IDFLOLWLHV WHPSRUDU\ IDFLOLWLHV DQG DOO RWKHU IDFLOLWLHV DQG LQFLGHQWDOVQHFHVVDU\ IRU WKH SHUIRUPDQFH &RQWUDFWRUUHTXLUHGWHVWLQJVWDUWXSDQGFRPSOHWLRQRIWKH:RUNZKHWKHURUQRWVXFKLWHPVDUH VSHFLILFDOO\FDOOHGIRULQWKH&RQWUDFW'RFXPHQWV  %$OOPDWHULDOVDQGHTXLSPHQWLQFRUSRUDWHGLQWRWKH:RUNVKDOOEHDVVSHFLILHGRULIQRWVSHFLILHG VKDOOEHRIVXIILFLHQWTXDOLW\WRFRPSOHWHWKH:RUNDQGQHZH[FHSWDVRWKHUZLVHSURYLGHGLQWKH &RQWUDFW'RFXPHQWV$OOVSHFLDOZDUUDQWLHVDQGJXDUDQWHHVUHTXLUHGE\WKH6SHFLILFDWLRQVVKDOO H[SUHVVO\UXQWRWKHEHQHILWRI&LW\,IUHTXLUHGE\&LW\&RQWUDFWRUVKDOOIXUQLVKVDWLVIDFWRU\ HYLGHQFH LQFOXGLQJUHSRUWVRIUHTXLUHGWHVWV DVWRWKHVRXUFHNLQGDQGTXDOLW\RIPDWHULDOVDQG HTXLSPHQW  &$OOPDWHULDOVDQGHTXLSPHQWWREHLQFRUSRUDWHGLQWRWKH:RUNVKDOOEHVWRUHGDSSOLHGLQVWDOOHG FRQQHFWHGHUHFWHGSURWHFWHGXVHGFOHDQHGDQGFRQGLWLRQHGLQDFFRUGDQFHZLWKLQVWUXFWLRQVRI WKHDSSOLFDEOH6XSSOLHUH[FHSWDVRWKHUZLVHPD\EHSURYLGHGLQWKH&RQWUDFW'RFXPHQWV  '$OOLWHPVRIVWDQGDUGHTXLSPHQWWREHLQFRUSRUDWHGLQWRWKH:RUNVKDOOEHWKHODWHVWPRGHODWWKH WLPHRIELGXQOHVVRWKHUZLVHVSHFLILHG  Project Schedule  $&RQWUDFWRUVKDOODGKHUHWRWKH3URMHFW6FKHGXOHHVWDEOLVKHGLQDFFRUGDQFHZLWK3DUDJUDSK DQGWKH*HQHUDO5HTXLUHPHQWVDVLWPD\EHDGMXVWHGIURPWLPHWRWLPHDVSURYLGHGEHORZ  &RQWUDFWRUVKDOOVXEPLWWR&LW\IRUDFFHSWDQFH WRWKHH[WHQWLQGLFDWHGLQ3DUDJUDSKDQG WKH*HQHUDO5HTXLUHPHQWV SURSRVHGDGMXVWPHQWVLQWKH3URMHFW6FKHGXOHWKDWZLOOQRWUHVXOW LQFKDQJLQJWKH&RQWUDFW7LPH6XFKDGMXVWPHQWVZLOOFRPSO\ZLWKDQ\SURYLVLRQVRIWKH *HQHUDO5HTXLUHPHQWVDSSOLFDEOHWKHUHWR  &RQWUDFWRUVKDOOVXEPLWWR&LW\DPRQWKO\3URMHFW6FKHGXOHZLWKDPRQWKO\SURJUHVVSD\PHQW       438   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 IRUWKHGXUDWLRQRIWKH&RQWUDFWLQDFFRUGDQFHZLWKWKHVFKHGXOHVSHFLILFDWLRQ  3URSRVHGDGMXVWPHQWVLQWKH3URMHFW6FKHGXOHWKDWZLOOFKDQJHWKH&RQWUDFW7LPHVKDOOEH VXEPLWWHGLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRI$UWLFOH$GMXVWPHQWVLQ&RQWUDFW7LPH PD\RQO\EHPDGHE\D&KDQJH2UGHU  Substitutes and “Or-Equals”  $:KHQHYHUDQLWHPRIPDWHULDORUHTXLSPHQWLVVSHFLILHGRUGHVFULEHGLQWKH&RQWUDFW'RFXPHQWV E\XVLQJWKHQDPHRIDSURSULHWDU\LWHPRUWKHQDPHRIDSDUWLFXODU6XSSOLHUWKHVSHFLILFDWLRQRU GHVFULSWLRQLVLQWHQGHGWRHVWDEOLVKWKHW\SHIXQFWLRQDSSHDUDQFHDQGTXDOLW\UHTXLUHG8QOHVV WKHVSHFLILFDWLRQRUGHVFULSWLRQFRQWDLQVRULVIROORZHGE\ZRUGVUHDGLQJWKDWQROLNHHTXLYDOHQW RU³RUHTXDO´LWHPRUQRVXEVWLWXWLRQLVSHUPLWWHGRWKHULWHPVRIPDWHULDORUHTXLSPHQWRIRWKHU 6XSSOLHUVPD\EHVXEPLWWHGWR&LW\IRUUHYLHZXQGHUWKHFLUFXPVWDQFHVGHVFULEHGEHORZ  “Or-Equal” Items: ,ILQ&LW\¶VVROHGLVFUHWLRQDQLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGE\ &RQWUDFWRULVIXQFWLRQDOO\HTXDOWRWKDWQDPHGDQGVXIILFLHQWO\VLPLODUVRWKDWQRFKDQJHLQ UHODWHG:RUNZLOOEHUHTXLUHGLWPD\EHFRQVLGHUHGE\&LW\DVDQ³RUHTXDO´LWHPLQZKLFK FDVH UHYLHZ DQG DSSURYDO RI WKH SURSRVHG LWHP PD\ LQ &LW\¶V VROH GLVFUHWLRQ EH DFFRPSOLVKHG ZLWKRXW FRPSOLDQFH ZLWK VRPH RU DOO RI WKH UHTXLUHPHQWV IRU DSSURYDO RI SURSRVHGVXEVWLWXWHLWHPV)RUWKHSXUSRVHVRIWKLV3DUDJUDSK$DSURSRVHGLWHPRI PDWHULDORUHTXLSPHQWZLOOEHFRQVLGHUHGIXQFWLRQDOO\HTXDOWRDQLWHPVRQDPHGLI  DWKH&LW\GHWHUPLQHVWKDW   LWLVDWOHDVWHTXDOLQPDWHULDOVRIFRQVWUXFWLRQTXDOLW\GXUDELOLW\DSSHDUDQFH VWUHQJWKDQGGHVLJQFKDUDFWHULVWLFV   LWZLOOUHOLDEO\SHUIRUPDWOHDVWHTXDOO\ZHOOWKHIXQFWLRQDQGDFKLHYHWKHUHVXOWV LPSRVHGE\WKHGHVLJQFRQFHSWRIWKHFRPSOHWHG3URMHFWDVDIXQFWLRQLQJZKROHDQG   LWKDVDSURYHQUHFRUGRISHUIRUPDQFHDQGDYDLODELOLW\RIUHVSRQVLYHVHUYLFHDQG   LWLVQRWREMHFWLRQDEOHWRWKH&LW\E&RQWUDFWRUFHUWLILHVWKDWLIDSSURYHGDQGLQFRUSRUDWHGLQWRWKH:RUN  WKHUHZLOOEHQRLQFUHDVHLQFRVWWRWKH&LW\RULQFUHDVHLQ&RQWUDFW7LPHDQG   LWZLOOFRQIRUPVXEVWDQWLDOO\WRWKHGHWDLOHGUHTXLUHPHQWVRIWKHLWHPQDPHGLQWKH &RQWUDFW'RFXPHQWV  Substitute Items:  D,ILQ&LW\¶VVROHGLVFUHWLRQDQLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGE\&RQWUDFWRUGRHV QRWTXDOLI\DVDQ³RUHTXDO´LWHPXQGHU3DUDJUDSK$LWPD\EHVXEPLWWHGDVD       439   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 SURSRVHGVXEVWLWXWHLWHP  E&RQWUDFWRU VKDOO VXEPLW VXIILFLHQW LQIRUPDWLRQ DV SURYLGHG EHORZ WR DOORZ &LW\ WR GHWHUPLQHLIWKHLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGLVHVVHQWLDOO\HTXLYDOHQWWRWKDW QDPHGDQGDQDFFHSWDEOHVXEVWLWXWHWKHUHIRU5HTXHVWVIRUUHYLHZRISURSRVHGVXEVWLWXWH LWHPVRIPDWHULDORUHTXLSPHQWZLOOQRWEHDFFHSWHGE\&LW\IURPDQ\RQHRWKHUWKDQ &RQWUDFWRU  F&RQWUDFWRUVKDOOPDNHZULWWHQDSSOLFDWLRQWR&LW\IRUUHYLHZRIDSURSRVHGVXEVWLWXWHLWHP RIPDWHULDORUHTXLSPHQWWKDW&RQWUDFWRUVHHNVWRIXUQLVKRUXVH7KHDSSOLFDWLRQVKDOO FRPSO\ZLWK6HFWLRQDQG   VKDOOFHUWLI\WKDWWKHSURSRVHGVXEVWLWXWHLWHPZLOO  D SHUIRUPDGHTXDWHO\WKHIXQFWLRQVDQGDFKLHYHWKHUHVXOWVFDOOHGIRUE\WKHJHQHUDO GHVLJQ  E EHVLPLODULQVXEVWDQFHWRWKDWVSHFLILHG  F EHVXLWHGWRWKHVDPHXVHDVWKDWVSHFLILHGDQG   ZLOOVWDWH  D WKHH[WHQWLIDQ\WRZKLFKWKHXVHRIWKHSURSRVHGVXEVWLWXWHLWHPZLOOSUHMXGLFH &RQWUDFWRU¶VDFKLHYHPHQWRIILQDOFRPSOHWLRQRQWLPH  E ZKHWKHUXVHRIWKHSURSRVHGVXEVWLWXWHLWHPLQWKH:RUNZLOOUHTXLUHDFKDQJHLQ DQ\RIWKH&RQWUDFW'RFXPHQWV RULQWKHSURYLVLRQVRIDQ\RWKHUGLUHFWFRQWUDFW ZLWK&LW\IRURWKHUZRUNRQWKH3URMHFW WRDGDSWWKHGHVLJQWRWKHSURSRVHG VXEVWLWXWHLWHP  F ZKHWKHULQFRUSRUDWLRQRUXVHRIWKHSURSRVHGVXEVWLWXWHLWHPLQFRQQHFWLRQZLWK WKH:RUNLVVXEMHFWWRSD\PHQWRIDQ\OLFHQVHIHHRUUR\DOW\DQG   ZLOOLGHQWLI\  D DOOYDULDWLRQVRIWKHSURSRVHGVXEVWLWXWHLWHPIURPWKDWVSHFLILHG  E DYDLODEOHHQJLQHHULQJVDOHVPDLQWHQDQFHUHSDLUDQGUHSODFHPHQWVHUYLFHVDQG   VKDOOFRQWDLQDQLWHPL]HGHVWLPDWHRIDOOFRVWVRUFUHGLWVWKDWZLOOUHVXOWGLUHFWO\RU LQGLUHFWO\IURPXVHRIVXFKVXEVWLWXWHLWHPLQFOXGLQJFRVWVRIUHGHVLJQDQG'DPDJH &ODLPVRIRWKHUFRQWUDFWRUVDIIHFWHGE\DQ\UHVXOWLQJFKDQJH  %Substitute Construction Methods or Procedures: ,I D VSHFLILF PHDQV PHWKRG WHFKQLTXH VHTXHQFH RU SURFHGXUH RI FRQVWUXFWLRQ LV H[SUHVVO\ UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV &RQWUDFWRUPD\IXUQLVKRUXWLOL]HDVXEVWLWXWHPHDQVPHWKRGWHFKQLTXHVHTXHQFHRUSURFHGXUH       440   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 RIFRQVWUXFWLRQDSSURYHGE\&LW\&RQWUDFWRUVKDOOVXEPLWVXIILFLHQWLQIRUPDWLRQWRDOORZ&LW\LQ &LW\¶VVROHGLVFUHWLRQWRGHWHUPLQHWKDWWKHVXEVWLWXWHSURSRVHGLVHTXLYDOHQWWRWKDWH[SUHVVO\ FDOOHGIRUE\WKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOPDNHZULWWHQDSSOLFDWLRQWR&LW\IRU UHYLHZLQWKHVDPHPDQQHUDVWKRVHSURYLGHGLQ3DUDJUDSK$  &City’s Evaluation: &LW\ ZLOO EH DOORZHG D UHDVRQDEOH WLPH ZLWKLQ ZKLFK WR HYDOXDWH HDFK SURSRVDO RU VXEPLWWDO PDGH SXUVXDQW WR 3DUDJUDSKV $ DQG % &LW\ PD\ UHTXLUH &RQWUDFWRUWRIXUQLVKDGGLWLRQDOGDWDDERXWWKHSURSRVHGVXEVWLWXWH&LW\ZLOOEHWKHVROHMXGJHRI DFFHSWDELOLW\1R³RUHTXDO´RUVXEVWLWXWHZLOOEHRUGHUHGLQVWDOOHGRUXWLOL]HGXQWLO&LW\¶VUHYLHZ LVFRPSOHWHZKLFKZLOOEHHYLGHQFHGE\D&KDQJH2UGHULQWKHFDVHRIDVXEVWLWXWHDQGDQ DFFHSWHG6XEPLWWDOIRUDQ³RUHTXDO´&LW\ZLOODGYLVH&RQWUDFWRULQZULWLQJRILWVGHWHUPLQDWLRQ  'Special Guarantee: &LW\PD\UHTXLUH&RQWUDFWRUWRIXUQLVKDW&RQWUDFWRU¶VH[SHQVHDVSHFLDO SHUIRUPDQFHJXDUDQWHHZDUUDQW\RURWKHUVXUHW\ZLWKUHVSHFWWRDQ\VXEVWLWXWHContractor shall indemnify and hold harmless City and anyone directly or indirectly employed by them from and against any and all claims, damages, losses and expenses (including attorneys fees) arising out of the use of substituted materials or equipment.  (City’s Cost Reimbursement&LW\ZLOOUHFRUG&LW\¶VFRVWVLQHYDOXDWLQJDVXEVWLWXWHSURSRVHGRU VXEPLWWHG E\ &RQWUDFWRU SXUVXDQW WR 3DUDJUDSKV $ DQG % :KHWKHU RU QRW &LW\ DSSURYHVDVXEVWLWXWHVRSURSRVHGRUVXEPLWWHGE\&RQWUDFWRU&RQWUDFWRUPD\EHUHTXLUHGWR UHLPEXUVH&LW\IRUHYDOXDWLQJHDFKVXFKSURSRVHGVXEVWLWXWH&RQWUDFWRUPD\DOVREHUHTXLUHGWR UHLPEXUVH &LW\ IRU WKH FKDUJHV IRU PDNLQJ FKDQJHV LQ WKH &RQWUDFW 'RFXPHQWV RU LQ WKH SURYLVLRQVRIDQ\RWKHUGLUHFWFRQWUDFWZLWK&LW\ UHVXOWLQJIURPWKHDFFHSWDQFHRIHDFKSURSRVHG VXEVWLWXWH  )Contractor’s Expense&RQWUDFWRUVKDOOSURYLGHDOOGDWDLQVXSSRUWRIDQ\SURSRVHGVXEVWLWXWHRU ³RUHTXDO´DW&RQWUDFWRU¶VH[SHQVH  *City Substitute Reimbursement &RVWV VDYLQJV RU FKDUJHV  DWWULEXWDEOH WR DFFHSWDQFH RI D VXEVWLWXWHVKDOOEHLQFRUSRUDWHGWRWKH&RQWUDFWE\&KDQJH2UGHU  +Time Extensions1RDGGLWLRQDOWLPHZLOOEHJUDQWHGIRUVXEVWLWXWLRQV  Concerning Subcontractors, Suppliers, and Others  $&RQWUDFWRUVKDOOSHUIRUPZLWKKLVRZQRUJDQL]DWLRQZRUNRIDYDOXHQRWOHVVWKDQRIWKH YDOXHHPEUDFHGRQWKH&RQWUDFWXQOHVVRWKHUZLVHDSSURYHGE\WKH&LW\  %&RQWUDFWRUVKDOOQRWHPSOR\DQ\6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\ZKHWKHU LQLWLDOO\RUDVDUHSODFHPHQWDJDLQVWZKRP&LW\PD\KDYHUHDVRQDEOHREMHFWLRQ&RQWUDFWRUVKDOO QRWEHUHTXLUHGWRHPSOR\DQ\6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\WRIXUQLVKRU SHUIRUPDQ\RIWKH:RUNDJDLQVWZKRP&RQWUDFWRUKDVUHDVRQDEOHREMHFWLRQ H[FOXGLQJWKRVH DFFHSWDEOHWR&LW\DVLQGLFDWHGLQ3DUDJUDSK&   &7KH&LW\PD\IURPWLPHWRWLPHUHTXLUHWKHXVHRIFHUWDLQ6XEFRQWUDFWRUV6XSSOLHUVRURWKHU       441   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 LQGLYLGXDOVRUHQWLWLHVRQWKHSURMHFWDQGZLOOSURYLGHVXFKUHTXLUHPHQWVLQWKH6XSSOHPHQWDU\ &RQGLWLRQV  '&RQWUDFWRUVKDOOEHIXOO\UHVSRQVLEOHWR&LW\IRUDOODFWVDQGRPLVVLRQVRIWKH6XEFRQWUDFWRUV 6XSSOLHUVDQGRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJDQ\RIWKH:RUNMXVWDV &RQWUDFWRU LV UHVSRQVLEOH IRU &RQWUDFWRU¶V RZQ DFWV DQG RPLVVLRQV 1RWKLQJ LQ WKH &RQWUDFW 'RFXPHQWV  VKDOOFUHDWHIRUWKHEHQHILWRIDQ\VXFK6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\ DQ\ FRQWUDFWXDO UHODWLRQVKLS EHWZHHQ &LW\ DQG DQ\ VXFK 6XEFRQWUDFWRU 6XSSOLHU RU RWKHU LQGLYLGXDORUHQWLW\QRU  VKDOOFUHDWHDQ\REOLJDWLRQRQWKHSDUWRI&LW\WRSD\RUWRVHHWRWKHSD\PHQWRIDQ\PRQH\V GXHDQ\VXFK6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\H[FHSWDVPD\RWKHUZLVH EHUHTXLUHGE\/DZVDQG5HJXODWLRQV  (&RQWUDFWRU VKDOO EH VROHO\ UHVSRQVLEOH IRU VFKHGXOLQJ DQG FRRUGLQDWLQJ WKH :RUN RI 6XEFRQWUDFWRUV6XSSOLHUVDQGRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJDQ\RIWKH :RUNXQGHUDGLUHFWRULQGLUHFWFRQWUDFWZLWK&RQWUDFWRU  )$OO6XEFRQWUDFWRUV6XSSOLHUVDQGVXFKRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJDQ\ RIWKH:RUNVKDOOFRPPXQLFDWHZLWK&LW\WKURXJK&RQWUDFWRU  *$OO :RUN SHUIRUPHG IRU &RQWUDFWRU E\ D 6XEFRQWUDFWRU RU 6XSSOLHU ZLOO EH SXUVXDQW WR DQ DSSURSULDWHDJUHHPHQWEHWZHHQ&RQWUDFWRUDQGWKH6XEFRQWUDFWRURU6XSSOLHUZKLFKVSHFLILFDOO\ ELQGV WKH 6XEFRQWUDFWRU RU 6XSSOLHU WR WKH DSSOLFDEOH WHUPV DQG FRQGLWLRQV RI WKH &RQWUDFW 'RFXPHQWVIRUWKHEHQHILWRI&LW\  Wage Rates  $Duty to pay Prevailing Wage Rates. 7KH &RQWUDFWRU VKDOO FRPSO\ ZLWK DOO UHTXLUHPHQWV RI &KDSWHU7H[DV*RYHUQPHQW&RGH DVDPHQGHG LQFOXGLQJWKHSD\PHQWRIQRWOHVVWKDQWKH UDWHVGHWHUPLQHGE\WKH&LW\&RXQFLORIWKH&LW\RI'HQWRQWREHWKHSUHYDLOLQJZDJHUDWHVLQ DFFRUGDQFH ZLWK &KDSWHU  6XFK SUHYDLOLQJ ZDJH UDWHV DUH LQFOXGHG LQ WKHVH &RQWUDFW 'RFXPHQWV  %Penalty for Violation. $&RQWUDFWRURUDQ\6XEFRQWUDFWRUZKRGRHVQRWSD\WKHSUHYDLOLQJZDJH VKDOOXSRQGHPDQGPDGHE\WKH&LW\SD\WRWKH&LW\IRUHDFKZRUNHUHPSOR\HGIRUHDFK FDOHQGDU GD\ RU SDUW RI WKH GD\ WKDW WKH ZRUNHU LV SDLG OHVV WKDQ WKH SUHYDLOLQJ ZDJH UDWHV VWLSXODWHGLQWKHVHFRQWUDFWGRFXPHQWV7KLVSHQDOW\VKDOOEHUHWDLQHGE\WKH&LW\WRRIIVHWLWV DGPLQLVWUDWLYHFRVWVSXUVXDQWWR7H[DV*RYHUQPHQW&RGH  &Complaints of Violations and City Determination of Good Cause. 2QUHFHLSWRILQIRUPDWLRQ LQFOXGLQJ D FRPSODLQW E\ D ZRUNHU FRQFHUQLQJ DQ DOOHJHG YLRODWLRQ RI  7H[DV *RYHUQPHQW &RGH E\ D &RQWUDFWRU RU 6XEFRQWUDFWRU WKH&LW\ VKDOO PDNH DQ LQLWLDO GHWHUPLQDWLRQEHIRUHWKHVWGD\DIWHUWKHGDWHWKH&LW\UHFHLYHVWKHLQIRUPDWLRQDVWRZKHWKHU       442   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 JRRGFDXVHH[LVWVWREHOLHYHWKDWWKHYLRODWLRQRFFXUUHG 7KH&LW\VKDOOQRWLI\LQZULWLQJWKH &RQWUDFWRURU6XEFRQWUDFWRUDQGDQ\DIIHFWHGZRUNHURILWVLQLWLDOGHWHUPLQDWLRQ 8SRQWKH&LW\¶V GHWHUPLQDWLRQWKDWWKHUHLVJRRGFDXVHWREHOLHYHWKH&RQWUDFWRURU6XEFRQWUDFWRUKDVYLRODWHG &KDSWHUWKH&LW\VKDOOUHWDLQWKHIXOODPRXQWVFODLPHGE\WKHFODLPDQWRUFODLPDQWVDVWKH GLIIHUHQFHEHWZHHQZDJHVSDLGDQGZDJHVGXHXQGHUWKHSUHYDLOLQJZDJHUDWHVVXFKDPRXQWV EHLQJ VXEWUDFWHG IURP VXFFHVVLYH SURJUHVV SD\PHQWV SHQGLQJ D ILQDO GHWHUPLQDWLRQ RI WKH YLRODWLRQ  'Arbitration Required if Violation Not Resolved. $Q LVVXH UHODWLQJ WR DQ DOOHJHG YLRODWLRQ RI 6HFWLRQ7H[DV*RYHUQPHQW&RGHLQFOXGLQJDSHQDOW\RZHGWRWKH&LW\RUDQDIIHFWHG ZRUNHU VKDOO EH VXEPLWWHG WR ELQGLQJ DUELWUDWLRQ LQ DFFRUGDQFH ZLWK WKH 7H[DV *HQHUDO $UELWUDWLRQ$FW $UWLFOHHWVHT5HYLVHG6WDWXWHV LIWKH&RQWUDFWRURU6XEFRQWUDFWRUDQGDQ\ DIIHFWHGZRUNHUGRHVQRWUHVROYHWKHLVVXHE\DJUHHPHQWEHIRUHWKHWKGD\DIWHUWKHGDWHWKH &LW\PDNHVLWVLQLWLDOGHWHUPLQDWLRQSXUVXDQWWR3DUDJUDSK&DERYH,IWKHSHUVRQVUHTXLUHGWR DUELWUDWHXQGHUWKLVVHFWLRQGRQRWDJUHHRQDQDUELWUDWRUEHIRUHWKHWKGD\DIWHUWKHGDWHWKDW DUELWUDWLRQLVUHTXLUHGDGLVWULFWFRXUWVKDOODSSRLQWDQDUELWUDWRURQWKHSHWLWLRQRIDQ\RIWKH SHUVRQV7KH&LW\LVQRWDSDUW\LQWKHDUELWUDWLRQ7KHGHFLVLRQDQGDZDUGRIWKHDUELWUDWRULV ILQDODQGELQGLQJRQDOOSDUWLHVDQGPD\EHHQIRUFHGLQDQ\FRXUWRIFRPSHWHQWMXULVGLFWLRQ  (Records to be Maintained. 7KH&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUVKDOOIRUDSHULRGRIWKUHH   \HDUVIROORZLQJWKHGDWHRIDFFHSWDQFHRIWKHZRUNPDLQWDLQUHFRUGVWKDWVKRZ L WKHQDPHDQG RFFXSDWLRQRIHDFKZRUNHUHPSOR\HGE\WKH&RQWUDFWRULQWKHFRQVWUXFWLRQRIWKH:RUNSURYLGHG IRULQWKLV&RQWUDFWDQG LL WKHDFWXDOSHUGLHPZDJHVSDLGWRHDFKZRUNHU7KHUHFRUGVVKDOOEH RSHQDWDOOUHDVRQDEOHKRXUVIRULQVSHFWLRQE\WKH&LW\7KHSURYLVLRQVRI3DUDJUDSK5LJKW WR$XGLWVKDOOSHUWDLQWRWKLVLQVSHFWLRQ  )Progress Payments :LWK HDFK SURJUHVV SD\PHQW RU SD\UROO SHULRG ZKLFKHYHU LV OHVV WKH &RQWUDFWRU VKDOO VXEPLW DQ DIILGDYLW VWDWLQJ WKDW WKH &RQWUDFWRU KDV FRPSOLHG ZLWK WKH UHTXLUHPHQWVRI&KDSWHU7H[DV*RYHUQPHQW&RGH  *Posting of Wage Rates7KH&RQWUDFWRUVKDOOSRVWSUHYDLOLQJZDJHUDWHVLQDFRQVSLFXRXVSODFHDW DOOWLPHV  +Subcontractor Compliance7KH&RQWUDFWRUVKDOOLQFOXGHLQLWVVXEFRQWUDFWVDQGRUVKDOO RWKHUZLVHUHTXLUHDOORILWV6XEFRQWUDFWRUVWRFRPSO\ZLWK3DUDJUDSKV$WKURXJK*DERYH  Patent Fees and Royalties  $&RQWUDFWRUVKDOOSD\DOOOLFHQVHIHHVDQGUR\DOWLHVDQGDVVXPHDOOFRVWVLQFLGHQWWRWKHXVHLQWKH SHUIRUPDQFHRIWKH:RUNRUWKHLQFRUSRUDWLRQLQWKH:RUNRIDQ\LQYHQWLRQGHVLJQSURFHVV SURGXFW RU GHYLFH ZKLFK LV WKH VXEMHFW RI SDWHQW ULJKWV RU FRS\ULJKWV KHOG E\ RWKHUV ,I D SDUWLFXODULQYHQWLRQGHVLJQSURFHVVSURGXFWRUGHYLFHLVVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV IRUXVHLQWKHSHUIRUPDQFHRIWKH:RUNDQGLIWRWKHDFWXDONQRZOHGJHRI&LW\LWVXVHLVVXEMHFW WRSDWHQWULJKWVRUFRS\ULJKWVFDOOLQJIRUWKHSD\PHQWRIDQ\OLFHQVHIHHRUUR\DOW\WRRWKHUVWKH H[LVWHQFHRIVXFKULJKWVVKDOOEHGLVFORVHGE\&LW\LQWKH&RQWUDFW'RFXPHQWV)DLOXUHRIWKH&LW\ WRGLVFORVHVXFKLQIRUPDWLRQGRHVQRWUHOLHYHWKH&RQWUDFWRUIURPLWVREOLJDWLRQVWRSD\IRUWKH       443   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 XVHRIVDLGIHHVRUUR\DOWLHVWRRWKHUV  %To the fullest extent permitted by Laws and Regulations, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to any infringement of patent rights or copyrights incident to the use in the performance of the Work or resulting from the incorporation in the Work of any invention, design, process, product, or device not specified in the Contract Documents.  Permits and Utilities  $Contractor obtained permits and licenses. &RQWUDFWRUVKDOOREWDLQDQGSD\IRUDOOFRQVWUXFWLRQ SHUPLWVDQGOLFHQVHVH[FHSWWKRVHSURYLGHGIRULQWKH6XSSOHPHQWDU\&RQGLWLRQVRU&RQWUDFW 'RFXPHQWV&LW\VKDOODVVLVW&RQWUDFWRUZKHQQHFHVVDU\LQREWDLQLQJVXFKSHUPLWVDQGOLFHQVHV &RQWUDFWRUVKDOOSD\DOOJRYHUQPHQWDOFKDUJHVDQGLQVSHFWLRQIHHVQHFHVVDU\IRUWKHSURVHFXWLRQ RIWKH:RUNZKLFKDUHDSSOLFDEOHDWWKHWLPHRIRSHQLQJRI%LGVRULIWKHUHDUHQR%LGVRQWKH (IIHFWLYH'DWHRIWKH$JUHHPHQWH[FHSWIRUSHUPLWVSURYLGHGE\WKH&LW\DVVSHFLILHGLQ% &LW\VKDOOSD\DOOFKDUJHVRIXWLOLW\RZQHUVIRUFRQQHFWLRQVIRUSURYLGLQJSHUPDQHQWVHUYLFHWRWKH :RUN  %City obtained permits and licenses. &LW\ZLOOREWDLQDQGSD\IRUDOOSHUPLWVDQGOLFHQVHVDV SURYLGHGIRULQWKH6XSSOHPHQWDU\&RQGLWLRQVRU&RQWUDFW'RFXPHQWV,WZLOOEHWKH&RQWUDFWRU¶V UHVSRQVLELOLW\WRFDUU\RXWWKHSURYLVLRQVRIWKHSHUPLW,IWKH&RQWUDFWRULQLWLDWHVFKDQJHVWRWKH &RQWUDFW DQG WKH &LW\ DSSURYHV WKH FKDQJHV WKH &RQWUDFWRU LV UHVSRQVLEOH IRU REWDLQLQJ FOHDUDQFHVDQGFRRUGLQDWLQJZLWKWKHDSSURSULDWHUHJXODWRU\DJHQF\7KH&LW\ZLOOQRWUHLPEXUVH WKH&RQWUDFWRUIRUDQ\FRVWDVVRFLDWHGZLWKWKHVHUHTXLUHPHQWVRIDQ\&LW\DFTXLUHGSHUPLW7KH IROORZLQJDUHSHUPLWVWKH&LW\ZLOOREWDLQLIUHTXLUHG  7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQ3HUPLWV  86$UP\&RUSVRI(QJLQHHUV3HUPLWV  7H[DV&RPPLVVLRQRQ(QYLURQPHQWDO4XDOLW\3HUPLWV  5DLOURDG&RPSDQ\3HUPLWV  7H[DV'HSDUWPHQWRI/LFHQVLQJDQG5HJXODWLRQ 7'/5 3HUPLWV  &Outstanding permits and licenses. 7KH&LW\DQWLFLSDWHVDFTXLVLWLRQRIDQGRUDFFHVVWRSHUPLWV DQGOLFHQVHV$Q\RXWVWDQGLQJSHUPLWVDQGOLFHQVHVDUHDQWLFLSDWHGWREHDFTXLUHGLQDFFRUGDQFH ZLWKWKHVFKHGXOHVHWIRUWKLQWKH6XSSOHPHQWDU\&RQGLWLRQV7KH3URMHFW6FKHGXOHVXEPLWWHGE\ WKH &RQWUDFWRU LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV PXVW FRQVLGHU DQ\ RXWVWDQGLQJ SHUPLWVDQGOLFHQVHV  Laws and Regulations       444   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  $&RQWUDFWRUVKDOOJLYHDOOQRWLFHVUHTXLUHGE\DQGVKDOOFRPSO\ZLWKDOO/DZVDQG5HJXODWLRQV DSSOLFDEOH WR WKH SHUIRUPDQFH RI WKH :RUN ([FHSW ZKHUH RWKHUZLVH H[SUHVVO\ UHTXLUHG E\ DSSOLFDEOH/DZVDQG5HJXODWLRQVWKH&LW\VKDOOQRWEHUHVSRQVLEOHIRUPRQLWRULQJ&RQWUDFWRU¶V FRPSOLDQFHZLWKDQ\/DZVRU5HJXODWLRQV  %,I&RQWUDFWRUSHUIRUPVDQ\:RUNNQRZLQJRUKDYLQJUHDVRQWRNQRZWKDWLWLVFRQWUDU\WR/DZVRU 5HJXODWLRQV &RQWUDFWRU VKDOO EHDU DOO FODLPV FRVWV ORVVHV DQG GDPDJHV LQFOXGLQJ EXW QRW OLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOO FRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWV DULVLQJRXWRIRUUHODWLQJWRVXFK:RUN +RZHYHULWVKDOOQRWEH&RQWUDFWRU¶VUHVSRQVLELOLW\WRPDNHFHUWDLQWKDWWKH6SHFLILFDWLRQVDQG 'UDZLQJVDUHLQDFFRUGDQFHZLWK/DZVDQG5HJXODWLRQVEXWWKLVVKDOOQRWUHOLHYH&RQWUDFWRURI &RQWUDFWRU¶VREOLJDWLRQVXQGHU3DUDJUDSK  &&KDQJHVLQ/DZVRU5HJXODWLRQVQRWNQRZQDWWKHWLPHRIRSHQLQJRI%LGVKDYLQJDQHIIHFWRQ WKHFRVWRUWLPHRISHUIRUPDQFHRIWKH:RUNPD\EHWKHVXEMHFWRIDQDGMXVWPHQWLQ&RQWUDFW 3ULFHRU&RQWUDFW7LPH  Taxes  $2QDFRQWUDFWDZDUGHGE\WKH&LW\DQRUJDQL]DWLRQZKLFKTXDOLILHVIRUH[HPSWLRQSXUVXDQWWR 7H[DV7D[&RGH6XEFKDSWHU+ DVDPHQGHG WKH&RQWUDFWRUPD\SXUFKDVHUHQWRUOHDVHDOO PDWHULDOV VXSSOLHV DQG HTXLSPHQW XVHG RU FRQVXPHG LQ WKHSHUIRUPDQFH RI WKLV FRQWUDFW E\ LVVXLQJWRKLVVXSSOLHUDQH[HPSWLRQFHUWLILFDWHLQOLHXRIWKHWD[VDLGH[HPSWLRQFHUWLILFDWHWR FRPSO\ZLWK6WDWH&RPSWUROOHU¶V5XOLQJVDSSOLFDEOHWR7H[DV7D[&RGH6XEFKDSWHU+$Q\VXFK H[HPSWLRQFHUWLILFDWHLVVXHGWRWKH&RQWUDFWRULQOLHXRIWKHWD[VKDOOEHVXEMHFWWRDQGVKDOO FRPSO\ZLWKDOODSSOLFDEOHUXOLQJVSHUWDLQLQJWRWKH7H[DV7D[&RGH6XEFKDSWHU+  %7H[DV7D[SHUPLWVDQGLQIRUPDWLRQPD\EHREWDLQHGIURP  &RPSWUROOHURI3XEOLF$FFRXQWV 6DOHV7D['LYLVLRQ &DSLWRO6WDWLRQ $XVWLQ7;RU  KWWSZZZZLQGRZVWDWHW[XVWD[LQIRWD[IRUPVIRUPVKWPO  Use of Site and Other Areas  $Limitation on Use of Site and Other Areas:  &RQWUDFWRUVKDOOFRQILQHFRQVWUXFWLRQHTXLSPHQWWKHVWRUDJHRIPDWHULDOVDQGHTXLSPHQWDQG WKHRSHUDWLRQVRIZRUNHUVWRWKH6LWHDQGRWKHUDUHDVSHUPLWWHGE\/DZVDQG5HJXODWLRQVDQG VKDOOQRWXQUHDVRQDEO\HQFXPEHUWKH6LWHDQGRWKHUDUHDVZLWKFRQVWUXFWLRQHTXLSPHQWRU RWKHUPDWHULDOVRUHTXLSPHQW&RQWUDFWRUVKDOODVVXPHIXOOUHVSRQVLELOLW\IRUDQ\GDPDJHWR DQ\VXFKODQGRUDUHDRUWRWKHRZQHURURFFXSDQWWKHUHRIRURIDQ\DGMDFHQWODQGRUDUHDV       445   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 UHVXOWLQJIURPWKHSHUIRUPDQFHRIWKH:RUN  $WDQ\WLPHZKHQLQWKHMXGJPHQWRIWKH&LW\WKH&RQWUDFWRUKDVREVWUXFWHGFORVHGRULV FDUU\LQJRQRSHUDWLRQVLQDSRUWLRQRIDVWUHHWULJKWRIZD\RUHDVHPHQWJUHDWHUWKDQLV QHFHVVDU\IRUSURSHUH[HFXWLRQRIWKH:RUNWKH&LW\PD\UHTXLUHWKH&RQWUDFWRUWRILQLVKWKH VHFWLRQRQZKLFKRSHUDWLRQVDUHLQSURJUHVVEHIRUHZRUNLVFRPPHQFHGRQDQ\DGGLWLRQDO DUHDRIWKH6LWH  &RQVWUXFWLRQHTXLSPHQWVSRLOPDWHULDOVVXSSOLHVIRUPVEXLOGLQJVODEVRUHTXLSPHQWDQG VXSSO\VWRUDJHEXLOGLQJVRUDQ\RWKHULWHPWKDWPD\EHWUDQVSRUWHGE\IORRGIORZVVKDOOQRW EHVWRUHGZLWKLQH[LVWLQJIHGHUDOIORRGZD\VGXULQJWKHFRXUVHRIWKH:RUN  6KRXOG DQ\ 'DPDJH &ODLP EH PDGH E\ DQ\ VXFK RZQHU RU RFFXSDQW EHFDXVH RI WKH SHUIRUPDQFHRIWKH:RUN&RQWUDFWRUVKDOOSURPSWO\DWWHPSWWRUHVROYHWKH'DPDJH&ODLP  Pursuant to Paragraph 6.21, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages arising out of or relating to any claim or action, legal or equitable, brought by any such owner or occupant against City.  %Removal of Debris During Performance of the Work: 'XULQJWKHSURJUHVVRIWKH:RUN &RQWUDFWRU VKDOO NHHS WKH 6LWH DQG RWKHU DUHDV IUHH IURP DFFXPXODWLRQV RI ZDVWH PDWHULDOV UXEELVKDQGRWKHUGHEULV5HPRYDODQGGLVSRVDORIVXFKZDVWHPDWHULDOVUXEELVKDQGRWKHU GHEULVVKDOOFRQIRUPWRDSSOLFDEOH/DZVDQG5HJXODWLRQV  &Site Maintenance Cleaning: KRXUVDIWHUZULWWHQQRWLFHLVJLYHQWRWKH&RQWUDFWRUWKDWWKH FOHDQXSRQWKHMREVLWHLVSURFHHGLQJLQDPDQQHUXQVDWLVIDFWRU\WRWKH&LW\LIWKH&RQWUDFWRU IDLOVWRFRUUHFWWKHXQVDWLVIDFWRU\SURFHGXUHWKH&LW\PD\WDNHVXFKGLUHFWDFWLRQDVWKH&LW\ GHHPV DSSURSULDWH WR FRUUHFW WKH FOHDQXS GHILFLHQFLHV FLWHG WR WKH &RQWUDFWRU LQ WKH ZULWWHQ QRWLFH E\OHWWHURUHOHFWURQLFFRPPXQLFDWLRQ DQGWKHFRVWVRIVXFKGLUHFWDFWLRQSOXVRI VXFKFRVWVVKDOOEHGHGXFWHGIURPWKHPRQLHVGXHRUWREHFRPHGXHWRWKH&RQWUDFWRU  'Final Site Cleaning: 3ULRUWR)LQDO$FFHSWDQFHRIWKH:RUN&RQWUDFWRUVKDOOFOHDQWKH6LWHDQG WKH:RUNDQGPDNHLWUHDG\IRUXWLOL]DWLRQE\&LW\RUDGMDFHQWSURSHUW\RZQHU$WWKHFRPSOHWLRQ RIWKH:RUN&RQWUDFWRUVKDOOUHPRYHIURPWKH6LWHDOOWRROVDSSOLDQFHVFRQVWUXFWLRQHTXLSPHQW DQGPDFKLQHU\DQGVXUSOXVPDWHULDOVDQGVKDOOUHVWRUHWRRULJLQDOFRQGLWLRQRUEHWWHUDOOSURSHUW\ GLVWXUEHGE\WKH:RUN  (Loading Structures: &RQWUDFWRUVKDOOQRWORDGQRUSHUPLWDQ\SDUWRIDQ\VWUXFWXUHWREHORDGHG LQDQ\PDQQHUWKDWZLOOHQGDQJHUWKHVWUXFWXUHQRUVKDOO&RQWUDFWRUVXEMHFWDQ\SDUWRIWKH:RUN RUDGMDFHQWSURSHUW\WRVWUHVVHVRUSUHVVXUHVWKDWZLOOHQGDQJHULW  Record Documents  $&RQWUDFWRUVKDOOPDLQWDLQLQDVDIHSODFHDWWKH6LWHRULQDSODFHGHVLJQDWHGE\WKH&RQWUDFWRUDQG DSSURYHGE\WKH&LW\RQH  UHFRUGFRS\RIDOO'UDZLQJV6SHFLILFDWLRQV$GGHQGD&KDQJH 2UGHUV)LHOG2UGHUVDQGZULWWHQLQWHUSUHWDWLRQVDQGFODULILFDWLRQVLQJRRGRUGHUDQGDQQRWDWHGWR       446   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 VKRZFKDQJHVPDGHGXULQJFRQVWUXFWLRQ7KHVHUHFRUGGRFXPHQWVWRJHWKHUZLWKDOODSSURYHG 6DPSOHVDQGDFRXQWHUSDUWRIDOODFFHSWHG6XEPLWWDOVZLOOEHDYDLODEOHWR&LW\IRUUHIHUHQFH 8SRQFRPSOHWLRQRIWKH:RUNWKHVHUHFRUGGRFXPHQWVDQ\RSHUDWLRQDQGPDLQWHQDQFHPDQXDOV DQG 6XEPLWWDOV ZLOO EH GHOLYHUHG WR &LW\ SULRU WR )LQDO ,QVSHFWLRQ &RQWUDFWRU VKDOO LQFOXGH DFFXUDWHORFDWLRQVIRUEXULHGDQGHPEHGGHGLWHPV  Safety and Protection  $&RQWUDFWRU VKDOO EH VROHO\ UHVSRQVLEOH IRU LQLWLDWLQJ PDLQWDLQLQJ DQG VXSHUYLVLQJ DOO VDIHW\ SUHFDXWLRQVDQGSURJUDPVLQFRQQHFWLRQZLWKWKH:RUN6XFKUHVSRQVLELOLW\GRHVQRWUHOLHYH 6XEFRQWUDFWRUVRIWKHLUUHVSRQVLELOLW\IRUWKHVDIHW\RISHUVRQVRUSURSHUW\LQWKHSHUIRUPDQFHRI WKHLUZRUNQRUIRUFRPSOLDQFHZLWKDSSOLFDEOHVDIHW\/DZVDQG5HJXODWLRQV&RQWUDFWRUVKDOO WDNHDOOQHFHVVDU\SUHFDXWLRQVIRUWKHVDIHW\RIDQGVKDOOSURYLGHWKHQHFHVVDU\SURWHFWLRQWR SUHYHQWGDPDJHLQMXU\RUORVVWR  DOOSHUVRQVRQWKH6LWHRUZKRPD\EHDIIHFWHGE\WKH:RUN  DOOWKH:RUNDQGPDWHULDOVDQGHTXLSPHQWWREHLQFRUSRUDWHGWKHUHLQZKHWKHULQVWRUDJHRQ RURIIWKH6LWHDQG  RWKHUSURSHUW\DWWKH6LWHRUDGMDFHQWWKHUHWRLQFOXGLQJWUHHVVKUXEVODZQVZDONV SDYHPHQWV URDGZD\V VWUXFWXUHV XWLOLWLHV DQG 8QGHUJURXQG )DFLOLWLHV QRW GHVLJQDWHG IRU UHPRYDOUHORFDWLRQRUUHSODFHPHQWLQWKHFRXUVHRIFRQVWUXFWLRQ  %&RQWUDFWRU VKDOO FRPSO\ ZLWK DOO DSSOLFDEOH /DZV DQG 5HJXODWLRQV UHODWLQJ WR WKH VDIHW\ RI SHUVRQVRUSURSHUW\RUWRWKHSURWHFWLRQRISHUVRQVRUSURSHUW\IURPGDPDJHLQMXU\RUORVVDQG VKDOOHUHFWDQGPDLQWDLQDOOQHFHVVDU\VDIHJXDUGVIRUVXFKVDIHW\DQGSURWHFWLRQ&RQWUDFWRUVKDOO QRWLI\RZQHUVRIDGMDFHQWSURSHUW\DQGRI8QGHUJURXQG)DFLOLWLHVDQGRWKHUXWLOLW\RZQHUVZKHQ SURVHFXWLRQ RI WKH :RUN PD\ DIIHFW WKHP DQG VKDOO FRRSHUDWH ZLWK WKHP LQ WKH SURWHFWLRQ UHPRYDOUHORFDWLRQDQGUHSODFHPHQWRIWKHLUSURSHUW\  &&RQWUDFWRUVKDOOFRPSO\ZLWKWKHDSSOLFDEOHUHTXLUHPHQWVRI&LW\¶VVDIHW\SURJUDPVLIDQ\  '&RQWUDFWRUVKDOOLQIRUP&LW\RIWKHVSHFLILFUHTXLUHPHQWVRI&RQWUDFWRU¶VVDIHW\SURJUDPLIDQ\ ZLWKZKLFK&LW\¶VHPSOR\HHVDQGUHSUHVHQWDWLYHVPXVWFRPSO\ZKLOHDWWKH6LWH  ($OOGDPDJHLQMXU\RUORVVWRDQ\SURSHUW\UHIHUUHGWRLQ3DUDJUDSK$RU$FDXVHG GLUHFWO\RULQGLUHFWO\LQZKROHRULQSDUWE\&RQWUDFWRUDQ\6XEFRQWUDFWRU6XSSOLHURUDQ\ RWKHULQGLYLGXDORUHQWLW\GLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH :RUNRUDQ\RQHIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOHVKDOOEHUHPHGLHGE\&RQWUDFWRU  )&RQWUDFWRU¶VGXWLHVDQGUHVSRQVLELOLWLHVIRUVDIHW\DQGIRUSURWHFWLRQRIWKH:RUNVKDOOFRQWLQXH XQWLOVXFKWLPHDVDOOWKH:RUNLVFRPSOHWHGDQG&LW\KDVDFFHSWHGWKH:RUN  Safety Representative  &RQWUDFWRUVKDOOLQIRUP&LW\LQZULWLQJRI&RQWUDFWRU¶VGHVLJQDWHGVDIHW\UHSUHVHQWDWLYHDWWKH6LWH       447   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Hazard Communication Programs  &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUFRRUGLQDWLQJDQ\H[FKDQJHRIPDWHULDOVDIHW\GDWDVKHHWVRURWKHU KD]DUGFRPPXQLFDWLRQLQIRUPDWLRQUHTXLUHGWREHPDGHDYDLODEOHWRRUH[FKDQJHGEHWZHHQRUDPRQJ HPSOR\HUVLQDFFRUGDQFHZLWK/DZVRU5HJXODWLRQV  Emergencies and/or Rectification  $,QHPHUJHQFLHVDIIHFWLQJWKHVDIHW\RUSURWHFWLRQRISHUVRQVRUWKH:RUNRUSURSHUW\DWWKH6LWHRU DGMDFHQWWKHUHWR&RQWUDFWRULVREOLJDWHGWRDFWWRSUHYHQWWKUHDWHQHGGDPDJHLQMXU\RUORVV &RQWUDFWRU VKDOO JLYH &LW\ SURPSW ZULWWHQ QRWLFH LI &RQWUDFWRUEHOLHYHV WKDW DQ\ VLJQLILFDQW FKDQJHVLQWKH:RUNRUYDULDWLRQVIURPWKH&RQWUDFW'RFXPHQWVKDYHEHHQFDXVHGWKHUHE\RUDUH UHTXLUHG DV D UHVXOW WKHUHRI ,I &LW\ GHWHUPLQHV WKDW D FKDQJHLQWKH&RQWUDFW'RFXPHQWVLV UHTXLUHGEHFDXVHRIWKHDFWLRQWDNHQE\&RQWUDFWRULQUHVSRQVHWRVXFKDQHPHUJHQF\D&KDQJH 2UGHUPD\EHLVVXHG  %6KRXOGWKH&RQWUDFWRUIDLOWRUHVSRQGWRDUHTXHVWIURPWKH&LW\WRUHFWLI\DQ\GLVFUHSDQFLHV RPLVVLRQVRUFRUUHFWLRQQHFHVVDU\WRFRQIRUPZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV WKH&LW\VKDOOJLYHWKH&RQWUDFWRUZULWWHQQRWLFHWKDWVXFKZRUNRUFKDQJHVDUHWREHSHUIRUPHG 7KHZULWWHQQRWLFHVKDOOGLUHFWDWWHQWLRQWRWKHGLVFUHSDQWFRQGLWLRQDQGUHTXHVWWKH&RQWUDFWRUWR WDNHUHPHGLDODFWLRQWRFRUUHFWWKHFRQGLWLRQ,QWKHHYHQWWKH&RQWUDFWRUGRHVQRWWDNHSRVLWLYH VWHSVWRIXOILOOWKLVZULWWHQUHTXHVWRUGRHVQRWVKRZMXVWFDXVHIRUQRWWDNLQJWKHSURSHUDFWLRQ ZLWKLQKRXUVWKH&LW\PD\WDNHVXFKUHPHGLDODFWLRQZLWK&LW\UHVRXUFHVRUE\FRQWUDFW7KH &LW\VKDOOGHGXFWDQDPRXQWHTXDOWRWKHHQWLUHFRVWVIRUVXFKUHPHGLDODFWLRQSOXVIURP DQ\IXQGVGXHRUEHFRPHGXHWKH&RQWUDFWRURQWKH3URMHFW  Submittals  $&RQWUDFWRUVKDOOVXEPLWUHTXLUHG6XEPLWWDOVWR&LW\IRUUHYLHZDQGDFFHSWDQFHLQDFFRUGDQFH ZLWKWKHDFFHSWHG6FKHGXOHRI6XEPLWWDOV DVUHTXLUHGE\3DUDJUDSK (DFKVXEPLWWDOZLOOEH LGHQWLILHGDV&LW\PD\UHTXLUH  6XEPLWLQDFFRUGDQFHZLWKWKH*HQHUDO5HTXLUHPHQWV  'DWD VKRZQ RQ WKH 6XEPLWWDOV ZLOO EH FRPSOHWH ZLWK UHVSHFW WR TXDQWLWLHV GLPHQVLRQV VSHFLILHGSHUIRUPDQFHDQGGHVLJQFULWHULDPDWHULDOVDQGVLPLODUGDWDWRGHPRQVWUDWHWR&LW\ WKHVHUYLFHVPDWHULDOVDQGHTXLSPHQW&RQWUDFWRUSURSRVHVWRSURYLGHDQGWRHQDEOH&LW\WR UHYLHZWKHLQIRUPDWLRQIRUWKHOLPLWHGSXUSRVHVUHTXLUHGE\3DUDJUDSK&  6XEPLWWDOV VXEPLWWHG DV KHUHLQ SURYLGHG E\ &RQWUDFWRU DQG UHYLHZHG E\ &LW\ IRU FRQIRUPDQFH ZLWK WKH GHVLJQ FRQFHSW VKDOO EH H[HFXWHG LQ FRQIRUPLW\ZLWKWKH&RQWUDFW 'RFXPHQWVXQOHVVRWKHUZLVHUHTXLUHGE\&LW\  :KHQ6XEPLWWDOVDUHVXEPLWWHGIRUWKHSXUSRVHRIVKRZLQJWKHLQVWDOODWLRQLQJUHDWHUGHWDLO WKHLU UHYLHZ VKDOO QRW H[FXVH &RQWUDFWRUIURPUHTXLUHPHQWV VKRZQ RQ WKH 'UDZLQJV DQG 6SHFLILFDWLRQV       448   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  )RU,QIRUPDWLRQ2QO\VXEPLWWDOVXSRQZKLFKWKH&LW\LVQRWH[SHFWHGWRFRQGXFWUHYLHZRU WDNHUHVSRQVLYHDFWLRQPD\EHVRLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWV  6XEPLWUHTXLUHGQXPEHURI6DPSOHVVSHFLILHGLQWKH6SHFLILFDWLRQV  &OHDUO\LGHQWLI\HDFK6DPSOHDVWRPDWHULDO6XSSOLHUSHUWLQHQWGDWDVXFKDVFDWDORJQXPEHUV WKHXVHIRUZKLFKLQWHQGHGDQGRWKHUGDWDDV&LW\PD\UHTXLUHWRHQDEOH&LW\WRUHYLHZWKH VXEPLWWDOIRUWKHOLPLWHGSXUSRVHVUHTXLUHGE\3DUDJUDSK&  %:KHUHD6XEPLWWDOLVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVRUWKH6FKHGXOHRI6XEPLWWDOVDQ\ UHODWHG:RUNSHUIRUPHGSULRUWR&LW\¶VUHYLHZDQGDFFHSWDQFHRIWKHSHUWLQHQWVXEPLWWDOZLOOEH DWWKHVROHH[SHQVHDQGUHVSRQVLELOLW\RI&RQWUDFWRU  &City’s Review:  &LW\ZLOOSURYLGHWLPHO\UHYLHZRIUHTXLUHG6XEPLWWDOVLQDFFRUGDQFHZLWKWKH6FKHGXOHRI 6XEPLWWDOVDFFHSWDEOHWR&LW\&LW\¶VUHYLHZDQGDFFHSWDQFHZLOOEHRQO\WRGHWHUPLQHLIWKH LWHPVFRYHUHGE\WKHVXEPLWWDOVZLOODIWHULQVWDOODWLRQRULQFRUSRUDWLRQLQWKH:RUNFRQIRUP WR WKH LQIRUPDWLRQ JLYHQ LQ WKH &RQWUDFW 'RFXPHQWV DQG EH FRPSDWLEOH ZLWK WKH GHVLJQ FRQFHSW RI WKH FRPSOHWHG 3URMHFW DV D IXQFWLRQLQJ ZKROH DV LQGLFDWHG E\ WKH &RQWUDFW 'RFXPHQWV  &LW\¶VUHYLHZDQGDFFHSWDQFHZLOOQRWH[WHQGWRPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVRU SURFHGXUHVRIFRQVWUXFWLRQ H[FHSWZKHUHDSDUWLFXODUPHDQVPHWKRGWHFKQLTXHVHTXHQFH RU SURFHGXUH RI FRQVWUXFWLRQ LV VSHFLILFDOO\ DQG H[SUHVVO\ FDOOHG IRU E\ WKH &RQWUDFW 'RFXPHQWV RUWRVDIHW\SUHFDXWLRQVRUSURJUDPVLQFLGHQWWKHUHWR7KHUHYLHZDQGDFFHSWDQFH RIDVHSDUDWHLWHPDVVXFKZLOOQRWLQGLFDWHDSSURYDORIWKHDVVHPEO\LQZKLFKWKHLWHP IXQFWLRQV  &LW\¶VUHYLHZDQGDFFHSWDQFHVKDOOQRWUHOLHYH&RQWUDFWRUIURPUHVSRQVLELOLW\IRUDQ\ YDULDWLRQIURPWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVXQOHVV&RQWUDFWRUKDVFRPSOLHG ZLWKWKHUHTXLUHPHQWVRI6HFWLRQDQG&LW\KDVJLYHQZULWWHQDFFHSWDQFHRIHDFK VXFK YDULDWLRQ E\ VSHFLILF ZULWWHQ QRWDWLRQ WKHUHRI LQFRUSRUDWHG LQ RU DFFRPSDQ\LQJ WKH 6XEPLWWDO&LW\¶VUHYLHZDQGDFFHSWDQFHVKDOOQRWUHOLHYH&RQWUDFWRUIURPUHVSRQVLELOLW\IRU FRPSO\LQJZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV  Continuing the Work  ([FHSWDVRWKHUZLVHSURYLGHG&RQWUDFWRUVKDOOFDUU\RQWKH:RUNDQGDGKHUHWRWKH3URMHFW6FKHGXOH GXULQJDOOGLVSXWHVRUGLVDJUHHPHQWVZLWK&LW\1R:RUNVKDOOEHGHOD\HGRUSRVWSRQHGSHQGLQJ UHVROXWLRQRIDQ\GLVSXWHVRUGLVDJUHHPHQWVH[FHSWDV&LW\DQG&RQWUDFWRUPD\RWKHUZLVHDJUHHLQ ZULWLQJ         449   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Contractor’s General Warranty and Guarantee  $&RQWUDFWRUZDUUDQWVDQGJXDUDQWHHVWR&LW\WKDWDOO:RUNZLOOEHLQDFFRUGDQFHZLWKWKH&RQWUDFW 'RFXPHQWVDQGZLOOQRWEHGHIHFWLYH&LW\DQGLWVRIILFHUVGLUHFWRUV PHPEHUV SDUWQHUV HPSOR\HHVDJHQWVFRQVXOWDQWVDQGVXEFRQWUDFWRUVVKDOOEHHQWLWOHGWRUHO\RQUHSUHVHQWDWLRQRI &RQWUDFWRU¶VZDUUDQW\DQGJXDUDQWHH  %&RQWUDFWRU¶VZDUUDQW\DQGJXDUDQWHHKHUHXQGHUH[FOXGHVGHIHFWVRUGDPDJHFDXVHGE\  DEXVHPRGLILFDWLRQRULPSURSHUPDLQWHQDQFHRURSHUDWLRQE\SHUVRQVRWKHUWKDQ&RQWUDFWRU 6XEFRQWUDFWRUV 6XSSOLHUV RU DQ\ RWKHU LQGLYLGXDO RU HQWLW\ IRU ZKRP &RQWUDFWRU LV UHVSRQVLEOHRU  QRUPDOZHDUDQGWHDUXQGHUQRUPDOXVDJH  &&RQWUDFWRU¶V REOLJDWLRQ WR SHUIRUP DQG FRPSOHWH WKH :RUN LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWVVKDOOEHDEVROXWH1RQHRIWKHIROORZLQJZLOOFRQVWLWXWHDQDFFHSWDQFHRI:RUNWKDWLV QRWLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVRUDUHOHDVHRI&RQWUDFWRU¶VREOLJDWLRQWRSHUIRUP WKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV  REVHUYDWLRQVE\&LW\  UHFRPPHQGDWLRQRUSD\PHQWE\&LW\RIDQ\SURJUHVVRUILQDOSD\PHQW  WKHLVVXDQFHRIDFHUWLILFDWHRI)LQDO$FFHSWDQFHE\&LW\RUDQ\SD\PHQWUHODWHGWKHUHWRE\ &LW\  XVHRURFFXSDQF\RIWKH:RUNRUDQ\SDUWWKHUHRIE\&LW\  DQ\UHYLHZDQGDFFHSWDQFHRID6XEPLWWDOE\&LW\  DQ\LQVSHFWLRQWHVWRUDSSURYDOE\RWKHUVRU  DQ\FRUUHFWLRQRIGHIHFWLYH:RUNE\&LW\  '7KH&RQWUDFWRUVKDOOUHPHG\DQ\GHIHFWVRUGDPDJHVLQWKH:RUNDQGSD\IRUDQ\GDPDJHWR RWKHUZRUNRUSURSHUW\UHVXOWLQJWKHUHIURPZKLFKVKDOODSSHDUZLWKLQDSHULRGRIWZR  \HDUV IURPWKHGDWHRI)LQDO$FFHSWDQFHRIWKH:RUNXQOHVVDORQJHUSHULRGLVVSHFLILHGDQGVKDOO IXUQLVKDJRRGDQGVXIILFLHQWPDLQWHQDQFHERQGFRPSO\LQJZLWKWKHUHTXLUHPHQWVRI$UWLFOH %7KH&LW\ZLOOJLYHQRWLFHRIREVHUYHGGHIHFWVZLWKUHDVRQDEOHSURPSWQHVV  ,QGHPQLILFDWLRQ  $&RQWUDFWRUFRYHQDQWVDQGDJUHHVWRLQGHPQLI\KROGKDUPOHVVDQGGHIHQGDWLWVRZQ H[SHQVHWKH&LW\LWVRIILFHUVVHUYDQWVDQGHPSOR\HHVIURPDQGDJDLQVWDQ\DQGDOOFODLPV DULVLQJRXWRIRUDOOHJHGWRDULVHRXWRIWKHZRUNDQGVHUYLFHVWREHSHUIRUPHGE\WKH &RQWUDFWRULWVRIILFHUVDJHQWVHPSOR\HHVVXEFRQWUDFWRUVOLFHQVHVRULQYLWHHVXQGHUWKLV       450   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &RQWUDFW7+,6,1'(01,),&$7,213529,6,21,663(&,),&$//<,17(1'('72 23(5$7($1'%(())(&7,9((9(1,),7,6$//(*('253529(17+$7$// 25620(2)7+('$0$*(6%(,1*628*+7:(5(&$86(',1:+2/(25,1 3$57%<$1<$&720,66,21251(*/,*(1&(2)7+(&,7<7KLVLQGHPQLW\ SURYLVLRQLVLQWHQGHGWRLQFOXGHZLWKRXWOLPLWDWLRQLQGHPQLW\IRUFRVWVH[SHQVHVDQGOHJDO IHHVLQFXUUHGE\WKH&LW\LQGHIHQGLQJDJDLQVWVXFKFODLPVDQGFDXVHVRIDFWLRQV  %&RQWUDFWRUFRYHQDQWVDQGDJUHHVWRLQGHPQLI\DQGKROGKDUPOHVVDWLWVRZQH[SHQVHWKH &LW\LWVRIILFHUVVHUYDQWVDQGHPSOR\HHVIURPDQGDJDLQVWDQ\DQGDOOORVVGDPDJHRU GHVWUXFWLRQRISURSHUW\RIWKH&LW\DULVLQJRXWRIRUDOOHJHGWRDULVHRXWRIWKHZRUNDQG VHUYLFHVWREHSHUIRUPHGE\WKH&RQWUDFWRULWVRIILFHUVDJHQWVHPSOR\HHVVXEFRQWUDFWRUV OLFHQVHHVRULQYLWHHVXQGHUWKLV&RQWUDFW7+,6,1'(01,),&$7,21 3529,6,21 ,6 63(&,),&$//< ,17(1'(' 72 23(5$7( $1' %( ())(&7,9( (9(1 ,) ,7 ,6 $//(*('253529(17+$7$//25620(2)7+('$0$*(6%(,1*628*+7 :(5( &$86(' ,1 :+2/( 25 ,1 3$57 %< $1< $&7 20,66,21 25 1(*/,*(1&(2)7+(&,7<  Delegation of Professional Design Services  $&RQWUDFWRUZLOOQRWEHUHTXLUHGWRSURYLGHSURIHVVLRQDOGHVLJQVHUYLFHVXQOHVVVXFKVHUYLFHVDUH VSHFLILFDOO\ UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV IRU D SRUWLRQ RI WKH :RUN RU XQOHVV VXFK VHUYLFHVDUHUHTXLUHGWRFDUU\RXW&RQWUDFWRU¶VUHVSRQVLELOLWLHVIRUFRQVWUXFWLRQPHDQVPHWKRGV WHFKQLTXHVVHTXHQFHVDQGSURFHGXUHV  %,I SURIHVVLRQDO GHVLJQ VHUYLFHV RU FHUWLILFDWLRQV E\ D GHVLJQ SURIHVVLRQDO UHODWHG WR V\VWHPV PDWHULDOVRUHTXLSPHQWDUHVSHFLILFDOO\UHTXLUHGRI&RQWUDFWRUE\WKH&RQWUDFW'RFXPHQWV&LW\ ZLOOVSHFLI\DOOSHUIRUPDQFHDQGGHVLJQFULWHULDWKDWVXFKVHUYLFHVPXVWVDWLVI\&RQWUDFWRUVKDOO FDXVHVXFKVHUYLFHVRUFHUWLILFDWLRQVWREHSURYLGHGE\DSURSHUO\OLFHQVHGSURIHVVLRQDOZKRVH VLJQDWXUHDQGVHDOVKDOODSSHDURQDOOGUDZLQJVFDOFXODWLRQVVSHFLILFDWLRQVFHUWLILFDWLRQVDQG 6XEPLWWDOVSUHSDUHGE\VXFKSURIHVVLRQDO6XEPLWWDOVUHODWHGWRWKH:RUNGHVLJQHGRUFHUWLILHGE\ VXFKSURIHVVLRQDOLISUHSDUHGE\RWKHUVVKDOOEHDUVXFKSURIHVVLRQDO¶VZULWWHQDSSURYDOZKHQ VXEPLWWHGWR&LW\  &&LW\VKDOOEHHQWLWOHGWRUHO\XSRQWKHDGHTXDF\DFFXUDF\DQGFRPSOHWHQHVVRIWKHVHUYLFHV FHUWLILFDWLRQVRUDSSURYDOVSHUIRUPHGE\VXFKGHVLJQSURIHVVLRQDOVSURYLGHG&LW\KDVVSHFLILHG WR&RQWUDFWRUSHUIRUPDQFHDQGGHVLJQFULWHULDWKDWVXFKVHUYLFHVPXVWVDWLVI\  '3XUVXDQWWRWKLV3DUDJUDSK&LW\¶VUHYLHZDQGDFFHSWDQFHRIGHVLJQFDOFXODWLRQVDQGGHVLJQ GUDZLQJVZLOOEHRQO\IRUWKHOLPLWHGSXUSRVHRIFKHFNLQJIRUFRQIRUPDQFHZLWKSHUIRUPDQFHDQG GHVLJQFULWHULDJLYHQDQGWKHGHVLJQFRQFHSWH[SUHVVHGLQWKH&RQWUDFW'RFXPHQWV&LW\¶VUHYLHZ DQGDFFHSWDQFHRI6XEPLWWDOV H[FHSWGHVLJQFDOFXODWLRQVDQGGHVLJQGUDZLQJV ZLOOEHRQO\IRU WKHSXUSRVHVWDWHGLQ3DUDJUDSK&         451   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Right to Audit  $7KH&LW\VKDOOKDYHWKHULJKWWRDXGLWDQGPDNHFRSLHVRIWKHERRNVUHFRUGVDQGFRPSXWDWLRQV SHUWDLQLQJWRWKH&RQWUDFW7KH&RQWUDFWRUVKDOOUHWDLQVXFKERRNVUHFRUGVGRFXPHQWVDQGRWKHU HYLGHQFHSHUWDLQLQJWRWKH&RQWUDFWSHULRG DQGILYH\HDUV WKHUHDIWHUH[FHSWLIDQ DXGLWLVLQ SURJUHVVRUDXGLWILQGLQJVDUH\HWXQUHVROYHGLQZKLFKFDVHUHFRUGVVKDOOEHNHSWXQWLODOODXGLW WDVNVDUHFRPSOHWHGDQGUHVROYHG7KHVHERRNVUHFRUGVGRFXPHQWVDQGRWKHUHYLGHQFHVKDOOEH DYDLODEOHZLWKLQWHQ  EXVLQHVVGD\VRIZULWWHQUHTXHVW)XUWKHUWKH&RQWUDFWRUVKDOODOVR UHTXLUH DOO 6XEFRQWUDFWRUV PDWHULDO VXSSOLHUV DQG RWKHU SD\HHV WR UHWDLQ DOO ERRNV UHFRUGV GRFXPHQWVDQGRWKHUHYLGHQFHSHUWDLQLQJWRWKH&RQWUDFWDQGWRDOORZWKH&LW\VLPLODUDFFHVVWR WKRVHGRFXPHQWV$OOERRNVDQGUHFRUGVZLOOEHPDGHDYDLODEOHZLWKLQDPLOHUDGLXVRIWKH &LW\7KHFRVWRIWKHDXGLWZLOOEHERUQHE\WKH&LW\XQOHVVWKHDXGLWUHYHDOVDQRYHUSD\PHQWRI RUJUHDWHU,IDQRYHUSD\PHQWRIRUJUHDWHURFFXUVWKHUHDVRQDEOHFRVWRIWKHDXGLW LQFOXGLQJDQ\WUDYHOFRVWVPXVWEHERUQHE\WKH&RQWUDFWRUZKLFKPXVWEHSD\DEOHZLWKLQILYH   EXVLQHVVGD\VRIUHFHLSWRIDQLQYRLFH  %)DLOXUHWRFRPSO\ZLWKWKHSURYLVLRQVRIWKLVVHFWLRQVKDOOEHDPDWHULDOEUHDFKRIWKH&RQWUDFW DQGVKDOOFRQVWLWXWHLQWKH&LW\¶VVROHGLVFUHWLRQJURXQGVIRUWHUPLQDWLRQWKHUHRI(DFKRIWKH WHUPV³ERRNV´³UHFRUGV´³GRFXPHQWV´DQG³RWKHUHYLGHQFH´DVXVHGDERYHVKDOOEHFRQVWUXHG WRLQFOXGHGUDIWVDQGHOHFWURQLFILOHVHYHQLIVXFKGUDIWVRUHOHFWURQLFILOHVDUHVXEVHTXHQWO\XVHG WRJHQHUDWHRUSUHSDUHDILQDOSULQWHGGRFXPHQW  Nondiscrimination  $7KH&LW\LVUHVSRQVLEOHIRURSHUDWLQJ3XEOLF7UDQVSRUWDWLRQ3URJUDPVDQGLPSOHPHQWLQJWUDQVLW UHODWHGSURMHFWVZKLFKDUHIXQGHGLQSDUWZLWK)HGHUDOILQDQFLDODVVLVWDQFHDZDUGHGE\WKH86 'HSDUWPHQW RI 7UDQVSRUWDWLRQ DQG WKH )HGHUDO 7UDQVLW $GPLQLVWUDWLRQ )7$  ZLWKRXW GLVFULPLQDWLQJDJDLQVWDQ\SHUVRQLQWKH8QLWHG6WDWHVRQWKHEDVLVRIUDFHFRORURUQDWLRQDO RULJLQ  %Title VI, Civil Rights Act of 1964 as amended: &RQWUDFWRUVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI WKH$FWDQGWKH5HJXODWLRQVDVIXUWKHUGHILQHGLQWKH6XSSOHPHQWDU\&RQGLWLRQVIRUDQ\SURMHFW UHFHLYLQJ)HGHUDODVVLVWDQFH  $57,&/(±27+(5:25.$77+(6,7(  Related Work at Site  $&LW\PD\SHUIRUPRWKHUZRUNUHODWHGWRWKH3URMHFWDWWKH6LWHZLWK&LW\¶VHPSOR\HHVRURWKHU &LW\FRQWUDFWRUVRUWKURXJKRWKHUGLUHFWFRQWUDFWVWKHUHIRURUKDYHRWKHUZRUNSHUIRUPHGE\ XWLOLW\RZQHUV,IVXFKRWKHUZRUNLVQRWQRWHGLQWKH&RQWUDFW'RFXPHQWVWKHQZULWWHQQRWLFH WKHUHRIZLOOEHJLYHQWR&RQWUDFWRUSULRUWRVWDUWLQJDQ\VXFKRWKHUZRUNDQG  %&RQWUDFWRUVKDOODIIRUGHDFKRWKHUFRQWUDFWRUZKRLVDSDUW\WRVXFKDGLUHFWFRQWUDFWHDFKXWLOLW\ RZQHU DQG &LW\ LI &LW\ LV SHUIRUPLQJ RWKHU ZRUN ZLWK &LW\¶V HPSOR\HHV RU RWKHU &LW\ FRQWUDFWRUV SURSHU DQG VDIH DFFHVV WR WKH 6LWH SURYLGH D UHDVRQDEOH RSSRUWXQLW\ IRU WKH       452   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 LQWURGXFWLRQDQGVWRUDJHRIPDWHULDOVDQGHTXLSPHQWDQGWKHH[HFXWLRQRIVXFKRWKHUZRUNDQG SURSHUO\FRRUGLQDWHWKH:RUNZLWKWKHLUV&RQWUDFWRUVKDOOGRDOOFXWWLQJILWWLQJDQGSDWFKLQJRI WKH:RUNWKDWPD\EHUHTXLUHGWRSURSHUO\FRQQHFWRURWKHUZLVHPDNHLWVVHYHUDOSDUWVFRPH WRJHWKHUDQGSURSHUO\LQWHJUDWHZLWKVXFKRWKHUZRUN&RQWUDFWRUVKDOOQRWHQGDQJHUDQ\ZRUNRI RWKHUV E\ FXWWLQJ H[FDYDWLQJ RU RWKHUZLVH DOWHULQJ VXFK ZRUN SURYLGHG KRZHYHU WKDW &RQWUDFWRUPD\FXWRUDOWHURWKHUV ZRUNZLWKWKHZULWWHQFRQVHQWRI&LW\DQGWKHRWKHUVZKRVH ZRUNZLOOEHDIIHFWHG  &,IWKHSURSHUH[HFXWLRQRUUHVXOWVRIDQ\SDUWRI&RQWUDFWRU¶V:RUNGHSHQGVXSRQZRUNSHUIRUPHG E\RWKHUVXQGHUWKLV$UWLFOH&RQWUDFWRUVKDOOLQVSHFWVXFKRWKHUZRUNDQGSURPSWO\UHSRUWWR &LW\LQZULWLQJDQ\GHOD\VGHIHFWVRUGHILFLHQFLHVLQVXFKRWKHUZRUNWKDWUHQGHULWXQDYDLODEOH RUXQVXLWDEOHIRUWKHSURSHUH[HFXWLRQDQGUHVXOWVRI&RQWUDFWRU¶V:RUN&RQWUDFWRU¶VIDLOXUHWRVR UHSRUWZLOOFRQVWLWXWHDQDFFHSWDQFHRIVXFKRWKHUZRUNDVILWDQGSURSHUIRULQWHJUDWLRQZLWK &RQWUDFWRU¶V:RUNH[FHSWIRUODWHQWGHIHFWVLQWKHZRUNSURYLGHGE\RWKHUV  Coordination  $,I&LW\LQWHQGVWRFRQWUDFWZLWKRWKHUVIRUWKHSHUIRUPDQFHRIRWKHUZRUNRQWKH3URMHFWDWWKH 6LWHWKHIROORZLQJZLOOEHVHWIRUWKLQ6XSSOHPHQWDU\&RQGLWLRQV  WKHLQGLYLGXDORUHQWLW\ZKRZLOOKDYHDXWKRULW\DQGUHVSRQVLELOLW\IRUFRRUGLQDWLRQRIWKH DFWLYLWLHVDPRQJWKHYDULRXVFRQWUDFWRUVZLOOEHLGHQWLILHG  WKHVSHFLILFPDWWHUVWREHFRYHUHGE\VXFKDXWKRULW\DQGUHVSRQVLELOLW\ZLOOEHLWHPL]HGDQG  WKHH[WHQWRIVXFKDXWKRULW\DQGUHVSRQVLELOLWLHVZLOOEHSURYLGHG  %8QOHVVRWKHUZLVHSURYLGHGLQWKH6XSSOHPHQWDU\&RQGLWLRQV&LW\VKDOOKDYHDXWKRULW\IRUVXFK FRRUGLQDWLRQ  $57,&/(±&,7<¶65(63216,%,/,7,(6  Communications to Contractor  ([FHSWDVRWKHUZLVHSURYLGHGLQWKH6XSSOHPHQWDU\&RQGLWLRQV&LW\VKDOOLVVXHDOOFRPPXQLFDWLRQV WR&RQWUDFWRU  Furnish Data  &LW\VKDOOWLPHO\IXUQLVKWKHGDWDUHTXLUHGXQGHUWKH&RQWUDFW'RFXPHQWV  Pay When Due  &LW\VKDOOPDNHSD\PHQWVWR&RQWUDFWRULQDFFRUGDQFHZLWK$UWLFOH         453   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Lands and Easements; Reports and Tests  &LW\¶VGXWLHVZLWKUHVSHFWWRSURYLGLQJODQGVDQGHDVHPHQWVDQGSURYLGLQJHQJLQHHULQJVXUYH\VWR HVWDEOLVKUHIHUHQFHSRLQWVDUHVHWIRUWKLQ3DUDJUDSKVDQG3DUDJUDSKUHIHUVWR&LW\¶V LGHQWLI\LQJ DQG PDNLQJ DYDLODEOH WR &RQWUDFWRU FRSLHV RI UHSRUWVRIH[SORUDWLRQVDQGWHVWVRI VXEVXUIDFHFRQGLWLRQVDQGGUDZLQJVRISK\VLFDOFRQGLWLRQVUHODWLQJWRH[LVWLQJVXUIDFHRUVXEVXUIDFH VWUXFWXUHVDWRUFRQWLJXRXVWRWKH6LWHWKDWKDYHEHHQXWLOL]HGE\&LW\LQSUHSDULQJWKH&RQWUDFW 'RFXPHQWV  Change Orders  &LW\VKDOOH[HFXWH&KDQJH2UGHUVLQDFFRUGDQFHZLWK3DUDJUDSK  Inspections, Tests, and Approvals  &LW\¶VUHVSRQVLELOLW\ZLWKUHVSHFWWRFHUWDLQLQVSHFWLRQVWHVWVDQGDSSURYDOVLVVHWIRUWKLQ3DUDJUDSK   Limitations on City’s Responsibilities  $7KH&LW\VKDOOQRWVXSHUYLVHGLUHFWRUKDYHFRQWURORUDXWKRULW\RYHUQRUEHUHVSRQVLEOHIRU &RQWUDFWRU¶VPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVRUSURFHGXUHVRIFRQVWUXFWLRQRUWKHVDIHW\ SUHFDXWLRQVDQGSURJUDPVLQFLGHQWWKHUHWRRUIRUDQ\IDLOXUHRI&RQWUDFWRUWRFRPSO\ZLWK/DZV DQG5HJXODWLRQVDSSOLFDEOHWRWKHSHUIRUPDQFHRIWKH:RUN&LW\ZLOOQRWEHUHVSRQVLEOHIRU &RQWUDFWRU¶VIDLOXUHWRSHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV  %&LW\ZLOOQRWLI\WKH&RQWUDFWRURIDSSOLFDEOHVDIHW\SODQVSXUVXDQWWR3DUDJUDSK  Undisclosed Hazardous Environmental Condition  &LW\¶VUHVSRQVLELOLW\ZLWKUHVSHFWWRDQXQGLVFORVHG+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQLVVHWIRUWK LQ3DUDJUDSK  Compliance with Safety Program  :KLOHDWWKH6LWH&LW\¶VHPSOR\HHVDQGUHSUHVHQWDWLYHVVKDOOFRPSO\ZLWKWKHVSHFLILFDSSOLFDEOH UHTXLUHPHQWVRI&RQWUDFWRU¶VVDIHW\SURJUDPVRIZKLFK&LW\KDVEHHQLQIRUPHGSXUVXDQWWR 3DUDJUDSK  $57,&/(±&,7<¶62%6(59$7,2167$786'85,1*&216758&7,21  City’s Project Manager or Duly Authorized Representative &LW\ZLOOSURYLGHD3URMHFW0DQDJHURUGXO\DXWKRUL]HGUHSUHVHQWDWLYH GXULQJ WKH FRQVWUXFWLRQ SHULRG7KHGXWLHVDQGUHVSRQVLELOLWLHVDQGWKHOLPLWDWLRQVRIDXWKRULW\RI&LW\¶V3URMHFW0DQDJHURU GXO\DSSRLQWHGUHSUHVHQWDWLYHGXULQJFRQVWUXFWLRQDUHVHWIRUWKLQWKH&RQWUDFW'RFXPHQWV&LW\¶V 3URMHFW0DQDJHUIRUWKLV&RQWUDFWLVDVVHWIRUWKLQWKH6XSSOHPHQWDU\&RQGLWLRQV&LW\ZLOOHVWDEOLVK DGXO\DXWKRUL]HGUHSUHVHQWDWLYHDWWKH3UHFRQVWUXFWLRQ0HHWLQJLQDFFRUGDQFHZLWK6HFWLRQ       454   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  Visits to Site  $&LW\ZLOOPDNHYLVLWVWRWKH6LWHDWLQWHUYDOVDSSURSULDWHWRWKHYDULRXVVWDJHVRIFRQVWUXFWLRQDV &LW\GHHPVQHFHVVDU\LQRUGHUWRREVHUYHWKHSURJUHVVWKDWKDVEHHQPDGHDQGWKHTXDOLW\RI WKHYDULRXVDVSHFWVRI&RQWUDFWRU¶VH[HFXWHG:RUN%DVHGRQLQIRUPDWLRQREWDLQHGGXULQJ VXFK YLVLWV DQG REVHUYDWLRQV &LW\  ZLOOGHWHUPLQH LQ JHQHUDO LI WKH :RUN LV SURFHHGLQJ LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV &LW\ ZLOO QRW EH UHTXLUHG WR PDNH H[KDXVWLYH RU FRQWLQXRXVLQVSHFWLRQVRQWKH6LWHWRFKHFNWKHTXDOLW\RUTXDQWLW\RIWKH:RUN&LW\¶VHIIRUWV ZLOOEHGLUHFWHGWRZDUGSURYLGLQJ&LW\DJUHDWHUGHJUHHRIFRQILGHQFHWKDWWKHFRPSOHWHG:RUN ZLOOFRQIRUPJHQHUDOO\WRWKH&RQWUDFW'RFXPHQWV  %&LW\¶VYLVLWVDQGREVHUYDWLRQVDUHVXEMHFWWRDOOWKHOLPLWDWLRQVRQDXWKRULW\DQGUHVSRQVLELOLW\VHW IRUWKLQ3DUDJUDSK3DUWLFXODUO\EXWZLWKRXWOLPLWDWLRQGXULQJRUDVDUHVXOWRI&LW\¶VYLVLWV RUREVHUYDWLRQVRI&RQWUDFWRU¶V:RUN&LW\ZLOOQRWVXSHUYLVHGLUHFWFRQWURORUKDYHDXWKRULW\ RYHURUEHUHVSRQVLEOHIRU&RQWUDFWRU¶VPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVRUSURFHGXUHV RIFRQVWUXFWLRQRUWKHVDIHW\SUHFDXWLRQVDQGSURJUDPVLQFLGHQWWKHUHWRRUIRUDQ\IDLOXUHRI &RQWUDFWRUWRFRPSO\ZLWK/DZVDQG5HJXODWLRQVDSSOLFDEOHWRWKHSHUIRUPDQFHRIWKH:RUN  Authorized Variations in Work  &LW\¶V 3URMHFW 0DQDJHURUGXO\DXWKRUL]HGUHSUHVHQWDWLYH PD\ DXWKRUL]H PLQRU YDULDWLRQV LQ WKH :RUNIURPWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVZKLFKGRQRWLQYROYHDQDGMXVWPHQWLQWKH &RQWUDFW3ULFHRUWKH&RQWUDFW7LPHDQGDUHFRPSDWLEOHZLWKWKHGHVLJQFRQFHSWRIWKHFRPSOHWHG 3URMHFWDVDIXQFWLRQLQJZKROHDVLQGLFDWHGE\WKH&RQWUDFW'RFXPHQWV7KHVHPD\EHDFFRPSOLVKHG E\D)LHOG2UGHUDQGZLOOEHELQGLQJRQ&LW\DQGDOVRRQ&RQWUDFWRUZKRVKDOOSHUIRUPWKH:RUN LQYROYHGSURPSWO\  Rejecting Defective Work  &LW\ ZLOO KDYH DXWKRULW\ WR UHMHFW :RUN ZKLFK &LW\¶V 3URMHFW 0DQDJHU RU GXO\ DXWKRUL]HG UHSUHVHQWDWLYHEHOLHYHVWREHGHIHFWLYHRUZLOOQRWSURGXFHDFRPSOHWHG3URMHFWWKDWFRQIRUPVWRWKH &RQWUDFW'RFXPHQWVRUWKDWZLOOSUHMXGLFH WKH LQWHJULW\ RI WKHGHVLJQ FRQFHSW RIWKH FRPSOHWHG 3URMHFWDVDIXQFWLRQLQJZKROHDVLQGLFDWHGE\WKH&RQWUDFW'RFXPHQWV&LW\ZLOOKDYHDXWKRULW\WR FRQGXFWVSHFLDOLQVSHFWLRQRUWHVWLQJRIWKH:RUNDVSURYLGHGLQ$UWLFOHZKHWKHURUQRWWKH:RUN LVIDEULFDWHGLQVWDOOHGRUFRPSOHWHG  Determinations for Work Performed  &RQWUDFWRUZLOOGHWHUPLQHWKHDFWXDOTXDQWLWLHVDQGFODVVLILFDWLRQVRI:RUNSHUIRUPHG&LW\¶V3URMHFW 0DQDJHU RU GXO\ DXWKRUL]HG UHSUHVHQWDWLYH ZLOO UHYLHZ ZLWK &RQWUDFWRU WKH SUHOLPLQDU\ GHWHUPLQDWLRQVRQVXFKPDWWHUVEHIRUHUHQGHULQJDZULWWHQUHFRPPHQGDWLRQ&LW\¶VZULWWHQGHFLVLRQ ZLOOEHILQDO H[FHSWDVPRGLILHGWRUHIOHFWFKDQJHGIDFWXDOFRQGLWLRQVRUPRUHDFFXUDWHGDWD          455   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Decisions on Requirements of Contract Documents and Acceptability of Work  $&LW\ZLOOEHWKHLQLWLDOLQWHUSUHWHURIWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVDQGMXGJHRIWKH DFFHSWDELOLW\RIWKH:RUNWKHUHXQGHU  %&LW\ZLOOUHQGHUDZULWWHQGHFLVLRQRQDQ\LVVXHUHIHUUHG  &&LW\¶VZULWWHQGHFLVLRQRQWKHLVVXHUHIHUUHGZLOOEHILQDODQGELQGLQJRQWKH&RQWUDFWRUVXEMHFW WRWKHSURYLVLRQVRI3DUDJUDSK  $57,&/(±&+$1*(6,17+(:25.&/$,06(;75$:25. Authorized Changes in the Work  $:LWKRXWLQYDOLGDWLQJWKH&RQWUDFWDQGZLWKRXWQRWLFHWRDQ\VXUHW\&LW\PD\DWDQ\WLPHRUIURP WLPHWRWLPHRUGHU([WUD:RUN8SRQQRWLFHRIVXFK([WUD:RUN&RQWUDFWRUVKDOOSURFHHGZLWK WKH:RUNLQYROYHGRQO\XSRQUHFHLYLQJZULWWHQQRWLFHIURP&LW\([WUD:RUNZLOOEHSHUIRUPHG XQGHUWKHDSSOLFDEOHFRQGLWLRQV RI WKH&RQWUDFW'RFXPHQWV H[FHSWDV RWKHUZLVHVSHFLILFDOO\ SURYLGHG ([WUD:RUNVKDOOEHPHPRULDOL]HGE\D&KDQJH2UGHUZKLFKPD\RUPD\QRWSUHFHGH DQRUGHURI([WUDZRUN  %)RUPLQRUFKDQJHVRI:RUNQRWUHTXLULQJFKDQJHVWR&RQWUDFW7LPHRU&RQWUDFW3ULFHD)LHOG 2UGHUPD\EHLVVXHGE\WKH&LW\  Unauthorized Changes in the Work  &RQWUDFWRUVKDOOQRWEHHQWLWOHGWRDQLQFUHDVHLQWKH&RQWUDFW3ULFHRUDQH[WHQVLRQRIWKH&RQWUDFW 7LPH ZLWK UHVSHFW WR DQ\ ZRUN SHUIRUPHG WKDW LV QRW UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV DV DPHQGHG PRGLILHG RU VXSSOHPHQWHG DV SURYLGHG LQ 3DUDJUDSK  H[FHSW LQ WKH FDVH RI DQ HPHUJHQF\DVSURYLGHGLQ3DUDJUDSK  Execution of Change Orders  $&LW\DQG&RQWUDFWRUVKDOOH[HFXWHDSSURSULDWH&KDQJH2UGHUVFRYHULQJ  FKDQJHVLQWKH:RUNZKLFKDUH L RUGHUHGE\&LW\SXUVXDQWWR3DUDJUDSK$ LL  UHTXLUHGEHFDXVHRIDFFHSWDQFHRIGHIHFWLYH:RUNXQGHU3DUDJUDSKRU&LW\¶VFRUUHFWLRQ RIGHIHFWLYH:RUNXQGHU3DUDJUDSKRU LLL DJUHHGWRE\WKHSDUWLHV  FKDQJHVLQWKH&RQWUDFW3ULFHRU&RQWUDFW7LPHZKLFKDUHDJUHHGWRE\WKHSDUWLHVLQFOXGLQJ DQ\XQGLVSXWHGVXPRUDPRXQWRIWLPHIRU:RUNDFWXDOO\SHUIRUPHG  Dispute ofExtra Work  $6KRXOGDGLIIHUHQFHDULVHDVWRZKDWGRHVRUGRHVQRWFRQVWLWXWH([WUD:RUNRUDVWRWKHSD\PHQW WKHUHRIDQGWKH&LW\LQVLVWVXSRQLWVSHUIRUPDQFHWKH&RQWUDFWRUVKDOOSURFHHGZLWKWKHZRUN DIWHUPDNLQJZULWWHQUHTXHVWIRUZULWWHQRUGHUVDQGVKDOONHHSDFFXUDWHDFFRXQWRIWKHDFWXDO       456   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 UHDVRQDEOH FRVW WKHUHRI &RQWUDFW &ODLPV UHJDUGLQJ ([WUD :RUN VKDOO EH PDGH SXUVXDQW WR 3DUDJUDSK  %7KH&RQWUDFWRUVKDOOIXUQLVKWKH&LW\VXFKLQVWDOODWLRQUHFRUGVRIDOOGHYLDWLRQVIURPWKHRULJLQDO &RQWUDFW'RFXPHQWVDVPD\EHQHFHVVDU\WRHQDEOHWKH&LW\WRSUHSDUHIRUSHUPDQHQWUHFRUGD FRUUHFWHGVHWRISODQVVKRZLQJWKHDFWXDOLQVWDOODWLRQ  &7KHFRPSHQVDWLRQDJUHHGXSRQIRU([WUD:RUNZKHWKHURUQRWLQLWLDWHGE\D&KDQJH2UGHUVKDOO EHDIXOOFRPSOHWHDQGILQDOSD\PHQWIRUDOOFRVWV&RQWUDFWRULQFXUVDVDUHVXOWRUUHODWLQJWRWKH FKDQJHRU([WUD:RUNZKHWKHUVDLGFRVWVDUHNQRZQXQNQRZQIRUHVHHQRUXQIRUHVHHQDWWKDW WLPHLQFOXGLQJZLWKRXWOLPLWDWLRQDQ\FRVWVIRUGHOD\H[WHQGHGRYHUKHDGULSSOHRULPSDFWFRVW RUDQ\RWKHUHIIHFWRQFKDQJHGRUXQFKDQJHGZRUNDVDUHVXOWRIWKHFKDQJHRU([WUD:RUN  Notification to Surety  ,IWKHSURYLVLRQVRIDQ\ERQGUHTXLUHQRWLFHWREHJLYHQWRDVXUHW\RIDQ\FKDQJHDIIHFWLQJWKH JHQHUDOVFRSHRIWKH:RUNRUWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWV LQFOXGLQJEXWQRWOLPLWHG WR &RQWUDFW 3ULFH RU &RQWUDFW 7LPH  WKH JLYLQJ RI DQ\ VXFK QRWLFH ZLOO EH &RQWUDFWRU¶V UHVSRQVLELOLW\7KHDPRXQWRIHDFKDSSOLFDEOHERQGZLOOEHDGMXVWHGE\WKH&RQWUDFWRUWRUHIOHFWWKH HIIHFWRIDQ\VXFKFKDQJH  Contract Claims Process  $&LW\¶V'HFLVLRQ5HTXLUHG$OO&RQWUDFW&ODLPVH[FHSWWKRVHZDLYHGSXUVXDQWWR3DUDJUDSK VKDOOEHUHIHUUHGWRWKH&LW\IRUGHFLVLRQ$GHFLVLRQE\&LW\VKDOOEHUHTXLUHGDVDFRQGLWLRQ SUHFHGHQWWRDQ\H[HUFLVHE\&RQWUDFWRURIDQ\ULJKWVRUUHPHGLHVKHPD\RWKHUZLVHKDYHXQGHU WKH&RQWUDFW'RFXPHQWVRUE\/DZVDQG5HJXODWLRQVLQUHVSHFWRIVXFK&RQWUDFW&ODLPV  %Notice:  :ULWWHQQRWLFHVWDWLQJWKHJHQHUDOQDWXUHRIHDFK&RQWUDFW&ODLPVKDOOEHGHOLYHUHGE\WKH &RQWUDFWRUWR&LW\QRODWHUWKDQGD\VDIWHUWKHVWDUWRIWKHHYHQWJLYLQJULVHWKHUHWR7KH UHVSRQVLELOLW\WRVXEVWDQWLDWHD&RQWUDFW&ODLPVKDOOUHVWZLWKWKHSDUW\PDNLQJWKH&RQWUDFW &ODLP  1RWLFHRIWKHDPRXQWRUH[WHQWRIWKH&RQWUDFW&ODLPZLWKVXSSRUWLQJGDWDVKDOOEHGHOLYHUHG WRWKH&LW\RQRUEHIRUHGD\VIURPWKHVWDUWRIWKHHYHQWJLYLQJULVHWKHUHWR XQOHVVWKH&LW\ DOORZVDGGLWLRQDOWLPHIRU&RQWUDFWRUWRVXEPLWDGGLWLRQDORUPRUHDFFXUDWHGDWDLQVXSSRUWRI VXFK&RQWUDFW&ODLP   $&RQWUDFW&ODLPIRUDQDGMXVWPHQWLQ&RQWUDFW3ULFHVKDOOEHSUHSDUHGLQDFFRUGDQFHZLWK WKHSURYLVLRQVRI3DUDJUDSK  $&RQWUDFW&ODLPIRUDQDGMXVWPHQWLQ&RQWUDFW7LPHVKDOOEHSUHSDUHGLQDFFRUGDQFHZLWK WKHSURYLVLRQVRI3DUDJUDSK        457   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 (DFK &RQWUDFW &ODLP VKDOO EH DFFRPSDQLHG E\ &RQWUDFWRU¶V ZULWWHQ VWDWHPHQW WKDW WKH DGMXVWPHQWFODLPHGLVWKHHQWLUHDGMXVWPHQWWRZKLFKWKH&RQWUDFWRUEHOLHYHVLWLVHQWLWOHGDVD UHVXOWRIVDLGHYHQW  7KH&LW\VKDOOVXEPLWDQ\UHVSRQVHWRWKH&RQWUDFWRUZLWKLQGD\VDIWHUUHFHLSWRIWKH FODLPDQW¶VODVWVXEPLWWDO XQOHVV&RQWUDFWDOORZVDGGLWLRQDOWLPH   &City’s Action&LW\ZLOOUHYLHZHDFK&RQWUDFW&ODLPDQGZLWKLQGD\VDIWHUUHFHLSWRIWKHODVW VXEPLWWDORIWKH&RQWUDFWRULIDQ\WDNHRQHRIWKHIROORZLQJDFWLRQVLQZULWLQJ  GHQ\WKH&RQWUDFW&ODLPLQZKROHRULQSDUW  DSSURYHWKH&RQWUDFW&ODLPRU  QRWLI\WKH&RQWUDFWRUWKDWWKH&LW\LVXQDEOHWRUHVROYHWKH&RQWUDFW&ODLPLILQWKH&LW\¶V VROH GLVFUHWLRQ LW ZRXOG EH LQDSSURSULDWH IRUWKH &LW\ WRGR VR )RU SXUSRVHV RI IXUWKHU UHVROXWLRQRIWKH&RQWUDFW&ODLPVXFKQRWLFHVKDOOEHGHHPHGDGHQLDO  '&LW\¶VZULWWHQDFWLRQXQGHU3DUDJUDSK&ZLOOEHILQDODQGELQGLQJXQOHVV&LW\RU &RQWUDFWRULQYRNHWKHGLVSXWHUHVROXWLRQSURFHGXUHVHWIRUWKLQ$UWLFOHZLWKLQGD\VRIVXFK DFWLRQRUGHQLDO  (1R&RQWUDFW&ODLPIRUDQDGMXVWPHQWLQ&RQWUDFW3ULFHRU&RQWUDFW7LPHZLOOEHYDOLGLIQRW VXEPLWWHGLQDFFRUGDQFHZLWKWKLV3DUDJUDSK  ),I WKH &LW\IDLOV WR WDNH DQ\ DFWLRQ SXUVXDQWWR 3DUDJUDSK  &  WKH FRQWUDFW &ODLP LV FRQVLGHUHGWRKDYHEHHQGHQLHGE\WKH&LW\  $57,&/(±&2672)7+(:25.$//2:$1&(681,735,&(:25.3/$16 48$17,7<0($685(0(17  Cost of the Work  $Costs Included: 7KHWHUP&RVWRIWKH:RUNPHDQVWKHVXPRIDOOFRVWVH[FHSWWKRVHH[FOXGHGLQ 3DUDJUDSK%QHFHVVDULO\LQFXUUHGDQGSDLGE\&RQWUDFWRULQWKHSURSHUSHUIRUPDQFHRIWKH :RUN:KHQWKHYDOXHRIDQ\:RUNFRYHUHGE\D&KDQJH2UGHUWKHFRVWVWREHUHLPEXUVHGWR &RQWUDFWRUZLOOEHRQO\WKRVHDGGLWLRQDORULQFUHPHQWDOFRVWVUHTXLUHGEHFDXVHRIWKHFKDQJHLQ WKH:RUN6XFKFRVWVVKDOOQRWLQFOXGHDQ\RIWKHFRVWVLWHPL]HGLQ3DUDJUDSK%DQGVKDOO LQFOXGHEXWQRWEHOLPLWHGWRWKHIROORZLQJLWHPV  3D\UROOFRVWVIRUHPSOR\HHVLQWKHGLUHFWHPSOR\RI&RQWUDFWRULQWKHSHUIRUPDQFHRIWKH :RUN XQGHU VFKHGXOHV RI MRE FODVVLILFDWLRQV DJUHHG XSRQ E\ &LW\ DQG &RQWUDFWRU 6XFK HPSOR\HHVVKDOOLQFOXGHZLWKRXWOLPLWDWLRQVXSHULQWHQGHQWVIRUHPHQDQGRWKHUSHUVRQQHO HPSOR\HGIXOOWLPHRQWKH:RUN3D\UROOFRVWVIRUHPSOR\HHVQRWHPSOR\HGIXOOWLPHRQWKH :RUNVKDOOEHDSSRUWLRQHGRQWKHEDVLVRIWKHLUWLPHVSHQWRQWKH:RUN3D\UROOFRVWVVKDOO LQFOXGH       458   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  DVDODULHVDQGZDJHVSOXVWKHFRVWRIIULQJHEHQHILWVZKLFKVKDOOLQFOXGHVRFLDOVHFXULW\ FRQWULEXWLRQVXQHPSOR\PHQWH[FLVHDQGSD\UROOWD[HVZRUNHUV¶FRPSHQVDWLRQKHDOWK DQGUHWLUHPHQWEHQHILWVERQXVHVVLFNOHDYHYDFDWLRQDQGKROLGD\SD\DSSOLFDEOHWKHUHWR 7KHH[SHQVHVRISHUIRUPLQJ:RUNRXWVLGHRI5HJXODU:RUNLQJ+RXUV:HHNHQG :RUNLQJ+RXUVRUOHJDOKROLGD\VVKDOOEHLQFOXGHGLQWKHDERYHWRWKHH[WHQWDXWKRUL]HG E\&LW\  &RVWRIDOOPDWHULDOVDQGHTXLSPHQWIXUQLVKHGDQGLQFRUSRUDWHGLQWKH:RUNLQFOXGLQJFRVWV RIWUDQVSRUWDWLRQDQGVWRUDJHWKHUHRIDQG6XSSOLHUV¶ILHOGVHUYLFHVUHTXLUHGLQFRQQHFWLRQ WKHUHZLWK  5HQWDOVRIDOOFRQVWUXFWLRQHTXLSPHQWDQGPDFKLQHU\DQGWKHSDUWVWKHUHRIZKHWKHUUHQWHG IURP&RQWUDFWRURURWKHUVLQDFFRUGDQFHZLWKUHQWDODJUHHPHQWVDSSURYHGE\&LW\DQGWKH FRVWVRIWUDQVSRUWDWLRQORDGLQJXQORDGLQJDVVHPEO\GLVPDQWOLQJDQGUHPRYDOWKHUHRI$OO VXFKFRVWVVKDOOEHLQDFFRUGDQFHZLWKWKHWHUPVRIVDLGUHQWDODJUHHPHQWV7KHUHQWDORIDQ\ VXFKHTXLSPHQWPDFKLQHU\RUSDUWVVKDOOFHDVHZKHQWKHXVHWKHUHRILVQRORQJHUQHFHVVDU\ IRUWKH:RUN  3D\PHQWVPDGHE\&RQWUDFWRUWR6XEFRQWUDFWRUVIRU:RUNSHUIRUPHGE\6XEFRQWUDFWRUV,I UHTXLUHGE\&LW\&RQWUDFWRUVKDOOREWDLQFRPSHWLWLYHELGVIURPVXEFRQWUDFWRUVDFFHSWDEOHWR &LW\DQG&RQWUDFWRUDQGVKDOOGHOLYHUVXFKELGVWR&LW\ZKRZLOOWKHQGHWHUPLQHZKLFKELGV LIDQ\ZLOOEHDFFHSWDEOH,IDQ\VXEFRQWUDFWSURYLGHVWKDWWKH6XEFRQWUDFWRULVWREHSDLGRQ WKHEDVLVRI&RVWRIWKH:RUNSOXVDIHHWKH6XEFRQWUDFWRU¶V&RVWRIWKH:RUNDQGIHHVKDOO EHGHWHUPLQHGLQWKHVDPHPDQQHUDV&RQWUDFWRU¶V&RVWRIWKH:RUNDQGIHHDVSURYLGHGLQ WKLV3DUDJUDSK  &RVWV RI VSHFLDO FRQVXOWDQWV LQFOXGLQJ EXW QRW OLPLWHG WR HQJLQHHUV DUFKLWHFWV WHVWLQJ ODERUDWRULHVVXUYH\RUVDWWRUQH\VDQGDFFRXQWDQWV HPSOR\HGIRUVHUYLFHVVSHFLILFDOO\UHODWHG WRWKH:RUN  6XSSOHPHQWDOFRVWVLQFOXGLQJWKHIROORZLQJ  D7KH SURSRUWLRQ RI QHFHVVDU\ WUDQVSRUWDWLRQ WUDYHO DQGVXEVLVWHQFH H[SHQVHV RI &RQWUDFWRU¶VHPSOR\HHVLQFXUUHGLQGLVFKDUJHRIGXWLHVFRQQHFWHGZLWKWKH:RUN  E&RVW LQFOXGLQJ WUDQVSRUWDWLRQ DQG PDLQWHQDQFH RI DOO PDWHULDOV VXSSOLHV HTXLSPHQW PDFKLQHU\DSSOLDQFHVRIILFHDQGWHPSRUDU\IDFLOLWLHVDWWKH6LWHDQGKDQGWRROVQRW RZQHGE\WKHZRUNHUVZKLFKDUHFRQVXPHGLQWKHSHUIRUPDQFHRIWKH:RUNDQGFRVW OHVVPDUNHWYDOXHRIVXFKLWHPVXVHGEXWQRWFRQVXPHGZKLFKUHPDLQWKHSURSHUW\RI &RQWUDFWRU  F6DOHVFRQVXPHUXVHDQGRWKHUVLPLODUWD[HVUHODWHGWRWKH:RUNDQGIRUZKLFK &RQWUDFWRU LV OLDEOH QRW FRYHUHG XQGHU 3DUDJUDSK  DV LPSRVHG E\ /DZV DQG 5HJXODWLRQV        459   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 G'HSRVLWV ORVW IRU FDXVHV RWKHU WKDQ QHJOLJHQFH RI &RQWUDFWRU DQ\ 6XEFRQWUDFWRU RU DQ\RQHGLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPRUIRUZKRVHDFWVDQ\RIWKHPPD\ EHOLDEOHDQGUR\DOW\SD\PHQWVDQGIHHVIRUSHUPLWVDQGOLFHQVHV  H/RVVHV DQG GDPDJHV DQG UHODWHG H[SHQVHV  FDXVHG E\ GDPDJH WR WKH :RUN QRW FRPSHQVDWHGE\LQVXUDQFHRURWKHUZLVHVXVWDLQHGE\&RQWUDFWRULQFRQQHFWLRQZLWKWKH SHUIRUPDQFHRIWKH:RUNSURYLGHGVXFKORVVHVDQGGDPDJHVKDYHUHVXOWHGIURPFDXVHV RWKHU WKDQ WKH QHJOLJHQFH RI &RQWUDFWRU DQ\ 6XEFRQWUDFWRU RUDQ\RQH GLUHFWO\ RU LQGLUHFWO\HPSOR\HGE\DQ\RIWKHPRUIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOH6XFK ORVVHVVKDOOLQFOXGHVHWWOHPHQWVPDGHZLWKWKHZULWWHQFRQVHQWDQGDSSURYDORI&LW\1R VXFKORVVHVGDPDJHVDQGH[SHQVHVVKDOOEHLQFOXGHGLQWKH&RVWRIWKH:RUNIRUWKH SXUSRVHRIGHWHUPLQLQJ&RQWUDFWRU¶VIHH  I7KHFRVWRIXWLOLWLHVIXHODQGVDQLWDU\IDFLOLWLHVDWWKH6LWH  J0LQRU H[SHQVHV VXFK DV WHOHJUDPV ORQJ GLVWDQFH WHOHSKRQH FDOOV WHOHSKRQH DQG FRPPXQLFDWLRQVHUYLFHVDWWKH6LWHH[SUHVVDQGFRXULHUVHUYLFHVDQGVLPLODUSHWW\FDVK LWHPVLQFRQQHFWLRQZLWKWKH:RUN  K7KHFRVWVRISUHPLXPVIRUDOOERQGVDQGLQVXUDQFH&RQWUDFWRULVUHTXLUHGE\WKH&RQWUDFW 'RFXPHQWVWRSXUFKDVHDQGPDLQWDLQ  %Costs Excluded: 7KHWHUP&RVWRIWKH:RUNVKDOOQRWLQFOXGHDQ\RIWKHIROORZLQJLWHPV  3D\UROO FRVWV DQG RWKHU FRPSHQVDWLRQ RI &RQWUDFWRU¶V RIILFHUVH[HFXWLYHV SULQFLSDOV RI SDUWQHUVKLSV DQG VROH SURSULHWRUVKLSV  JHQHUDO PDQDJHUV VDIHW\ PDQDJHUV HQJLQHHUV DUFKLWHFWV HVWLPDWRUV DWWRUQH\V DXGLWRUV DFFRXQWDQWV SXUFKDVLQJDQG FRQWUDFWLQJ DJHQWV H[SHGLWHUVWLPHNHHSHUVFOHUNVDQGRWKHUSHUVRQQHOHPSOR\HGE\&RQWUDFWRUZKHWKHUDWWKH 6LWHRULQ&RQWUDFWRU¶VSULQFLSDORUEUDQFKRIILFHIRUJHQHUDODGPLQLVWUDWLRQRIWKH:RUNDQG QRWVSHFLILFDOO\LQFOXGHGLQWKHDJUHHGXSRQVFKHGXOHRIMREFODVVLILFDWLRQVUHIHUUHGWRLQ 3DUDJUDSK$RUVSHFLILFDOO\FRYHUHGE\3DUDJUDSK$DOORIZKLFKDUHWREH FRQVLGHUHGDGPLQLVWUDWLYHFRVWVFRYHUHGE\WKH&RQWUDFWRU¶VIHH  ([SHQVHVRI&RQWUDFWRU¶VSULQFLSDODQGEUDQFKRIILFHVRWKHUWKDQ&RQWUDFWRU¶VRIILFHDWWKH 6LWH  $Q\SDUWRI&RQWUDFWRU¶VFDSLWDOH[SHQVHVLQFOXGLQJLQWHUHVWRQ&RQWUDFWRU¶VFDSLWDO HPSOR\HGIRUWKH:RUNDQGFKDUJHVDJDLQVW&RQWUDFWRUIRUGHOLQTXHQWSD\PHQWV  &RVWVGXHWRWKHQHJOLJHQFHRI&RQWUDFWRUDQ\6XEFRQWUDFWRURUDQ\RQHGLUHFWO\RULQGLUHFWO\ HPSOR\HGE\DQ\RIWKHPRUIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOHLQFOXGLQJEXWQRW OLPLWHGWRWKHFRUUHFWLRQRIGHIHFWLYH:RUNGLVSRVDORIPDWHULDOVRUHTXLSPHQWZURQJO\ VXSSOLHGDQGPDNLQJJRRGDQ\GDPDJHWRSURSHUW\  2WKHURYHUKHDGRUJHQHUDOH[SHQVHFRVWVRIDQ\NLQG        460   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &Contractor’s Fee: :KHQDOOWKH:RUNLVSHUIRUPHGRQWKHEDVLVRIFRVWSOXV&RQWUDFWRU¶VIHH VKDOOEHGHWHUPLQHGDVVHWIRUWKLQWKH$JUHHPHQW:KHQWKHYDOXHRIDQ\:RUNFRYHUHGE\D &KDQJH2UGHUIRUDQDGMXVWPHQWLQ&RQWUDFW3ULFHLVGHWHUPLQHGRQWKHEDVLVRI&RVWRIWKH :RUN&RQWUDFWRU¶VIHHVKDOOEHGHWHUPLQHGDVVHWIRUWKLQ3DUDJUDSK&  'Documentation: :KHQHYHUWKH&RVWRIWKH:RUNIRUDQ\SXUSRVHLVWREHGHWHUPLQHGSXUVXDQWWR 3DUDJUDSKV $ DQG % &RQWUDFWRU ZLOO HVWDEOLVK DQG PDLQWDLQ UHFRUGV WKHUHRI LQ DFFRUGDQFHZLWKJHQHUDOO\DFFHSWHGDFFRXQWLQJSUDFWLFHVDQGVXEPLWLQDIRUPDFFHSWDEOHWR&LW\ DQLWHPL]HGFRVWEUHDNGRZQWRJHWKHUZLWKVXSSRUWLQJGDWD  Allowances  $Specified Allowance: ,W LV XQGHUVWRRG WKDW &RQWUDFWRU KDV LQFOXGHG LQ WKH &RQWUDFW 3ULFH DOO DOORZDQFHVVRQDPHGLQWKH&RQWUDFW'RFXPHQWVDQGVKDOOFDXVHWKH:RUNVRFRYHUHGWREH SHUIRUPHGIRUVXFKVXPVDQGE\VXFKSHUVRQVRUHQWLWLHVDVPD\EHDFFHSWDEOHWR&LW\  %Cash Allowances:  &RQWUDFWRUDJUHHVWKDW  DWKHFDVKDOORZDQFHVLQFOXGHWKHFRVWWR&RQWUDFWRU OHVVDQ\DSSOLFDEOHWUDGHGLVFRXQWV  RIPDWHULDOVDQGHTXLSPHQWUHTXLUHGE\WKHDOORZDQFHVWREHGHOLYHUHGDWWKH6LWHDQGDOO DSSOLFDEOHWD[HVDQG  E&RQWUDFWRU¶VFRVWVIRUXQORDGLQJDQGKDQGOLQJRQWKH6LWHODERULQVWDOODWLRQRYHUKHDG SURILWDQGRWKHUH[SHQVHVFRQWHPSODWHGIRUWKHFDVKDOORZDQFHVKDYHEHHQLQFOXGHGLQ WKHDOORZDQFHVDQGQRGHPDQGIRUDGGLWLRQDOSD\PHQWRQDFFRXQWRIDQ\RIWKH IRUHJRLQJZLOOEHYDOLG  &Contingency Allowance: &RQWUDFWRUDJUHHVWKDWDFRQWLQJHQF\DOORZDQFHLIDQ\LVIRUWKHVROH XVHRI&LW\  '3ULRUWRILQDOSD\PHQWDQDSSURSULDWH&KDQJH2UGHUZLOOEHLVVXHGWRUHIOHFWDFWXDODPRXQWVGXH &RQWUDFWRU RQ DFFRXQW RI :RUN FRYHUHG E\ DOORZDQFHV DQG WKH &RQWUDFW3ULFHVKDOOEH FRUUHVSRQGLQJO\DGMXVWHG  Unit Price Work  $:KHUHWKH&RQWUDFW'RFXPHQWVSURYLGHWKDWDOORUSDUWRIWKH:RUNLVWREH8QLW3ULFH:RUN LQLWLDOO\WKH&RQWUDFW3ULFHZLOOEHGHHPHGWRLQFOXGHIRUDOO8QLW3ULFH:RUNDQDPRXQWHTXDOWR WKH VXP RI WKH XQLW SULFH IRU HDFK VHSDUDWHO\ LGHQWLILHG LWHP RI8QLW3ULFH:RUNWLPHVWKH HVWLPDWHGTXDQWLW\RIHDFKLWHPDVLQGLFDWHGLQWKH$JUHHPHQW  %7KHHVWLPDWHGTXDQWLWLHVRILWHPVRI8QLW3ULFH:RUNDUHQRWJXDUDQWHHGDQGDUHVROHO\IRUWKH SXUSRVHRIFRPSDULVRQRI%LGVDQGGHWHUPLQLQJDQLQLWLDO&RQWUDFW3ULFH'HWHUPLQDWLRQVRIWKH DFWXDOTXDQWLWLHVDQGFODVVLILFDWLRQVRI8QLW3ULFH:RUNSHUIRUPHGE\&RQWUDFWRUZLOOEHPDGHE\       461   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &LW\VXEMHFWWRWKHSURYLVLRQVRI3DUDJUDSK  &(DFKXQLWSULFHZLOOEHGHHPHGWRLQFOXGHDQDPRXQWFRQVLGHUHGE\&RQWUDFWRUWREHDGHTXDWHWR FRYHU&RQWUDFWRU¶VRYHUKHDGDQGSURILWIRUHDFKVHSDUDWHO\LGHQWLILHGLWHP:RUNGHVFULEHGLQWKH &RQWUDFW'RFXPHQWVRUUHDVRQDEO\LQIHUUHGDVUHTXLUHGIRUDIXQFWLRQDOO\FRPSOHWHLQVWDOODWLRQ EXWQRWLGHQWLILHGLQWKHOLVWLQJRIXQLWSULFHLWHPVVKDOOEHFRQVLGHUHGLQFLGHQWDOWRXQLWSULFH ZRUNOLVWHGDQGWKHFRVWRILQFLGHQWDOZRUNLQFOXGHGDVSDUWRIWKHXQLWSULFH  '&LW\PD\PDNHDQDGMXVWPHQWLQWKH&RQWUDFW3ULFHLQDFFRUGDQFHZLWK3DUDJUDSKLI  WKHTXDQWLW\RIDQ\LWHPRI8QLW3ULFH:RUNSHUIRUPHGE\&RQWUDFWRUGLIIHUVPDWHULDOO\DQG VLJQLILFDQWO\IURPWKHHVWLPDWHGTXDQWLW\RIVXFKLWHPLQGLFDWHGLQWKH$JUHHPHQWDQG  WKHUHLVQRFRUUHVSRQGLQJDGMXVWPHQWZLWKUHVSHFWWRDQ\RWKHULWHPRI:RUN  (Increased or Decreased Quantities: 7KH&LW\UHVHUYHVWKHULJKWWRRUGHU([WUD:RUNLQ DFFRUGDQFHZLWK3DUDJUDSK  ,IWKHFKDQJHVLQTXDQWLWLHVRUWKHDOWHUDWLRQVGRQRWVLJQLILFDQWO\FKDQJHWKHFKDUDFWHURI ZRUNXQGHUWKH&RQWUDFW'RFXPHQWVWKHDOWHUHGZRUNZLOOEHSDLGIRUDWWKH&RQWUDFWXQLW SULFH  ,IWKHFKDQJHVLQTXDQWLWLHVRUDOWHUDWLRQVVLJQLILFDQWO\FKDQJHWKHFKDUDFWHURIZRUNWKH &RQWUDFWZLOOEHDPHQGHGE\D&KDQJH2UGHU  ,IQRXQLWSULFHVH[LVWWKLVZLOOEHFRQVLGHUHG([WUD:RUNDQGWKH&RQWUDFWZLOOEHDPHQGHG E\D&KDQJH2UGHULQDFFRUGDQFHZLWK$UWLFOH  $VLJQLILFDQWFKDQJHLQWKHFKDUDFWHURIZRUNRFFXUVZKHQ  DWKHFKDUDFWHURIZRUNIRUDQ\,WHPDVDOWHUHGGLIIHUVPDWHULDOO\LQNLQGRUQDWXUHIURPWKDW LQWKH&RQWUDFWRU  ED0DMRU,WHPRIZRUNYDULHVE\PRUHWKDQIURPWKHRULJLQDO&RQWUDFWTXDQWLW\  :KHQWKHTXDQWLW\RIZRUNWREHGRQHXQGHUDQ\0DMRU,WHPRIWKH&RQWUDFWLVPRUHWKDQ RIWKHRULJLQDOTXDQWLW\VWDWHGLQWKH&RQWUDFWWKHQHLWKHUSDUW\WRWKH&RQWUDFWPD\ UHTXHVWDQDGMXVWPHQWWRWKHXQLWSULFHRQWKHSRUWLRQRIWKHZRUNWKDWLVDERYH  :KHQWKHTXDQWLW\RIZRUNWREHGRQHXQGHUDQ\0DMRU,WHPRIWKH&RQWUDFWLVOHVVWKDQ RIWKHRULJLQDOTXDQWLW\VWDWHGLQWKH&RQWUDFWWKHQHLWKHUSDUW\WRWKH&RQWUDFWPD\UHTXHVW DQDGMXVWPHQWWRWKHXQLWSULFH         462   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Plans Quantity Measurement for Unclassified Excavation or Embankment  $3ODQVTXDQWLWLHVPD\RUPD\QRWUHSUHVHQWWKHH[DFWTXDQWLW\RIZRUNSHUIRUPHGRUPDWHULDO PRYHGKDQGOHGRUSODFHGGXULQJWKHH[HFXWLRQRIWKH&RQWUDFW7KHHVWLPDWHGELGTXDQWLWLHVDUH GHVLJQDWHGDVILQDOSD\PHQWTXDQWLWLHVXQOHVVUHYLVHGE\WKHJRYHUQLQJ6HFWLRQRUWKLV$UWLFOH  %,IWKHTXDQWLW\PHDVXUHGDVRXWOLQHGXQGHU³3ULFHDQG3D\PHQW3URFHGXUHV´YDULHVE\PRUHWKDQ  RUDVVWLSXODWHGXQGHU³3ULFHDQG3D\PHQW3URFHGXUHV´IRUVSHFLILF,WHPV IURPWKHWRWDO HVWLPDWHG TXDQWLW\ IRU DQ LQGLYLGXDO ,WHP RULJLQDOO\ VKRZQ LQ WKH &RQWUDFW 'RFXPHQWV DQ DGMXVWPHQWPD\EHPDGHWRWKHTXDQWLW\RIDXWKRUL]HGZRUNGRQHIRUSD\PHQWSXUSRVHV7KH SDUW\WRWKH&RQWUDFWUHTXHVWLQJWKHDGMXVWPHQWZLOOSURYLGHILHOGPHDVXUHPHQWVDQGFDOFXODWLRQV VKRZLQJWKHILQDOTXDQWLW\IRUZKLFKSD\PHQWZLOOEHPDGH3D\PHQWIRUUHYLVHGTXDQWLW\ZLOOEH PDGHDWWKHXQLWSULFHELGIRUWKDW,WHPH[FHSWDVSURYLGHGIRULQ$UWLFOH  &:KHQTXDQWLWLHVDUHUHYLVHGE\DFKDQJHLQGHVLJQDSSURYHGE\WKH&LW\E\&KDQJH2UGHURUWR FRUUHFWDQHUURURUWRFRUUHFWDQHUURURQWKHSODQVWKHSODQVTXDQWLW\ZLOOEHLQFUHDVHGRU GHFUHDVHGE\WKHDPRXQWLQYROYHGLQWKHFKDQJHDQGWKHYDULDQFHZLOODSSO\WRWKHQHZ SODQVTXDQWLW\  ',IWKHWRWDO&RQWUDFWTXDQWLW\PXOWLSOLHGE\WKHXQLWSULFHELGIRUDQLQGLYLGXDO,WHPLVOHVVWKDQ DQGWKH,WHPLVQRWRULJLQDOO\DSODQVTXDQWLW\,WHPWKHQWKH,WHPPD\EHSDLGDVDSODQV TXDQWLW\,WHPLIWKH&LW\DQG&RQWUDFWRUDJUHHLQZULWLQJWRIL[WKHILQDOTXDQWLW\DVDSODQV TXDQWLW\  ()RUFDOORXWZRUNRUQRQVLWHVSHFLILF&RQWUDFWVWKHSODQVTXDQWLW\PHDVXUHPHQWUHTXLUHPHQWVDUH QRWDSSOLFDEOH  $57,&/(±&+$1*(2)&2175$&735,&(&+$1*(2)&2175$&77,0(  Change of Contract Price  $7KH&RQWUDFW3ULFHPD\RQO\EHFKDQJHGE\D&KDQJH2UGHU  %7KHYDOXHRIDQ\:RUNFRYHUHGE\D&KDQJH2UGHUZLOOEHGHWHUPLQHGDVIROORZV  ZKHUHWKH:RUNLQYROYHGLVFRYHUHGE\XQLWSULFHVFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWVE\ DSSOLFDWLRQ RI VXFK XQLW SULFHV WR WKH TXDQWLWLHV RI WKH LWHPVLQYROYHG VXEMHFW WR WKH SURYLVLRQVRI3DUDJUDSK RU  ZKHUHWKH:RUNLQYROYHGLVQRWFRYHUHGE\XQLWSULFHVFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWV E\DPXWXDOO\DJUHHGOXPSVXPRUXQLWSULFH ZKLFKPD\LQFOXGHDQDOORZDQFHIRURYHUKHDG DQGSURILWQRWQHFHVVDULO\LQDFFRUGDQFHZLWK3DUDJUDSK& DQGVKDOOLQFOXGHWKHFRVW RIDQ\VHFRQGDU\LPSDFWVWKDWDUHIRUHVHHDEOHDWWKHWLPHRISULFLQJWKHFRVWRI([WUD:RUN RU  ZKHUHWKH:RUNLQYROYHGLVQRWFRYHUHGE\XQLWSULFHVFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWV       463   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 DQGDJUHHPHQWWRDOXPSVXPRUXQLWSULFHLVQRWUHDFKHGXQGHU3DUDJUDSK%RQWKH EDVLV RI WKH &RVW RI WKH :RUN GHWHUPLQHG DV SURYLGHG LQ 3DUDJUDSK   SOXV D &RQWUDFWRU¶VIHHIRURYHUKHDGDQGSURILW GHWHUPLQHGDVSURYLGHGLQ3DUDJUDSK&   &Contractor’s Fee: 7KH&RQWUDFWRU¶VDGGLWLRQDOIHHIRURYHUKHDGDQGSURILWVKDOOEHGHWHUPLQHGDV IROORZV  DPXWXDOO\DFFHSWDEOHIL[HGIHHRU  LIDIL[HGIHHLVQRWDJUHHGXSRQWKHQDIHHEDVHGRQWKHIROORZLQJSHUFHQWDJHVRIWKHYDULRXV SRUWLRQVRIWKH&RVWRIWKH:RUN  DIRUFRVWVLQFXUUHGXQGHU3DUDJUDSKV$$DQG$WKH &RQWUDFWRU¶VDGGLWLRQDOIHHVKDOOEHSHUFHQWH[FHSWIRU   UHQWDOIHHVIRU&RQWUDFWRU¶VRZQHTXLSPHQWXVLQJVWDQGDUGUHQWDOUDWHV   ERQGVDQGLQVXUDQFH  EIRUFRVWVLQFXUUHGXQGHU3DUDJUDSK$DQG$WKH&RQWUDFWRU¶VIHHVKDOOEH ILYHSHUFHQW     ZKHUHRQHRUPRUHWLHUVRIVXEFRQWUDFWVDUHRQWKHEDVLVRI&RVWRIWKH:RUNSOXVDIHH DQGQRIL[HGIHHLVDJUHHGXSRQWKHLQWHQWRI3DUDJUDSKV&DDQG &ELVWKDWWKH6XEFRQWUDFWRUZKRDFWXDOO\SHUIRUPVWKH:RUNDWZKDWHYHU WLHUZLOOEHSDLGDIHHRISHUFHQWRIWKHFRVWVLQFXUUHGE\VXFK6XEFRQWUDFWRUXQGHU 3DUDJUDSKV$DQG$DQGWKDWDQ\KLJKHUWLHU6XEFRQWUDFWRUDQG &RQWUDFWRUZLOOHDFKEHSDLGDIHHRIILYHSHUFHQW  RIWKHDPRXQWSDLGWRWKHQH[W ORZHUWLHU6XEFRQWUDFWRUKRZHYHULQQRFDVHVKDOOWKHFXPXODWLYHWRWDORIIHHVSDLGEH LQH[FHVVRI  FQRIHHVKDOOEHSD\DEOHRQWKHEDVLVRIFRVWVLWHPL]HGXQGHU3DUDJUDSKV$DQG %  GWKHDPRXQWRIFUHGLWWREHDOORZHGE\&RQWUDFWRUWR&LW\IRUDQ\FKDQJHZKLFKUHVXOWVLQ D QHW GHFUHDVH LQ FRVW ZLOO EH WKH DPRXQW RI WKH DFWXDO QHW GHFUHDVH LQ FRVW SOXV D GHGXFWLRQ LQ &RQWUDFWRU¶V IHH E\ DQ DPRXQW HTXDO WR ILYH SHUFHQW   RI VXFK QHW GHFUHDVH  Change of Contract Time  $7KH&RQWUDFW7LPHPD\RQO\EHFKDQJHGE\D&KDQJH2UGHU  %1RH[WHQVLRQRIWKH&RQWUDFW7LPHZLOOEHDOORZHGIRU([WUD:RUNRUIRUFODLPHGGHOD\XQOHVV WKH([WUD:RUNFRQWHPSODWHGRUFODLPHGGHOD\LVVKRZQWREHRQWKHFULWLFDOSDWKRIWKH3URMHFW 6FKHGXOH RU &RQWUDFWRU FDQ VKRZ E\ &ULWLFDO 3DWK 0HWKRG DQDO\VLV KRZ WKH ([WUD :RUN RU FODLPHGGHOD\DGYHUVHO\DIIHFWVWKHFULWLFDOSDWK       464   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  Delays  $:KHUH&RQWUDFWRULVUHDVRQDEO\GHOD\HGLQWKHSHUIRUPDQFHRUFRPSOHWLRQRIDQ\SDUWRIWKH :RUNZLWKLQWKH&RQWUDFW7LPHGXHWRGHOD\EH\RQGWKHFRQWURORI&RQWUDFWRUWKH&RQWUDFW7LPH PD\EHH[WHQGHGLQDQDPRXQWHTXDOWRWKHWLPHORVWGXHWRVXFKGHOD\LID&RQWUDFW&ODLPLV PDGHWKHUHIRU'HOD\VEH\RQGWKHFRQWURORI&RQWUDFWRUVKDOOLQFOXGHEXWQRWEHOLPLWHGWRDFWV RUQHJOHFWE\&LW\DFWVRUQHJOHFWRIXWLOLW\RZQHUVRURWKHUFRQWUDFWRUVSHUIRUPLQJRWKHUZRUNDV FRQWHPSODWHGE\$UWLFOHILUHVIORRGVHSLGHPLFVDEQRUPDOZHDWKHUFRQGLWLRQVRUDFWVRI*RG 6XFKDQDGMXVWPHQWVKDOOEH&RQWUDFWRU¶VVROHDQGH[FOXVLYHUHPHG\IRUWKHGHOD\VGHVFULEHGLQ WKLV3DUDJUDSK  %,I&RQWUDFWRULVGHOD\HG&LW\VKDOOQRWEHOLDEOHWR&RQWUDFWRUIRUDQ\FODLPVFRVWVORVVHVRU GDPDJHV LQFOXGLQJEXWQRWOLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQG RWKHUSURIHVVLRQDOVDQGDOOFRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWV VXVWDLQHGE\ &RQWUDFWRURQRULQFRQQHFWLRQZLWKDQ\RWKHUSURMHFWRUDQWLFLSDWHGSURMHFW  &&RQWUDFWRUVKDOOQRWEHHQWLWOHGWRDQDGMXVWPHQWLQ&RQWUDFW3ULFHRU&RQWUDFW7LPHIRUGHOD\V ZLWKLQWKHFRQWURORI&RQWUDFWRU'HOD\VDWWULEXWDEOHWRDQGZLWKLQWKHFRQWURORID6XEFRQWUDFWRU RU6XSSOLHUVKDOOEHGHHPHGWREHGHOD\VZLWKLQWKHFRQWURORI&RQWUDFWRU  '7KH&RQWUDFWRUVKDOOUHFHLYHQRFRPSHQVDWLRQIRUGHOD\VRUKLQGUDQFHVWRWKH:RUNH[FHSWZKHQ GLUHFWDQGXQDYRLGDEOHH[WUDFRVWWRWKH&RQWUDFWRULVFDXVHGE\WKHIDLOXUHRIWKH&LW\WRSURYLGH LQIRUPDWLRQRUPDWHULDOLIDQ\ZKLFKLVWREHIXUQLVKHGE\WKH&LW\  $57,&/(±7(676$1',163(&7,216&255(&7,215(029$/25$&&(37$1&(2) '()(&7,9(:25.  Notice of Defects  1RWLFH RI DOO GHIHFWLYH :RUN RI ZKLFK &LW\ KDV DFWXDO NQRZOHGJH ZLOO EH JLYHQ WR &RQWUDFWRU 'HIHFWLYH:RUNPD\EHUHMHFWHGFRUUHFWHGRUDFFHSWHGDVSURYLGHGLQWKLV$UWLFOH  Access to Work  &LW\LQGHSHQGHQWWHVWLQJODERUDWRULHVDQGJRYHUQPHQWDODJHQFLHVZLWKMXULVGLFWLRQDOLQWHUHVWVZLOO KDYHDFFHVVWRWKH6LWHDQGWKH :RUNDWUHDVRQDEOHWLPHVIRUWKHLUREVHUYDWLRQLQVSHFWLRQDQG WHVWLQJ&RQWUDFWRUVKDOOSURYLGHWKHPSURSHUDQGVDIHFRQGLWLRQVIRUVXFKDFFHVVDQGDGYLVHWKHPRI &RQWUDFWRU¶VVDIHW\SURFHGXUHVDQGSURJUDPVVRWKDWWKH\PD\FRPSO\WKHUHZLWKDVDSSOLFDEOH  Tests and Inspections  $&RQWUDFWRUVKDOOJLYH&LW\WLPHO\QRWLFHRIUHDGLQHVVRIWKH:RUNIRUDOOUHTXLUHGLQVSHFWLRQV WHVWVRUDSSURYDOVDQGVKDOOFRRSHUDWHZLWKLQVSHFWLRQDQGWHVWLQJSHUVRQQHOWRIDFLOLWDWHUHTXLUHG LQVSHFWLRQVRUWHVWV  %,I&RQWUDFW'RFXPHQWV/DZVRU5HJXODWLRQVRIDQ\SXEOLFERG\KDYLQJMXULVGLFWLRQUHTXLUHDQ\       465   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 RIWKH:RUN RUSDUWWKHUHRI WREHLQVSHFWHGWHVWHGRUDSSURYHG&RQWUDFWRUVKDOODVVXPHIXOO UHVSRQVLELOLW\ IRU DUUDQJLQJ DQG REWDLQLQJ VXFK LQGHSHQGHQW LQVSHFWLRQV WHVWV UHWHVWV RU DSSURYDOVSD\DOOFRVWVLQFRQQHFWLRQWKHUHZLWKDQGIXUQLVK&LW\WKHUHTXLUHGFHUWLILFDWHVRI LQVSHFWLRQ RU DSSURYDO H[FHSWLQJ KRZHYHU WKRVH IHHV VSHFLILFDOO\ LGHQWLILHG LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV RU DQ\ 7H[DV 'HSDUWPHQW RI /LFHQVXUH DQG 5HJXODWLRQ 7'/5  LQVSHFWLRQVZKLFKVKDOOEHSDLGDVGHVFULEHGLQWKH6XSSOHPHQWDU\&RQGLWLRQV  &&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDUUDQJLQJDQGREWDLQLQJDQGVKDOOSD\DOOFRVWVLQFRQQHFWLRQ ZLWKDQ\LQVSHFWLRQVWHVWVUHWHVWVRUDSSURYDOVUHTXLUHGIRU&LW\¶VDFFHSWDQFHRIPDWHULDOVRU HTXLSPHQWWREHLQFRUSRUDWHGLQWKH:RUNRUDFFHSWDQFHRIPDWHULDOVPL[GHVLJQVRUHTXLSPHQW VXEPLWWHGIRUDSSURYDOSULRUWR&RQWUDFWRU¶VSXUFKDVHWKHUHRIIRULQFRUSRUDWLRQLQWKH:RUN 6XFKLQVSHFWLRQVWHVWVUHWHVWVRUDSSURYDOVVKDOOEHSHUIRUPHGE\RUJDQL]DWLRQVDFFHSWDEOHWR &LW\  '&LW\ PD\ DUUDQJH IRU WKH VHUYLFHV RI DQ LQGHSHQGHQW WHVWLQJ ODERUDWRU\ ³7HVWLQJ /DE´  WR SHUIRUPDQ\LQVSHFWLRQVRUWHVWV ³7HVWLQJ´ IRUDQ\SDUWRIWKH:RUNDVGHWHUPLQHGVROHO\E\ &LW\  &LW\ZLOOFRRUGLQDWHVXFK7HVWLQJWRWKHH[WHQWSRVVLEOHZLWK&RQWUDFWRU  6KRXOGDQ\7HVWLQJXQGHUWKLV6HFWLRQ'UHVXOWLQD³IDLO´³GLGQRWSDVV´RURWKHU VLPLODUQHJDWLYHUHVXOWWKH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUSD\LQJIRUDQ\DQGDOOUHWHVWV &RQWUDFWRU¶VFDQFHOODWLRQZLWKRXWFDXVHRI&LW\LQLWLDWHG7HVWLQJVKDOOEHGHHPHGDQHJDWLYH UHVXOWDQGUHTXLUHDUHWHVW  $Q\DPRXQWVRZHGIRUDQ\UHWHVWXQGHUWKLV6HFWLRQ'VKDOOEHSDLGGLUHFWO\WRWKH 7HVWLQJ/DEE\&RQWUDFWRU &LW\ZLOOIRUZDUGDOOLQYRLFHVIRUUHWHVWVWR&RQWUDFWRU  ,I&RQWUDFWRUIDLOVWRSD\WKH7HVWLQJ/DE&LW\ZLOOQRWLVVXH)LQDO3D\PHQWXQWLOWKH7HVWLQJ /DELVSDLG  (,IDQ\:RUN RUWKHZRUNRIRWKHUV WKDWLVWREHLQVSHFWHGWHVWHGRUDSSURYHGLVFRYHUHGE\ &RQWUDFWRUZLWKRXWZULWWHQFRQFXUUHQFHRI&LW\&RQWUDFWRUVKDOOLIUHTXHVWHGE\&LW\XQFRYHU VXFK:RUNIRUREVHUYDWLRQ  )8QFRYHULQJ:RUNDVSURYLGHGLQ3DUDJUDSK(VKDOOEHDW&RQWUDFWRU¶VH[SHQVH  *&RQWUDFWRUVKDOOKDYHWKHULJKWWRPDNHD&RQWUDFW&ODLPUHJDUGLQJDQ\UHWHVWRULQYRLFHLVVXHG XQGHU6HFWLRQ'         466   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Uncovering Work  $,IDQ\:RUNLVFRYHUHGFRQWUDU\WRWKH&RQWUDFW'RFXPHQWVRUVSHFLILFLQVWUXFWLRQVE\WKH&LW\LW PXVWLIUHTXHVWHGE\&LW\EHXQFRYHUHGIRU&LW\¶VREVHUYDWLRQDQGUHSODFHGDW&RQWUDFWRU¶V H[SHQVH  %,I&LW\FRQVLGHUVLWQHFHVVDU\RUDGYLVDEOHWKDWFRYHUHG:RUNEHREVHUYHGE\&LW\RULQVSHFWHGRU WHVWHGE\RWKHUV&RQWUDFWRUDW&LW\¶VUHTXHVWVKDOOXQFRYHUH[SRVHRURWKHUZLVHPDNHDYDLODEOH IRUREVHUYDWLRQLQVSHFWLRQRUWHVWLQJDV&LW\PD\UHTXLUHWKDWSRUWLRQRIWKH:RUNLQTXHVWLRQ IXUQLVKLQJDOOQHFHVVDU\ODERUPDWHULDODQGHTXLSPHQW  ,ILWLVIRXQGWKDWWKHXQFRYHUHG:RUNLVGHIHFWLYH&RQWUDFWRUVKDOOSD\DOOFODLPVFRVWV ORVVHVDQGGDPDJHV LQFOXGLQJEXWQRWOLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWV DWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOOFRXUWRURWKHUGLVSXWHUHVROXWLRQFRVWV DULVLQJRXW RI RU UHODWLQJ WR VXFK XQFRYHULQJ H[SRVXUH REVHUYDWLRQ LQVSHFWLRQ DQG WHVWLQJ DQG RI VDWLVIDFWRU\UHSODFHPHQWRUUHFRQVWUXFWLRQ LQFOXGLQJEXWQRWOLPLWHGWRDOOFRVWVRIUHSDLURU UHSODFHPHQW RI ZRUN RI RWKHUV  RU &LW\ VKDOO EH HQWLWOHG WR DFFHSW GHIHFWLYH :RUN LQ DFFRUGDQFHZLWK3DUDJUDSKLQZKLFKFDVH&RQWUDFWRUVKDOOVWLOOEHUHVSRQVLEOHIRUDOO FRVWVDVVRFLDWHGZLWKH[SRVLQJREVHUYLQJDQGWHVWLQJWKHGHIHFWLYH:RUN  ,I WKH XQFRYHUHG :RUN LV QRW IRXQG WR EH GHIHFWLYH &RQWUDFWRUVKDOO EH DOORZHG DQ H[WHQVLRQ RI WKH &RQWUDFW 7LPH GLUHFWO\ DWWULEXWDEOH WR VXFK XQFRYHULQJ H[SRVXUH REVHUYDWLRQLQVSHFWLRQWHVWLQJUHSODFHPHQWDQGUHFRQVWUXFWLRQ  City May Stop the Work  ,IWKH:RUNLVGHIHFWLYHRU&RQWUDFWRUIDLOVWRVXSSO\VXIILFLHQWVNLOOHGZRUNHUVRUVXLWDEOHPDWHULDOV RUHTXLSPHQWRUIDLOVWRSHUIRUPWKH:RUNLQVXFKDZD\WKDWWKHFRPSOHWHG:RUNZLOOFRQIRUPWR WKH&RQWUDFW'RFXPHQWV&LW\PD\RUGHU&RQWUDFWRUWRVWRSWKH:RUNRUDQ\SRUWLRQWKHUHRIXQWLO WKHFDXVHIRUVXFKRUGHUKDVEHHQHOLPLQDWHGKRZHYHUWKLVULJKWRI&LW\WRVWRSWKH:RUNVKDOOQRW JLYHULVHWRDQ\GXW\RQWKHSDUWRI&LW\WRH[HUFLVHWKLVULJKWIRUWKHEHQHILWRI&RQWUDFWRUDQ\ 6XEFRQWUDFWRUDQ\6XSSOLHUDQ\RWKHULQGLYLGXDORUHQWLW\RUDQ\VXUHW\IRURUHPSOR\HHRUDJHQWRI DQ\RIWKHP  Correction or Removal of Defective Work  $3URPSWO\DIWHUUHFHLSWRIZULWWHQQRWLFH&RQWUDFWRUVKDOOFRUUHFWDOOGHIHFWLYH:RUNSXUVXDQWWR DQDFFHSWDEOHVFKHGXOHZKHWKHURUQRWIDEULFDWHGLQVWDOOHGRUFRPSOHWHGRULIWKH:RUNKDV EHHQUHMHFWHGE\&LW\UHPRYHLWIURPWKH3URMHFWDQGUHSODFHLWZLWK:RUNWKDWLVQRWGHIHFWLYH &RQWUDFWRUVKDOOSD\DOOFODLPVFRVWVDGGLWLRQDOWHVWLQJORVVHVDQGGDPDJHV LQFOXGLQJEXWQRW OLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOO FRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWV DULVLQJRXWRIRUUHODWLQJWRVXFKFRUUHFWLRQ RUUHPRYDO LQFOXGLQJEXWQRWOLPLWHGWRDOOFRVWVRIUHSDLURUUHSODFHPHQWRIZRUNRIRWKHUV  )DLOXUHWRUHTXLUHWKHUHPRYDORIDQ\GHIHFWLYH:RUNVKDOOQRWFRQVWLWXWHDFFHSWDQFHRIVXFK :RUN        467   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 %:KHQFRUUHFWLQJGHIHFWLYH:RUNXQGHUWKHWHUPVRIWKLV3DUDJUDSKRU3DUDJUDSK &RQWUDFWRUVKDOOWDNHQRDFWLRQWKDWZRXOGYRLGRURWKHUZLVHLPSDLU&LW\¶VVSHFLDOZDUUDQW\DQG JXDUDQWHHLIDQ\RQVDLG:RUN  Correction Period  $,IZLWKLQWZR  \HDUVDIWHUWKHGDWHRI)LQDO$FFHSWDQFH RUVXFKORQJHUSHULRGRIWLPHDVPD\ EH SUHVFULEHG E\ WKH WHUPV RI DQ\ DSSOLFDEOH VSHFLDO JXDUDQWHHUHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV DQ\:RUNLVIRXQGWREHGHIHFWLYHRULIWKHUHSDLURIDQ\GDPDJHVWRWKHODQGRU DUHDVPDGHDYDLODEOHIRU&RQWUDFWRU¶VXVHE\&LW\RUSHUPLWWHGE\/DZVDQG5HJXODWLRQVDV FRQWHPSODWHGLQ3DUDJUDSK$LVIRXQGWREHGHIHFWLYH&RQWUDFWRUVKDOOSURPSWO\ZLWKRXW FRVWWR&LW\DQGLQDFFRUGDQFHZLWK&LW\¶VZULWWHQLQVWUXFWLRQV  UHSDLUVXFKGHIHFWLYHODQGRUDUHDVRU  FRUUHFWVXFKGHIHFWLYH:RUNRU  LIWKHGHIHFWLYH:RUNKDVEHHQUHMHFWHGE\&LW\UHPRYHLWIURPWKH3URMHFWDQGUHSODFHLW ZLWK:RUNWKDWLVQRWGHIHFWLYHDQG  VDWLVIDFWRULO\FRUUHFWRUUHSDLURUUHPRYHDQGUHSODFHDQ\GDPDJHWRRWKHU:RUNWRWKHZRUN RIRWKHUVRURWKHUODQGRUDUHDVUHVXOWLQJWKHUHIURP  %,I&RQWUDFWRUGRHVQRWSURPSWO\FRPSO\ZLWKWKHWHUPVRI&LW\¶VZULWWHQLQVWUXFWLRQVRULQDQ HPHUJHQF\ZKHUHGHOD\ZRXOGFDXVHVHULRXVULVNRIORVVRUGDPDJH&LW\PD\KDYHWKHGHIHFWLYH :RUNFRUUHFWHGRUUHSDLUHGRUPD\KDYHWKHUHMHFWHG:RUNUHPRYHGDQGUHSODFHG$OOFODLPV FRVWV ORVVHV DQG GDPDJHV LQFOXGLQJ EXW QRW OLPLWHG WR DOO IHHV DQG FKDUJHV RI HQJLQHHUV DUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOOFRXUWRU RWKHU GLVSXWH UHVROXWLRQ FRVWV  DULVLQJRXWRIRUUHODWLQJWRVXFKFRUUHFWLRQRUUHSDLURUVXFKUHPRYDODQGUHSODFHPHQW LQFOXGLQJ EXWQRWOLPLWHGWRDOOFRVWVRIUHSDLURUUHSODFHPHQWRIZRUNRIRWKHUV ZLOOEHSDLGE\&RQWUDFWRU  &,QVSHFLDOFLUFXPVWDQFHVZKHUHDSDUWLFXODULWHPRIHTXLSPHQWLVSODFHGLQFRQWLQXRXVVHUYLFH EHIRUH)LQDO$FFHSWDQFHRIDOOWKH:RUNWKHFRUUHFWLRQSHULRGIRUWKDWLWHPPD\VWDUWWRUXQIURP DQHDUOLHUGDWHLIVRSURYLGHGLQWKH&RQWUDFW'RFXPHQWV  ':KHUHGHIHFWLYH:RUN DQGGDPDJHWRRWKHU:RUNUHVXOWLQJWKHUHIURP KDVEHHQFRUUHFWHGRU UHPRYHGDQGUHSODFHGXQGHUWKLV3DUDJUDSKWKHFRUUHFWLRQSHULRGKHUHXQGHUZLWKUHVSHFW WRVXFK:RUNPD\EHUHTXLUHGWREHH[WHQGHGIRUDQDGGLWLRQDOSHULRGRIRQH\HDUDIWHUWKHHQGRI WKHLQLWLDOFRUUHFWLRQSHULRG&LW\VKDOOSURYLGHGD\VZULWWHQQRWLFHWR&RQWUDFWRUVKRXOGVXFK DGGLWLRQDOZDUUDQW\FRYHUDJHEHUHTXLUHG&RQWUDFWRUPD\GLVSXWHWKLVUHTXLUHPHQWE\ILOLQJD &RQWUDFW&ODLPSXUVXDQWWR3DUDJUDSK  (&RQWUDFWRU¶VREOLJDWLRQVXQGHUWKLV3DUDJUDSKDUHLQDGGLWLRQWRDQ\RWKHUREOLJDWLRQRU ZDUUDQW\7KHSURYLVLRQVRIWKLV3DUDJUDSKVKDOOQRWEHFRQVWUXHGDVDVXEVWLWXWHIRURUD ZDLYHURIWKHSURYLVLRQVRIDQ\DSSOLFDEOHVWDWXWHRIOLPLWDWLRQRUUHSRVH        468   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Acceptance of Defective Work  ,ILQVWHDGRIUHTXLULQJFRUUHFWLRQRUUHPRYDODQGUHSODFHPHQWRIGHIHFWLYH:RUN&LW\SUHIHUVWR DFFHSWLW&LW\PD\GRVR&RQWUDFWRUVKDOOSD\DOOFODLPVFRVWVORVVHVDQGGDPDJHV LQFOXGLQJEXW QRWOLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOO FRXUW RU RWKHU GLVSXWH UHVROXWLRQ FRVWV  DWWULEXWDEOH WR &LW\¶V HYDOXDWLRQ RIDQG GHWHUPLQDWLRQ WR DFFHSWVXFKGHIHFWLYH:RUNDQGIRUWKHGLPLQLVKHGYDOXHRIWKH:RUNWRWKHH[WHQWQRWRWKHUZLVH SDLGE\&RQWUDFWRU,IDQ\VXFKDFFHSWDQFHRFFXUVSULRUWR)LQDO$FFHSWDQFHD&KDQJH2UGHUZLOOEH LVVXHGLQFRUSRUDWLQJWKHQHFHVVDU\UHYLVLRQVLQWKH&RQWUDFW'RFXPHQWVZLWKUHVSHFWWRWKH:RUN DQG&LW\VKDOOEHHQWLWOHGWRDQDSSURSULDWHGHFUHDVHLQWKH&RQWUDFW3ULFHUHIOHFWLQJWKHGLPLQLVKHG YDOXHRI:RUNVRDFFHSWHG  City May Correct Defective Work  $,I&RQWUDFWRUIDLOVZLWKLQDUHDVRQDEOHWLPHDIWHUZULWWHQQRWLFHIURP&LW\WRFRUUHFWGHIHFWLYH :RUNRUWRUHPRYHDQGUHSODFHUHMHFWHG:RUNDVUHTXLUHGE\&LW\LQDFFRUGDQFHZLWK3DUDJUDSK $RULI&RQWUDFWRUIDLOVWRSHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV RULI&RQWUDFWRUIDLOVWRFRPSO\ZLWKDQ\RWKHUSURYLVLRQRIWKH&RQWUDFW'RFXPHQWV&LW\PD\ DIWHUVHYHQ  GD\VZULWWHQQRWLFHWR&RQWUDFWRUFRUUHFWRUUHPHG\DQ\VXFKGHILFLHQF\  %,QH[HUFLVLQJWKHULJKWVDQGUHPHGLHVXQGHUWKLV3DUDJUDSK&LW\VKDOOSURFHHG H[SHGLWLRXVO\ ,Q FRQQHFWLRQ ZLWK VXFK FRUUHFWLYH RU UHPHGLDO DFWLRQ &LW\ PD\ H[FOXGH &RQWUDFWRUIURPDOORUSDUWRIWKH6LWHWDNHSRVVHVVLRQRIDOORUSDUWRIWKH:RUNDQGVXVSHQG &RQWUDFWRU¶VVHUYLFHVUHODWHGWKHUHWRDQGLQFRUSRUDWHLQWKH:RUNDOOPDWHULDOVDQGHTXLSPHQW LQFRUSRUDWHGLQWKH:RUNVWRUHGDWWKH6LWHRUIRUZKLFK&LW\KDVSDLG&RQWUDFWRUEXWZKLFKDUH VWRUHG HOVHZKHUH &RQWUDFWRU VKDOO DOORZ &LW\ &LW\¶V UHSUHVHQWDWLYHV DJHQWV FRQVXOWDQWV HPSOR\HHVDQG&LW\¶VRWKHUFRQWUDFWRUVDFFHVVWRWKH6LWHWRHQDEOH&LW\WRH[HUFLVHWKHULJKWV DQGUHPHGLHVXQGHUWKLV3DUDJUDSK  &$OO FODLPV FRVWV ORVVHV DQG GDPDJHV LQFOXGLQJ EXW QRW OLPLWHGWRDOOIHHVDQGFKDUJHVRI HQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOOFRXUWRURWKHUGLVSXWHUHVROXWLRQ FRVWV LQFXUUHGRUVXVWDLQHGE\&LW\LQH[HUFLVLQJWKHULJKWVDQGUHPHGLHVXQGHUWKLV3DUDJUDSK ZLOOEHFKDUJHGDJDLQVW&RQWUDFWRUDQGD&KDQJH2UGHUZLOOEHLVVXHGLQFRUSRUDWLQJWKH QHFHVVDU\ UHYLVLRQV LQ WKH &RQWUDFW 'RFXPHQWVZLWK UHVSHFW WR WKH :RUN DQG &LW\ VKDOO EH HQWLWOHGWRDQDSSURSULDWHGHFUHDVHLQWKH&RQWUDFW3ULFH  '&RQWUDFWRUVKDOOQRWEHDOORZHGDQH[WHQVLRQRIWKH&RQWUDFW7LPHEHFDXVHRIDQ\GHOD\LQWKH SHUIRUPDQFHRIWKH:RUNDWWULEXWDEOHWRWKHH[HUFLVHRI&LW\¶VULJKWVDQGUHPHGLHVXQGHUWKLV 3DUDJUDSK  $57,&/(±3$<0(17672&2175$&725$1'&203/(7,21  Schedule of Values  7KH6FKHGXOHRI9DOXHVIRUOXPSVXPFRQWUDFWVHVWDEOLVKHGDVSURYLGHGLQ3DUDJUDSKZLOOVHUYH DVWKHEDVLVIRUSURJUHVVSD\PHQWVDQGZLOOEHLQFRUSRUDWHGLQWRDIRUPRI$SSOLFDWLRQIRU3D\PHQW       469   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 DFFHSWDEOHWR&LW\3URJUHVVSD\PHQWVRQDFFRXQWRI8QLW3ULFH:RUNZLOOEHEDVHGRQWKHQXPEHURI XQLWVFRPSOHWHG  Progress Payments  $Applications for Payments:  &RQWUDFWRULVUHVSRQVLEOHIRUSURYLGLQJDOOLQIRUPDWLRQDVUHTXLUHGWREHFRPHDYHQGRURIWKH &LW\  $WOHDVWGD\VEHIRUHWKHGDWHHVWDEOLVKHGLQWKH*HQHUDO5HTXLUHPHQWVIRUHDFKSURJUHVV SD\PHQW&RQWUDFWRUVKDOOVXEPLWWR&LW\IRUUHYLHZDQ$SSOLFDWLRQIRU3D\PHQWILOOHGRXW DQGVLJQHGE\&RQWUDFWRUFRYHULQJWKH:RUNFRPSOHWHGDVRIWKHGDWHRIWKH$SSOLFDWLRQDQG DFFRPSDQLHGE\VXFKVXSSRUWLQJGRFXPHQWDWLRQDVLVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV  ,ISD\PHQWLVUHTXHVWHGRQWKHEDVLVRIPDWHULDOVDQGHTXLSPHQWQRWLQFRUSRUDWHGLQWKH:RUN EXWGHOLYHUHGDQGVXLWDEO\VWRUHGDWWKH6LWHRUDWDQRWKHUORFDWLRQDJUHHGWRLQZULWLQJWKH $SSOLFDWLRQ IRU 3D\PHQW VKDOO DOVR EH DFFRPSDQLHG E\ D ELOO RIVDOH LQYRLFH RU RWKHU GRFXPHQWDWLRQZDUUDQWLQJWKDW&LW\KDVUHFHLYHGWKHPDWHULDOVDQGHTXLSPHQWIUHHDQGFOHDU RI DOO /LHQV DQG HYLGHQFH WKDW WKH PDWHULDOV DQG HTXLSPHQW DUHFRYHUHG E\ DSSURSULDWH LQVXUDQFH RU RWKHU DUUDQJHPHQWV WR SURWHFW &LW\¶V LQWHUHVW WKHUHLQDOORIZKLFKPXVWEH VDWLVIDFWRU\WR&LW\  %HJLQQLQJ ZLWK WKH VHFRQG $SSOLFDWLRQ IRU 3D\PHQW HDFK $SSOLFDWLRQ VKDOO LQFOXGH DQ DIILGDYLWRI&RQWUDFWRUVWDWLQJWKDWSUHYLRXVSURJUHVVSD\PHQWVUHFHLYHGRQDFFRXQWRIWKH :RUN KDYH EHHQ DSSOLHG RQ DFFRXQW WR GLVFKDUJH &RQWUDFWRU¶V OHJLWLPDWH REOLJDWLRQV DVVRFLDWHGZLWKSULRU$SSOLFDWLRQVIRU3D\PHQW  7KH DPRXQW RI UHWDLQDJH ZLWK UHVSHFW WR SURJUHVV SD\PHQWV ZLOOEH DV VWLSXODWHG LQ WKH &RQWUDFW'RFXPHQWV  %Review of Applications:  &LW\ ZLOO DIWHU UHFHLSW RI HDFK $SSOLFDWLRQ IRU 3D\PHQW HLWKHU LQGLFDWH LQ ZULWLQJ D UHFRPPHQGDWLRQRISD\PHQWRUUHWXUQWKH$SSOLFDWLRQWR&RQWUDFWRULQGLFDWLQJUHDVRQVIRU UHIXVLQJSD\PHQW,QWKHODWWHUFDVH&RQWUDFWRUPD\PDNHWKHQHFHVVDU\FRUUHFWLRQVDQG UHVXEPLWWKH$SSOLFDWLRQ  &LW\¶VSURFHVVLQJRIDQ\SD\PHQWUHTXHVWHGLQDQ$SSOLFDWLRQIRU3D\PHQWZLOOEHEDVHGRQ &LW\¶V REVHUYDWLRQV RI WKH H[HFXWHG :RUN DQG RQ &LW\¶V UHYLHZRI WKH $SSOLFDWLRQ IRU 3D\PHQWDQGWKHDFFRPSDQ\LQJGDWDDQGVFKHGXOHVWKDWWRWKHEHVWRI&LW\¶VNQRZOHGJH  DWKH:RUNKDVSURJUHVVHGWRWKHSRLQWLQGLFDWHG  EWKHTXDOLW\RIWKH:RUNLVJHQHUDOO\LQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV VXEMHFW WRDQHYDOXDWLRQRIWKH:RUNDVDIXQFWLRQLQJZKROHSULRUWRRUXSRQ)LQDO$FFHSWDQFH       470   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 WKH UHVXOWV RI DQ\ VXEVHTXHQW WHVWV FDOOHG IRU LQ WKH &RQWUDFW'RFXPHQWV D ILQDO GHWHUPLQDWLRQRITXDQWLWLHVDQGFODVVLILFDWLRQVIRU:RUNSHUIRUPHGXQGHU3DUDJUDSK DQGDQ\RWKHUTXDOLILFDWLRQVVWDWHGLQWKHUHFRPPHQGDWLRQ   3URFHVVLQJDQ\VXFKSD\PHQWZLOOQRWWKHUHE\EHGHHPHGWRKDYHUHSUHVHQWHGWKDW  DLQVSHFWLRQVPDGHWRFKHFNWKHTXDOLW\RU WKHTXDQWLW\RI WKH:RUNDVLWKDVEHHQ SHUIRUPHGKDYHEHHQH[KDXVWLYHH[WHQGHGWRHYHU\DVSHFWRIWKH:RUNLQSURJUHVVRU LQYROYHG GHWDLOHG LQVSHFWLRQV RI WKH :RUN EH\RQG WKH UHVSRQVLELOLWLHV VSHFLILFDOO\ DVVLJQHGWR&LW\LQWKH&RQWUDFW'RFXPHQWVRU  EWKHUHPD\QRWEHRWKHUPDWWHUVRULVVXHVEHWZHHQWKHSDUWLHVWKDWPLJKWHQWLWOH&RQWUDFWRU WREHSDLGDGGLWLRQDOO\E\&LW\RUHQWLWOH&LW\WRZLWKKROGSD\PHQWWR&RQWUDFWRURU  F&RQWUDFWRU KDV FRPSOLHG ZLWK /DZV DQG 5HJXODWLRQV DSSOLFDEOH WR &RQWUDFWRU¶V SHUIRUPDQFHRIWKH:RUN  &LW\PD\UHIXVHWRSURFHVVWKHZKROHRUDQ\SDUWRIDQ\SD\PHQWEHFDXVHRIVXEVHTXHQWO\ GLVFRYHUHGHYLGHQFHRUWKHUHVXOWVRIVXEVHTXHQWLQVSHFWLRQVRUWHVWVDQGUHYLVHRUUHYRNH DQ\VXFKSD\PHQWSUHYLRXVO\PDGHWRVXFKH[WHQWDVPD\EHQHFHVVDU\WRSURWHFW&LW\IURP ORVVEHFDXVH  DWKH:RUNLVGHIHFWLYHRUWKHFRPSOHWHG:RUNKDVEHHQGDPDJHGE\WKH&RQWUDFWRURUKLV VXEFRQWUDFWRUVUHTXLULQJFRUUHFWLRQRUUHSODFHPHQW  EGLVFUHSDQFLHVLQTXDQWLWLHVFRQWDLQHGLQSUHYLRXVDSSOLFDWLRQVIRUSD\PHQW  FWKH&RQWUDFW3ULFHKDVEHHQUHGXFHGE\&KDQJH2UGHUV  G&LW\KDVEHHQUHTXLUHGWRFRUUHFWGHIHFWLYH:RUNRUFRPSOHWH:RUNLQDFFRUGDQFHZLWK 3DUDJUDSKRU  H&LW\KDVDFWXDONQRZOHGJHRIWKHRFFXUUHQFHRIDQ\RIWKHHYHQWVHQXPHUDWHGLQ 3DUDJUDSK$ &Retainage:   )RUDOOFRQWUDFWVUHWDLQDJHVKDOOEHILYHSHUFHQW    'Liquidated Damages)RUHDFKFDOHQGDUGD\WKDWDQ\ZRUNVKDOOUHPDLQXQFRPSOHWHGDIWHUWKH WLPHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWVWKHVXPSHUGD\VSHFLILHGLQWKH$JUHHPHQWZLOOEH GHGXFWHG IURP WKH PRQLHV GXH WKH &RQWUDFWRU QRW DV D SHQDOW\EXW DV OLTXLGDWHG GDPDJHV VXIIHUHGE\WKH&LW\  (Payment: &RQWUDFWRUZLOOEHSDLGSXUVXDQWWRWKHUHTXLUHPHQWVRIWKLV$UWLFOHDQGSD\PHQW ZLOOEHFRPHGXHLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV       471   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018  )Reduction in Payment:  &LW\PD\UHIXVHWRPDNHSD\PHQWRIWKHDPRXQWUHTXHVWHGEHFDXVH D&ODLPV KDYH EHHQ PDGH DJDLQVW &LW\ RQ DFFRXQW RI &RQWUDFWRU¶V SHUIRUPDQFH RU IXUQLVKLQJRIWKH:RUN E/LHQVKDYHEHHQILOHGLQFRQQHFWLRQZLWKWKH:RUNH[FHSWZKHUH&RQWUDFWRU KDV GHOLYHUHG D VSHFLILF ERQG VDWLVIDFWRU\ WR &LW\ WR VHFXUH WKH VDWLVIDFWLRQ DQG GLVFKDUJHRIVXFK/LHQV FWKHUHDUHRWKHULWHPVHQWLWOLQJ&LW\WRDVHWRIIDJDLQVWWKHDPRXQWUHFRPPHQGHGRU G&LW\KDVDFWXDONQRZOHGJHRIWKHRFFXUUHQFHRIDQ\RIWKHHYHQWVHQXPHUDWHG LQ3DUDJUDSKV%DWKURXJK%HRU3DUDJUDSK$ ,I &LW\ UHIXVHV WR PDNH SD\PHQW RI WKH DPRXQW UHTXHVWHG &LW\ ZLOO JLYH &RQWUDFWRU ZULWWHQQRWLFHVWDWLQJWKHUHDVRQVIRUVXFKDFWLRQDQGSD\&RQWUDFWRUDQ\DPRXQWUHPDLQLQJ DIWHU GHGXFWLRQ RI WKH DPRXQW VR ZLWKKHOG &LW\ VKDOO SD\ &RQWUDFWRU WKH DPRXQW VR ZLWKKHOGRUDQ\DGMXVWPHQWWKHUHWRDJUHHGWRE\&LW\DQG&RQWUDFWRUZKHQ&RQWUDFWRU UHPHGLHVWKHUHDVRQVIRUVXFKDFWLRQ         472   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Contractor’s Warranty of Title  &RQWUDFWRUZDUUDQWVDQGJXDUDQWHHVWKDWWLWOHWRDOO:RUNPDWHULDOVDQGHTXLSPHQWFRYHUHGE\DQ\ $SSOLFDWLRQIRU3D\PHQWZKHWKHULQFRUSRUDWHGLQWKH3URMHFWRUQRWZLOOSDVVWR&LW\QRODWHUWKDQ WKHWLPHRISD\PHQWIUHHDQGFOHDURIDOO/LHQV  Partial Utilization  $3ULRUWR)LQDO$FFHSWDQFHRIDOOWKH:RUN&LW\PD\XVHRURFFXS\DQ\VXEVWDQWLDOO\FRPSOHWHG SDUWRIWKH:RUNZKLFKKDVVSHFLILFDOO\EHHQLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWVRUZKLFK &LW\GHWHUPLQHVFRQVWLWXWHVDVHSDUDWHO\IXQFWLRQLQJDQGXVDEOHSDUWRIWKH:RUNWKDWFDQEH XVHG E\ &LW\ IRU LWV LQWHQGHG SXUSRVH ZLWKRXW VLJQLILFDQW LQWHUIHUHQFH ZLWK &RQWUDFWRU¶V SHUIRUPDQFHRIWKHUHPDLQGHURIWKH:RUN&LW\DWDQ\WLPHPD\QRWLI\&RQWUDFWRULQZULWLQJWR SHUPLW&LW\WRXVHRURFFXS\DQ\VXFKSDUWRIWKH:RUNZKLFK&LW\GHWHUPLQHVWREHUHDG\IRULWV LQWHQGHGXVHVXEMHFWWRWKHIROORZLQJFRQGLWLRQV  &RQWUDFWRUDWDQ\WLPHPD\QRWLI\&LW\LQZULWLQJWKDW&RQWUDFWRUFRQVLGHUVDQ\VXFKSDUWRI WKH:RUNUHDG\IRULWVLQWHQGHGXVH  :LWKLQDUHDVRQDEOHWLPHDIWHUQRWLILFDWLRQDVHQXPHUDWHGLQ3DUDJUDSK$&LW\DQG &RQWUDFWRU VKDOO PDNH DQ LQVSHFWLRQ RI WKDW SDUW RI WKH :RUN WR GHWHUPLQH LWV VWDWXV RI FRPSOHWLRQ,I&LW\GRHVQRWFRQVLGHUWKDWSDUWRIWKH:RUNWREHVXEVWDQWLDOO\FRPSOHWH&LW\ ZLOOQRWLI\&RQWUDFWRULQZULWLQJJLYLQJWKHUHDVRQVWKHUHIRU  3DUWLDO8WLOL]DWLRQZLOOQRWFRQVWLWXWH)LQDO$FFHSWDQFHE\&LW\  Final Inspection  $8SRQZULWWHQQRWLFHIURP&RQWUDFWRUWKDWWKHHQWLUH:RUNLVFRPSOHWHLQDFFRUGDQFHZLWKWKH &RQWUDFW'RFXPHQWV  &LW\ZLOOSURPSWO\VFKHGXOHD)LQDO,QVSHFWLRQZLWK&RQWUDFWRU  &LW\ZLOOQRWLI\&RQWUDFWRULQZULWLQJRIDOOSDUWLFXODUVLQZKLFKWKLVLQVSHFWLRQUHYHDOVWKDW WKH:RUNLVLQFRPSOHWHRUGHIHFWLYH&RQWUDFWRUVKDOOLPPHGLDWHO\WDNHVXFKPHDVXUHVDVDUH QHFHVVDU\WRFRPSOHWHVXFK:RUNRUUHPHG\VXFKGHILFLHQFLHV  %&LW\UHVHUYHVWKHULJKWWRGHQ\UHTXHVWIRU)LQDO,QVSHFWLRQLI&LW\GHWHUPLQHVWKDWWKHHQWLUH:RUN LVQRWVXIILFLHQWO\FRPSOHWHWRZDUUDQWD)LQDO,QVSHFWLRQ  Final Acceptance  8SRQFRPSOHWLRQE\&RQWUDFWRUWR&LW\¶VVDWLVIDFWLRQRIDQ\DGGLWLRQDO:RUNLGHQWLILHGLQWKH)LQDO ,QVSHFWLRQ&LW\ZLOOLVVXHWR&RQWUDFWRUDOHWWHURI)LQDO$FFHSWDQFH         473   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Final Payment  $Application for Payment:  8SRQ)LQDO$FFHSWDQFHDQGLQWKHRSLQLRQRI&LW\&RQWUDFWRUPD\PDNHDQDSSOLFDWLRQIRU ILQDOSD\PHQWIROORZLQJWKHSURFHGXUHIRUSURJUHVVSD\PHQWVLQDFFRUGDQFHZLWKWKH &RQWUDFW'RFXPHQWV  7KHILQDO$SSOLFDWLRQIRU3D\PHQWVKDOOEHDFFRPSDQLHG H[FHSWDVSUHYLRXVO\GHOLYHUHG E\  DDOOGRFXPHQWDWLRQFDOOHGIRULQWKH&RQWUDFW'RFXPHQWVLQFOXGLQJEXWQRWOLPLWHGWR WKHHYLGHQFHRILQVXUDQFHUHTXLUHGE\3DUDJUDSK EFRQVHQWRIWKHVXUHW\LIDQ\WRILQDOSD\PHQW FDOLVWRIDOOSHQGLQJRUUHOHDVHG'DPDJH&ODLPVDJDLQVW&LW\WKDW&RQWUDFWRUEHOLHYHV DUHXQVHWWOHGDQG GDIILGDYLWV RI SD\PHQWV DQG FRPSOHWH DQG OHJDOO\ HIIHFWLYH UHOHDVHV RU ZDLYHUV VDWLVIDFWRU\ WR &LW\  RI DOO /LHQ ULJKWV DULVLQJ RXW RIRU/LHQVILOHGLQ FRQQHFWLRQZLWKWKH:RUN %3D\PHQW%HFRPHV'XH $IWHU &LW\¶V DFFHSWDQFH RI WKH $SSOLFDWLRQ IRU 3D\PHQW DQG DFFRPSDQ\LQJ GRFXPHQWDWLRQUHTXHVWHGE\&RQWUDFWRUOHVVSUHYLRXVSD\PHQWVPDGHDQGDQ\VXP &LW\LVHQWLWOHGLQFOXGLQJEXWQRWOLPLWHGWROLTXLGDWHGGDPDJHVZLOOEHFRPHGXHDQG SD\DEOH $IWHUDOO'DPDJH&ODLPVKDYHEHHQUHVROYHG DGLUHFWO\E\WKH&RQWUDFWRURU E&RQWUDFWRU SURYLGHV HYLGHQFH WKDW WKH 'DPDJH &ODLP KDV EHHQ UHSRUWHG WR &RQWUDFWRU¶VLQVXUDQFHSURYLGHUIRUUHVROXWLRQ 7KHPDNLQJRIWKHILQDOSD\PHQWE\WKH&LW\VKDOOQRWUHOLHYHWKH&RQWUDFWRURI DQ\ JXDUDQWHHV RU RWKHU UHTXLUHPHQWV RI WKH &RQWUDFW 'RFXPHQWVZKLFK VSHFLILFDOO\ FRQWLQXHWKHUHDIWHU  Final Completion Delayed and Partial Retainage Release  $,IILQDOFRPSOHWLRQRIWKH:RUNLVVLJQLILFDQWO\GHOD\HGDQGLI&LW\VRFRQILUPV&LW\PD\XSRQ UHFHLSW RI &RQWUDFWRU¶V ILQDO $SSOLFDWLRQ IRU 3D\PHQW DQG ZLWKRXW WHUPLQDWLQJ WKH &RQWUDFW PDNHSD\PHQWRIWKHEDODQFHGXHIRUWKDWSRUWLRQRIWKH:RUNIXOO\FRPSOHWHGDQGDFFHSWHG,I WKHUHPDLQLQJEDODQFHWREHKHOGE\&LW\IRU:RUNQRWIXOO\FRPSOHWHGRUFRUUHFWHGLVOHVVWKDQ WKHUHWDLQDJHVWLSXODWHGLQ3DUDJUDSK&DQGLIERQGVKDYHEHHQIXUQLVKHGDVUHTXLUHGLQ 3DUDJUDSKWKHZULWWHQFRQVHQWRIWKHVXUHW\WRWKHSD\PHQWRIWKHEDODQFHGXHIRUWKDW SRUWLRQRIWKH:RUNIXOO\FRPSOHWHGDQGDFFHSWHGVKDOOEHVXEPLWWHGE\&RQWUDFWRUWR&LW\ZLWK WKH$SSOLFDWLRQIRUVXFKSD\PHQW6XFKSD\PHQWVKDOOEHPDGHXQGHUWKHWHUPVDQGFRQGLWLRQV       474   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 JRYHUQLQJILQDOSD\PHQWH[FHSWWKDWLWVKDOOQRWFRQVWLWXWHDZDLYHURI&RQWUDFW&ODLPV  %Partial Retainage Release)RUD&RQWUDFWWKDWSURYLGHVIRUDVHSDUDWHYHJHWDWLYHHVWDEOLVKPHQW DQG PDLQWHQDQFH DQG WHVW DQG SHUIRUPDQFH SHULRGV IROORZLQJ WKH FRPSOHWLRQ RI DOO RWKHU FRQVWUXFWLRQLQWKH&RQWUDFW'RFXPHQWVIRUDOO:RUNORFDWLRQVWKH&LW\PD\UHOHDVHDSRUWLRQRI WKHDPRXQWUHWDLQHGSURYLGHGWKDWDOORWKHUZRUNLVFRPSOHWHGDVGHWHUPLQHGE\WKH&LW\%HIRUH WKHUHOHDVHDOOVXEPLWWDOVDQGILQDOTXDQWLWLHVPXVWEHFRPSOHWHGDQGDFFHSWHGIRUDOORWKHUZRUN $QDPRXQWVXIILFLHQWWRHQVXUH&RQWUDFWFRPSOLDQFHZLOOEHUHWDLQHG  Waiver of Claims  7KHDFFHSWDQFHRIILQDOSD\PHQWZLOOFRQVWLWXWHDUHOHDVHRIWKH&LW\IURPDOOFODLPVRUOLDELOLWLHV XQGHUWKH&RQWUDFWIRUDQ\WKLQJGRQHRUIXUQLVKHGRUUHODWLQJWRWKHZRUNXQGHUWKH&RQWUDFW 'RFXPHQWVRUDQ\DFWRUQHJOHFWRI&LW\UHODWHGWRRUFRQQHFWHGZLWKWKH&RQWUDFW  $57,&/(±6863(16,212):25.$1'7(50,1$7,21  City May Suspend Work  $$WDQ\WLPHDQGZLWKRXWFDXVH&LW\PD\VXVSHQGWKH:RUNRUDQ\SRUWLRQWKHUHRIE\ZULWWHQ QRWLFHWR&RQWUDFWRUDQGZKLFKPD\IL[WKHGDWHRQZKLFK:RUNZLOOEHUHVXPHG&RQWUDFWRU VKDOOUHVXPHWKH:RUNRQWKHGDWHVRIL[HG'XULQJWHPSRUDU\VXVSHQVLRQRIWKH:RUNFRYHUHG E\WKHVH&RQWUDFW'RFXPHQWVIRUDQ\UHDVRQWKH&LW\ZLOOPDNHQRH[WUDSD\PHQWIRUVWDQGE\ WLPHRIFRQVWUXFWLRQHTXLSPHQWDQGRUFRQVWUXFWLRQFUHZV  %6KRXOGWKH&RQWUDFWRUQRWEHDEOHWRFRPSOHWHDSRUWLRQRIWKH3URMHFWGXHWRFDXVHVEH\RQGWKH FRQWURORIDQGZLWKRXWWKHIDXOWRUQHJOLJHQFHRIWKH&RQWUDFWRUDQGVKRXOGLWEHGHWHUPLQHGE\ PXWXDOFRQVHQWRIWKH&RQWUDFWRUDQG&LW\WKDWDVROXWLRQWRDOORZFRQVWUXFWLRQWRSURFHHGLVQRW DYDLODEOHZLWKLQDUHDVRQDEOHSHULRGRIWLPH&RQWUDFWRUPD\UHTXHVWDQH[WHQVLRQLQ&RQWUDFW 7LPHGLUHFWO\DWWULEXWDEOHWRDQ\VXFKVXVSHQVLRQ  &,ILWVKRXOGEHFRPHQHFHVVDU\WRVXVSHQGWKH:RUNIRUDQLQGHILQLWHSHULRGWKH&RQWUDFWRUVKDOO VWRUHDOOPDWHULDOVLQVXFKDPDQQHUWKDWWKH\ZLOOQRWREVWUXFWRULPSHGHWKHSXEOLFXQQHFHVVDULO\ QRUEHFRPHGDPDJHGLQDQ\ZD\DQGKHVKDOOWDNHHYHU\SUHFDXWLRQWRSUHYHQWGDPDJHRU GHWHULRUDWLRQRIWKHZRUNSHUIRUPHGKHVKDOOSURYLGHVXLWDEOHGUDLQDJHDERXWWKHZRUNDQGHUHFW WHPSRUDU\VWUXFWXUHVZKHUHQHFHVVDU\  '&RQWUDFWRUPD\EHUHLPEXUVHGIRUWKHFRVWRIPRYLQJKLVHTXLSPHQWRIIWKHMREDQGUHWXUQLQJWKH QHFHVVDU\HTXLSPHQWWRWKHMREZKHQLWLVGHWHUPLQHGE\WKH&LW\WKDWFRQVWUXFWLRQPD\EH UHVXPHG6XFKUHLPEXUVHPHQWVKDOOEHEDVHGRQDFWXDOFRVWWRWKH&RQWUDFWRURIPRYLQJWKH HTXLSPHQWDQGQRSURILWZLOOEHDOORZHG5HLPEXUVHPHQWPD\QRWEHDOORZHGLIWKHHTXLSPHQWLV PRYHGWRDQRWKHUFRQVWUXFWLRQSURMHFWIRUWKH&LW\  City May Terminate for Cause  $7KHRFFXUUHQFHRIDQ\RQHRUPRUHRIWKHIROORZLQJHYHQWVE\ZD\RIH[DPSOHEXWQRWRI       475   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 OLPLWDWLRQPD\MXVWLI\WHUPLQDWLRQIRUFDXVH  &RQWUDFWRU¶V SHUVLVWHQW IDLOXUH WR SHUIRUP WKH :RUN LQ DFFRUGDQFHZLWKWKH&RQWUDFW 'RFXPHQWV LQFOXGLQJ EXW QRW OLPLWHG WR IDLOXUH WR VXSSO\ VXIILFLHQW VNLOOHG ZRUNHUV RU VXLWDEOHPDWHULDOVRUHTXLSPHQWIDLOXUHWRDGKHUHWRWKH3URMHFW6FKHGXOHHVWDEOLVKHGXQGHU 3DUDJUDSKDVDGMXVWHGIURPWLPHWRWLPHSXUVXDQWWR3DUDJUDSK  &RQWUDFWRU¶VGLVUHJDUGRI/DZVRU5HJXODWLRQVRIDQ\SXEOLFERG\KDYLQJMXULVGLFWLRQ  &RQWUDFWRU¶VUHSHDWHGGLVUHJDUGRIWKHDXWKRULW\RI&LW\RU  &RQWUDFWRU¶VYLRODWLRQLQDQ\VXEVWDQWLDOZD\RIDQ\SURYLVLRQVRIWKH&RQWUDFW'RFXPHQWV RU  &RQWUDFWRU¶V IDLOXUH WR SURPSWO\ PDNH JRRG DQ\ GHIHFW LQ PDWHULDOV RU ZRUNPDQVKLS RU GHIHFWVRIDQ\QDWXUHWKHFRUUHFWLRQRIZKLFKKDVEHHQGLUHFWHGLQZULWLQJE\WKH&LW\RU  6XEVWDQWLDOLQGLFDWLRQWKDWWKH&RQWUDFWRUKDVPDGHDQXQDXWKRUL]HGDVVLJQPHQWRIWKH &RQWUDFWRUDQ\IXQGVGXHWKHUHIURPIRUWKHEHQHILWRIDQ\FUHGLWRURUIRUDQ\RWKHUSXUSRVH RU  6XEVWDQWLDO HYLGHQFH WKDW WKH &RQWUDFWRU KDV EHFRPH LQVROYHQW RU EDQNUXSW RU RWKHUZLVH ILQDQFLDOO\XQDEOHWRFDUU\RQWKH:RUNVDWLVIDFWRULO\RU  &RQWUDFWRUFRPPHQFHVOHJDODFWLRQLQDFRXUWRIFRPSHWHQWMXULVGLFWLRQDJDLQVWWKH&LW\  %,IRQHRUPRUHRIWKHHYHQWVLGHQWLILHGLQ3DUDJUDSK$RFFXU&LW\ZLOOSURYLGHZULWWHQ QRWLFHWR&RQWUDFWRUDQG6XUHW\WRDUUDQJHDFRQIHUHQFHZLWK&RQWUDFWRUDQG6XUHW\WRDGGUHVV &RQWUDFWRU VIDLOXUHWRSHUIRUPWKH:RUN&RQIHUHQFHVKDOOEHKHOGQRWODWHUWKDQGD\VDIWHU UHFHLSWRIQRWLFH  ,IWKH&LW\WKH&RQWUDFWRUDQGWKH6XUHW\GRQRWDJUHHWRDOORZWKH&RQWUDFWRUWRSURFHHGWR SHUIRUP WKH FRQVWUXFWLRQ &RQWUDFW WKH &LW\ PD\ WR WKH H[WHQWSHUPLWWHG E\ /DZV DQG 5HJXODWLRQVGHFODUHD&RQWUDFWRUGHIDXOWDQGIRUPDOO\WHUPLQDWHWKH&RQWUDFWRU VULJKWWR FRPSOHWHWKH&RQWUDFW&RQWUDFWRUGHIDXOWVKDOOQRWEHGHFODUHGHDUOLHUWKDQGD\VDIWHUWKH &RQWUDFWRUDQG6XUHW\KDYHUHFHLYHGQRWLFHRIFRQIHUHQFHWRDGGUHVV&RQWUDFWRU VIDLOXUHWR SHUIRUPWKH:RUN  ,I&RQWUDFWRU VVHUYLFHVDUHWHUPLQDWHG6XUHW\VKDOOEHREOLJDWHGWRWDNHRYHUDQGSHUIRUPWKH :RUN,I6XUHW\GRHVQRWFRPPHQFHSHUIRUPDQFHWKHUHRIZLWKLQFRQVHFXWLYHFDOHQGDU GD\VDIWHUGDWHRIDQDGGLWLRQDOZULWWHQQRWLFHGHPDQGLQJ6XUHW\ VSHUIRUPDQFHRILWV REOLJDWLRQVWKHQ&LW\ZLWKRXWSURFHVVRUDFWLRQDWODZPD\WDNHRYHUDQ\SRUWLRQRIWKH :RUNDQGFRPSOHWHLWDVGHVFULEHGEHORZ  D,I&LW\FRPSOHWHVWKH:RUN&LW\PD\H[FOXGH&RQWUDFWRUDQG6XUHW\IURPWKHVLWHDQG WDNH SRVVHVVLRQ RI WKH:RUN DQG DOO PDWHULDOV DQGHTXLSPHQWLQFRUSRUDWHGLQWRWKH       476   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 :RUNVWRUHGDWWKH6LWHRUIRUZKLFK&LW\KDVSDLG&RQWUDFWRURU6XUHW\EXWZKLFKDUH VWRUHGHOVHZKHUHDQGILQLVKWKH:RUNDV&LW\PD\GHHPH[SHGLHQW  :KHWKHU&LW\RU6XUHW\FRPSOHWHVWKH:RUN&RQWUDFWRUVKDOOQRWEHHQWLWOHGWRUHFHLYHDQ\ IXUWKHU SD\PHQW XQWLO WKH :RUN LV ILQLVKHG ,I WKH XQSDLG EDODQFH RI WKH &RQWUDFW 3ULFH H[FHHGVDOOFODLPVFRVWVORVVHVDQGGDPDJHVVXVWDLQHGE\&LW\DULVLQJRXWRIRUUHVXOWLQJ IURPFRPSOHWLQJWKH:RUNVXFKH[FHVVZLOOEHSDLGWR&RQWUDFWRU,IVXFKFODLPVFRVWV ORVVHVDQGGDPDJHVH[FHHGVXFKXQSDLGEDODQFH&RQWUDFWRUVKDOOSD\WKHGLIIHUHQFHWR&LW\ 6XFKFODLPVFRVWVORVVHVDQGGDPDJHVLQFXUUHGE\&LW\ZLOOEHLQFRUSRUDWHGLQD&KDQJH 2UGHUSURYLGHGWKDWZKHQH[HUFLVLQJDQ\ULJKWVRUUHPHGLHVXQGHUWKLV3DUDJUDSK&LW\VKDOO QRWEHUHTXLUHGWRREWDLQWKHORZHVWSULFHIRUWKH:RUNSHUIRUPHG  1HLWKHU&LW\QRUDQ\RILWVUHVSHFWLYHFRQVXOWDQWVDJHQWVRIILFHUVGLUHFWRUVRUHPSOR\HHV VKDOOEHLQDQ\ZD\OLDEOHRUDFFRXQWDEOHWR&RQWUDFWRURU6XUHW\IRUWKHPHWKRGE\ZKLFKWKH FRPSOHWLRQRIWKHVDLG:RUNRUDQ\SRUWLRQWKHUHRIPD\EHDFFRPSOLVKHGRUIRUWKHSULFH SDLGWKHUHIRU  &LW\QRWZLWKVWDQGLQJWKHPHWKRGXVHGLQFRPSOHWLQJWKH&RQWUDFWVKDOOQRWIRUIHLWWKHULJKW WRUHFRYHUGDPDJHVIURP&RQWUDFWRURU6XUHW\IRU&RQWUDFWRU VIDLOXUHWRWLPHO\FRPSOHWHWKH HQWLUH&RQWUDFW&RQWUDFWRUVKDOOQRWEHHQWLWOHGWRDQ\FODLPRQDFFRXQWRIWKHPHWKRGXVHG E\&LW\LQFRPSOHWLQJWKH&RQWUDFW  0DLQWHQDQFHRIWKH:RUNVKDOOFRQWLQXHWREH&RQWUDFWRU VDQG6XUHW\ VUHVSRQVLELOLWLHVDV SURYLGHGIRULQWKHERQGUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVRUDQ\VSHFLDOJXDUDQWHHV SURYLGHGIRUXQGHUWKH&RQWUDFW'RFXPHQWVRUDQ\RWKHUREOLJDWLRQVRWKHUZLVHSUHVFULEHGE\ ODZ  &1RWZLWKVWDQGLQJ3DUDJUDSKV%&RQWUDFWRU¶VVHUYLFHVZLOOQRWEHWHUPLQDWHGLI&RQWUDFWRU EHJLQV ZLWKLQ VHYHQ GD\V RI UHFHLSW RI QRWLFH RI LQWHQW WR WHUPLQDWH WR FRUUHFW LWV IDLOXUH WR SHUIRUPDQGSURFHHGVGLOLJHQWO\WRFXUHVXFKIDLOXUHZLWKLQQRPRUHWKDQGD\VRIUHFHLSWRI VDLGQRWLFH  ':KHUH&RQWUDFWRU¶VVHUYLFHVKDYHEHHQVRWHUPLQDWHGE\&LW\WKHWHUPLQDWLRQZLOOQRWDIIHFWDQ\ ULJKWVRUUHPHGLHVRI&LW\DJDLQVW&RQWUDFWRUWKHQH[LVWLQJRUZKLFKPD\WKHUHDIWHUDFFUXH$Q\ UHWHQWLRQRUSD\PHQWRIPRQH\VGXH&RQWUDFWRUE\&LW\ZLOOQRWUHOHDVH&RQWUDFWRUIURPOLDELOLW\  (,IDQGWRWKHH[WHQWWKDW&RQWUDFWRUKDVSURYLGHGDSHUIRUPDQFHERQGXQGHUWKHSURYLVLRQVRI 3DUDJUDSKWKHWHUPLQDWLRQSURFHGXUHVRIWKDWERQGVKDOOQRWVXSHUVHGHWKHSURYLVLRQVRIWKLV $UWLFOH  City May Terminate For Convenience  $&LW\PD\ZLWKRXWFDXVHDQGZLWKRXWSUHMXGLFHWRDQ\RWKHUULJKWRUUHPHG\RI&LW\WHUPLQDWHWKH &RQWUDFW $Q\ WHUPLQDWLRQ VKDOO EH HIIHFWHG E\ PDLOLQJ D QRWLFH RI WKH WHUPLQDWLRQ WR WKH       477   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 &RQWUDFWRUVSHFLI\LQJWKHH[WHQWWRZKLFKSHUIRUPDQFHRI:RUNXQGHUWKHFRQWUDFWLVWHUPLQDWHG DQGWKHGDWHXSRQZKLFKVXFKWHUPLQDWLRQEHFRPHVHIIHFWLYH5HFHLSWRIWKHQRWLFHVKDOOEH GHHPHGFRQFOXVLYHO\SUHVXPHGDQGHVWDEOLVKHGZKHQWKHOHWWHULVSODFHGLQWKH8QLWHG6WDWHV 3RVWDO 6HUYLFH 0DLO E\ WKH &LW\ )XUWKHU LW VKDOO EH GHHPHG FRQFOXVLYHO\ SUHVXPHG DQG HVWDEOLVKHGWKDWVXFKWHUPLQDWLRQLVPDGHZLWKMXVWFDXVHDVWKHUHLQVWDWHGDQGQRSURRILQDQ\ FODLPGHPDQGRUVXLWVKDOOEHUHTXLUHGRIWKH&LW\UHJDUGLQJVXFKGLVFUHWLRQDU\DFWLRQ  %$IWHU UHFHLSW RI D QRWLFH RI WHUPLQDWLRQ DQG H[FHSW DV RWKHUZLVH GLUHFWHG E\ WKH &LW\ WKH &RQWUDFWRUVKDOO  6WRS ZRUN XQGHU WKH &RQWUDFW RQ WKH GDWH DQG WR WKH H[WHQW VSHFLILHG LQ WKH QRWLFH RI WHUPLQDWLRQ  SODFHQRIXUWKHURUGHUVRUVXEFRQWUDFWVIRUPDWHULDOVVHUYLFHVRUIDFLOLWLHVH[FHSWDVPD\EH QHFHVVDU\IRUFRPSOHWLRQRIVXFKSRUWLRQRIWKH:RUNXQGHUWKH&RQWUDFWDVLVQRWWHUPLQDWHG  WHUPLQDWHDOORUGHUVDQGVXEFRQWUDFWVWRWKHH[WHQWWKDWWKH\UHODWHWRWKHSHUIRUPDQFHRIWKH :RUNWHUPLQDWHGE\QRWLFHRIWHUPLQDWLRQ  WUDQVIHUWLWOHWRWKH&LW\DQGGHOLYHULQWKHPDQQHUDWWKHWLPHVDQGWRWKHH[WHQWLIDQ\ GLUHFWHGE\WKH&LW\  DWKH IDEULFDWHG RU XQIDEULFDWHG SDUWV :RUN LQ SURJUHVV FRPSOHWHG :RUN VXSSOLHV DQGRWKHUPDWHULDOSURGXFHGDVDSDUWRIRUDFTXLUHGLQFRQQHFWLRQZLWKWKHSHUIRUPDQFH RIWKH:RUNWHUPLQDWHGE\WKHQRWLFHRIWKHWHUPLQDWLRQDQG  EWKHFRPSOHWHGRUSDUWLDOO\FRPSOHWHGSODQVGUDZLQJVLQIRUPDWLRQDQGRWKHUSURSHUW\ ZKLFKLIWKH&RQWUDFWKDGEHHQFRPSOHWHGZRXOGKDYHEHHQUHTXLUHGWREHIXUQLVKHGWR WKH&LW\  FRPSOHWHSHUIRUPDQFHRIVXFK:RUNDVVKDOOQRWKDYHEHHQWHUPLQDWHGE\WKHQRWLFHRI WHUPLQDWLRQDQG  WDNHVXFKDFWLRQDVPD\EHQHFHVVDU\RUDVWKH&LW\PD\GLUHFWIRUWKHSURWHFWLRQDQG SUHVHUYDWLRQRIWKHSURSHUW\UHODWHGWRLWVFRQWUDFWZKLFKLVLQWKHSRVVHVVLRQRIWKH &RQWUDFWRUDQGLQZKLFKWKHRZQHUKDVRUPD\DFTXLUHWKHUHVW  &$WDWLPHQRWODWHUWKDQGD\VDIWHUWKHWHUPLQDWLRQGDWHVSHFLILHGLQWKHQRWLFHRIWHUPLQDWLRQ WKH&RQWUDFWRUPD\VXEPLWWRWKH&LW\DOLVWFHUWLILHGDVWRTXDQWLW\DQGTXDOLW\RIDQ\RUDOO LWHPVRIWHUPLQDWLRQLQYHQWRU\QRWSUHYLRXVO\GLVSRVHGRIH[FOXVLYHRILWHPVWKHGLVSRVLWLRQRI ZKLFKKDVEHHQGLUHFWHGRUDXWKRUL]HGE\&LW\  '1RWODWHUWKDQGD\VWKHUHDIWHUWKH&LW\VKDOODFFHSWWLWOHWRVXFKLWHPVSURYLGHGWKDWWKHOLVW       478   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 VXEPLWWHGVKDOOEHVXEMHFWWRYHULILFDWLRQE\WKH&LW\XSRQUHPRYDORIWKHLWHPVRULIWKHLWHPV DUHVWRUHGZLWKLQGD\VIURPWKHGDWHRIVXEPLVVLRQRIWKHOLVWDQGDQ\QHFHVVDU\DGMXVWPHQWV WRFRUUHFWWKHOLVWDVVXEPLWWHGVKDOOEHPDGHSULRUWRILQDOVHWWOHPHQW  (1RWODWHUWKDQGD\VDIWHUWKHQRWLFHRIWHUPLQDWLRQWKH&RQWUDFWRUVKDOOVXEPLWKLVWHUPLQDWLRQ FODLP WR WKH &LW\ LQ WKH IRUP DQG ZLWK WKH FHUWLILFDWLRQ SUHVFULEHG E\ WKH &LW\ 8QOHVV DQ H[WHQVLRQLVPDGHLQZULWLQJZLWKLQVXFKGD\SHULRGE\WKH&RQWUDFWRUDQGJUDQWHGE\WKH &LW\DQ\DQGDOOVXFKFODLPVVKDOOEHFRQFOXVLYHO\GHHPHGZDLYHG  ),QVXFKFDVH&RQWUDFWRUVKDOOEHSDLGIRU ZLWKRXWGXSOLFDWLRQRIDQ\LWHPV   FRPSOHWHGDQGDFFHSWDEOH:RUNH[HFXWHGLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVSULRU WRWKHHIIHFWLYHGDWHRIWHUPLQDWLRQLQFOXGLQJIDLUDQGUHDVRQDEOHVXPVIRURYHUKHDGDQG SURILWRQVXFK:RUN  H[SHQVHV VXVWDLQHG SULRU WR WKH HIIHFWLYH GDWH RI WHUPLQDWLRQ LQ SHUIRUPLQJ VHUYLFHV DQG IXUQLVKLQJ ODERU PDWHULDOV RU HTXLSPHQW DV UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV LQ FRQQHFWLRQZLWKXQFRPSOHWHG:RUNSOXVIDLUDQGUHDVRQDEOHVXPVIRURYHUKHDGDQGSURILWRQ VXFKH[SHQVHVDQG  UHDVRQDEOHH[SHQVHVGLUHFWO\DWWULEXWDEOHWRWHUPLQDWLRQ  *,QWKHHYHQWRIWKHIDLOXUHRIWKH&RQWUDFWRUDQG&LW\WRDJUHHXSRQWKHZKROHDPRXQWWREHSDLG WRWKH&RQWUDFWRUE\UHDVRQRIWKHWHUPLQDWLRQRIWKH:RUNWKH&LW\VKDOOGHWHUPLQHRQWKHEDVLV RI LQIRUPDWLRQ DYDLODEOH WR LW WKH DPRXQW LI DQ\ GXH WR WKH&RQWUDFWRU E\ UHDVRQ RI WKH WHUPLQDWLRQDQGVKDOOSD\WRWKH&RQWUDFWRUWKHDPRXQWVGHWHUPLQHG&RQWUDFWRUVKDOOQRWEHSDLG RQDFFRXQWRIORVVRIDQWLFLSDWHGSURILWVRUUHYHQXHRURWKHUHFRQRPLFORVVDULVLQJRXWRIRU UHVXOWLQJIURPVXFKWHUPLQDWLRQ  $57,&/(±',6387(5(62/87,21  Methods and Procedures  $(LWKHU&LW\RU&RQWUDFWRUPD\UHTXHVWPHGLDWLRQRIDQ\&RQWUDFW&ODLPVXEPLWWHGIRUDGHFLVLRQ XQGHU 3DUDJUDSK  EHIRUH VXFK GHFLVLRQ EHFRPHV ILQDO DQG ELQGLQJ 7KH UHTXHVW IRU PHGLDWLRQVKDOOEHVXEPLWWHGWRWKHRWKHUSDUW\WRWKH&RQWUDFW7LPHO\VXEPLVVLRQRIWKHUHTXHVW VKDOOVWD\WKHHIIHFWRI3DUDJUDSK(  %&LW\DQG&RQWUDFWRUVKDOOSDUWLFLSDWHLQWKHPHGLDWLRQSURFHVVLQJRRGIDLWK7KHSURFHVVVKDOOEH FRPPHQFHGZLWKLQGD\VRIILOLQJRIWKHUHTXHVW  &,IWKH&RQWUDFW&ODLPLVQRWUHVROYHGE\PHGLDWLRQ&LW\¶VDFWLRQXQGHU3DUDJUDSK&RUD GHQLDOSXUVXDQWWR3DUDJUDSKV&RU'VKDOOEHFRPHILQDODQGELQGLQJGD\VDIWHU WHUPLQDWLRQRIWKHPHGLDWLRQXQOHVVZLWKLQWKDWWLPHSHULRG&LW\RU&RQWUDFWRU  HOHFWVLQZULWLQJWRLQYRNHDQ\RWKHUGLVSXWHUHVROXWLRQSURFHVVSURYLGHGIRULQWKH       479   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 6XSSOHPHQWDU\&RQGLWLRQVRU  DJUHHVZLWKWKHRWKHUSDUW\WRVXEPLWWKH&RQWUDFW&ODLPWRDQRWKHU GLVSXWH UHVROXWLRQ SURFHVVRU  JLYHVZULWWHQQRWLFHWRWKHRWKHUSDUW\RIWKHLQWHQWWRVXEPLWWKH&RQWUDFW&ODLPWRDFRXUWRI FRPSHWHQWMXULVGLFWLRQ  $57,&/(±0,6&(//$1(286  Giving Notice  $:KHQHYHUDQ\SURYLVLRQRIWKH&RQWUDFW'RFXPHQWVUHTXLUHVWKHJLYLQJRIZULWWHQQRWLFHLWZLOO EHGHHPHGWRKDYHEHHQYDOLGO\JLYHQLI  GHOLYHUHGLQSHUVRQWRWKHLQGLYLGXDORUWRDPHPEHURIWKHILUPRUWRDQRIILFHURIWKH FRUSRUDWLRQIRUZKRPLWLVLQWHQGHGRU  GHOLYHUHGDWRUVHQWE\UHJLVWHUHGRUFHUWLILHGPDLOSRVWDJHSUHSDLGWRWKHODVWEXVLQHVV DGGUHVVNQRZQWRWKHJLYHURIWKHQRWLFH  GHOLYHUHGE\HOHFWURQLFPHDQVWRRUIURPWKH3URMHFW0DQDJHU  %%XVLQHVVDGGUHVVFKDQJHVPXVWEHSURPSWO\PDGHLQZULWLQJWRWKHRWKHUSDUW\  &:KHQHYHUWKH&RQWUDFW'RFXPHQWVVSHFLILHVJLYLQJQRWLFHE\HOHFWURQLFPHDQVVXFKHOHFWURQLF QRWLFHVKDOOEHGHHPHGVXIILFLHQWXSRQFRQILUPDWLRQRIUHFHLSWE\WKHUHFHLYLQJSDUW\  Computation of Times  :KHQDQ\SHULRGRIWLPHLVUHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWVE\GD\VLWZLOOEHFRPSXWHGWR H[FOXGHWKHILUVWDQGLQFOXGHWKHODVWGD\RIVXFKSHULRG,IWKHODVWGD\RIDQ\VXFKSHULRGIDOOVRQD 6DWXUGD\RU6XQGD\RURQDGD\PDGHDOHJDOKROLGD\WKHQH[W:RUNLQJ'D\VKDOOEHFRPHWKHODVW GD\RIWKHSHULRG  Cumulative Remedies  7KH GXWLHV DQG REOLJDWLRQV LPSRVHG E\ WKHVH *HQHUDO &RQGLWLRQVDQG WKH ULJKWV DQG UHPHGLHV DYDLODEOHKHUHXQGHUWRWKHSDUWLHVKHUHWRDUHLQDGGLWLRQWRDQGDUHQRWWREHFRQVWUXHGLQDQ\ZD\DV DOLPLWDWLRQRIDQ\ULJKWVDQGUHPHGLHVDYDLODEOHWRDQ\RUDOORIWKHPZKLFKDUHRWKHUZLVHLPSRVHG RUDYDLODEOHE\/DZVRU5HJXODWLRQVE\VSHFLDOZDUUDQW\RUJXDUDQWHHRUE\RWKHUSURYLVLRQVRIWKH &RQWUDFW'RFXPHQWV7KHSURYLVLRQVRIWKLV3DUDJUDSKZLOOEHDVHIIHFWLYHDVLIUHSHDWHGVSHFLILFDOO\ LQWKH&RQWUDFW'RFXPHQWVLQFRQQHFWLRQZLWKHDFKSDUWLFXODUGXW\REOLJDWLRQULJKWDQGUHPHG\WR ZKLFKWKH\DSSO\          480   *(1(5$/&21',7,216 3DJHRI   &,7<2)'(1721 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176 5HYLVHGSeptember 20, 2018 Survival of Obligations  $OOUHSUHVHQWDWLRQVLQGHPQLILFDWLRQVZDUUDQWLHVDQGJXDUDQWHHVPDGHLQUHTXLUHGE\RUJLYHQLQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV DV ZHOO DV DOO FRQWLQXLQJ REOLJDWLRQV LQGLFDWHG LQ WKH &RQWUDFW 'RFXPHQWV ZLOO VXUYLYH ILQDO SD\PHQW FRPSOHWLRQ DQG DFFHSWDQFH RI WKH :RUN RU WHUPLQDWLRQRUFRPSOHWLRQRIWKH&RQWUDFWRUWHUPLQDWLRQRIWKHVHUYLFHVRI&RQWUDFWRU  Headings  $UWLFOHDQGSDUDJUDSKKHDGLQJVDUHLQVHUWHGIRUFRQYHQLHQFHRQO\DQGGRQRWFRQVWLWXWHSDUWVRIWKHVH *HQHUDO&RQGLWLRQV       481  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018  6(&7,21 6833/(0(17$5<&21',7,216 72 *(1(5$/&21',7,216   6XSSOHPHQWDU\&RQGLWLRQV  7KHVH6XSSOHPHQWDU\&RQGLWLRQVPRGLI\DQGVXSSOHPHQW6HFWLRQ*HQHUDO&RQGLWLRQVDQGRWKHU SURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVDVLQGLFDWHGEHORZ$OOSURYLVLRQVRIWKH*HQHUDO&RQGLWLRQVWKDWDUH PRGLILHGRUVXSSOHPHQWHGUHPDLQLQIXOOIRUFHDQGHIIHFWDVVRPRGLILHGRUVXSSOHPHQWHG$OOSURYLVLRQV RIWKH*HQHUDO&RQGLWLRQVZKLFKDUHQRWVRPRGLILHGRUVXSSOHPHQWHGUHPDLQLQIXOOIRUFHDQGHIIHFW  'HILQHG7HUPV  7KHWHUPVXVHGLQWKHVH6XSSOHPHQWDU\&RQGLWLRQVZKLFKDUHGHILQHGLQWKH*HQHUDO&RQGLWLRQVKDYHWKH PHDQLQJDVVLJQHGWRWKHPLQWKH*HQHUDO&RQGLWLRQVXQOHVVVSHFLILFDOO\QRWHGKHUHLQ  0RGLILFDWLRQVDQG6XSSOHPHQWV  7KHIROORZLQJDUHLQVWUXFWLRQVWKDWPRGLI\RUVXSSOHPHQWVSHFLILFSDUDJUDSKVLQWKH*HQHUDO&RQGLWLRQVDQG RWKHU&RQWUDFW'RFXPHQWV  6&$  (DVHPHQWOLPLWVVKRZQRQWKH'UDZLQJDUHDSSUR[LPDWHDQGZHUHSURYLGHGWRHVWDEOLVKDEDVLVIRUELGGLQJ 8SRQUHFHLYLQJWKHILQDOHDVHPHQWVGHVFULSWLRQV&RQWUDFWRUVKDOOFRPSDUHWKHPWRWKHOLQHVVKRZQRQWKH &RQWUDFW'UDZLQJV  6&$³$YDLODELOLW\RI/DQGV´  7KHIROORZLQJLVDOLVWRINQRZQRXWVWDQGLQJULJKWRIZD\DQGRUHDVHPHQWVWREHDFTXLUHGLIDQ\DVRI 8/10/2020  2XWVWDQGLQJ5LJKW2I:D\DQGRU(DVHPHQWVWR%H$FTXLUHG 3$5&(/ 180%(5 2:1(5 7$5*(7'$7( 2)3266(66,21 None     7KH&RQWUDFWRUXQGHUVWDQGVDQGDJUHHVWKDWWKHGDWHVOLVWHGDERYHDUHHVWLPDWHVRQO\DUHQRWJXDUDQWHHG DQGGRQRWELQGWKH&LW\  ,I&RQWUDFWRUFRQVLGHUVWKHILQDOHDVHPHQWVSURYLGHGWRGLIIHUPDWHULDOO\IURPWKHUHSUHVHQWDWLRQVRQWKH &RQWUDFW'UDZLQJV&RQWUDFWRUVKDOOZLWKLQILYH  %XVLQHVV'D\VDQGEHIRUHSURFHHGLQJZLWKWKH:RUN QRWLI\&LW\LQZULWLQJDVVRFLDWHGZLWKWKHGLIIHULQJHDVHPHQWOLQHORFDWLRQV  6&$³$YDLODELOLW\RI/DQGV´  8WLOLWLHVRUREVWUXFWLRQVWREHUHPRYHGDGMXVWHGDQGRUUHORFDWHG        482  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018  7KHIROORZLQJLVOLVWRIXWLOLWLHVDQGRUREVWUXFWLRQVWKDWKDYHQRWEHHQUHPRYHGDGMXVWHGDQGRUUHORFDWHG DVRI8/10/2020  (;3(&7(' 2:1(5 87,/,7<$1'/2&$7,21 7$5*(7'$7(2) $'-8670(17 None   7KH&RQWUDFWRUXQGHUVWDQGVDQGDJUHHVWKDWWKHGDWHVOLVWHGDERYHDUHHVWLPDWHVRQO\DUHQRWJXDUDQWHHG DQGGRQRWELQGWKH&LW\  6&$³6XEVXUIDFHDQG3K\VLFDO&RQGLWLRQV´  7KHIROORZLQJDUHUHSRUWVRIH[SORUDWLRQVDQGWHVWVRIVXEVXUIDFHFRQGLWLRQVDWWKHVLWHRIWKH:RUN  $Geotechnical Investigation 5HSRUW1R'GDWHGSUHSDUHGE\ Gee Consultants Inc,  DVXEFRQVXOWDQWRI DFRQVXOWDQWRIWKH&LW\SURYLGLQJDGGLWLRQDOLQIRUPDWLRQRQ pavement section thickness  recommendations and subgrade treatment.   $General Report, 5HSRUW1RGDWHGSUHSDUHGE\ Gee Consultants Inc, DVXEFRQVXOWDQWRI, DFRQVXOWDQWRIWKH&LW\SURYLGLQJDGGLWLRQDOLQIRUPDWLRQRQ the existing parking lot pavement cross  section.  7KHIROORZLQJDUHGUDZLQJVRISK\VLFDOFRQGLWLRQVLQRUUHODWLQJWRH[LVWLQJVXUIDFHDQGVXEVXUIDFH VWUXFWXUHV H[FHSW8QGHUJURXQG)DFLOLWLHV ZKLFKDUHDWRUFRQWLJXRXVWRWKHVLWHRIWKH:RUN None   6&$³+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQVDW6LWH´  7KHIROORZLQJDUHUHSRUWVDQGGUDZLQJVRIH[LVWLQJKD]DUGRXVHQYLURQPHQWDOFRQGLWLRQVNQRZQWRWKH&LW\ None  6&$³&HUWLILFDWHVRI,QVXUDQFH´  7KHHQWLWLHVOLVWHGEHORZDUHDGGLWLRQDOLQVXUHGVDVWKHLULQWHUHVWPD\DSSHDULQFOXGLQJWKHLUUHVSHFWLYH RIILFHUVGLUHFWRUVDJHQWVDQGHPSOR\HHV   &LW\  &RQVXOWDQWNone  2WKHUNone   6&$³&RQWUDFWRU¶V,QVXUDQFH´  7KHOLPLWVRIOLDELOLW\IRUWKHLQVXUDQFHUHTXLUHGE\3DUDJUDSK*&VKDOOSURYLGHWKHIROORZLQJ FRYHUDJHVIRUQRWOHVVWKDQWKHIROORZLQJDPRXQWVRUJUHDWHUZKHUHUHTXLUHGE\ODZVDQGUHJXODWLRQV  $:RUNHUV &RPSHQVDWLRQXQGHU3DUDJUDSK*&$  Statutory limits  Employer's liability  $100,000 each accident/occurrence  $100,000 Disease - each employee  $500,000 Disease - policy limit       483  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018   6&%³&RQWUDFWRU¶V,QVXUDQFH´  %&RPPHUFLDO*HQHUDO/LDELOLW\XQGHU3DUDJUDSK*&%&RQWUDFWRU V/LDELOLW\,QVXUDQFH XQGHU3DUDJUDSK*&%ZKLFKVKDOOEHRQDSHUSURMHFWEDVLVFRYHULQJWKH&RQWUDFWRUZLWK PLQLPXPOLPLWVRI  $1,000,000 each occurrence  $2,000,000 aggregate limit     7KHSROLF\PXVWKDYHDQHQGRUVHPHQW $PHQGPHQW±$JJUHJDWH/LPLWVRI,QVXUDQFH PDNLQJWKH *HQHUDO$JJUHJDWH/LPLWVDSSO\VHSDUDWHO\WRHDFKMREVLWH  7KH&RPPHUFLDO*HQHUDO/LDELOLW\,QVXUDQFHSROLFLHVVKDOOSURYLGH³;´³&´DQG³8´FRYHUDJH¶V 9HULILFDWLRQRIVXFKFRYHUDJHPXVWEHVKRZQLQWKH5HPDUNV$UWLFOHRIWKH&HUWLILFDWHRI,QVXUDQFH  6&&³&RQWUDFWRU¶V,QVXUDQFH´ &$XWRPRELOH/LDELOLW\XQGHU3DUDJUDSK*&&&RQWUDFWRU¶V/LDELOLW\,QVXUDQFHXQGHU 3DUDJUDSK*&&ZKLFKVKDOOEHLQDQDPRXQWQRWOHVVWKDQWKHIROORZLQJDPRXQWV   $XWRPRELOH/LDELOLW\DFRPPHUFLDOEXVLQHVVSROLF\VKDOOSURYLGHFRYHUDJHRQ$Q\$XWR GHILQHGDVDXWRVRZQHGKLUHGDQGQRQRZQHG  $1,000,000 HDFKDFFLGHQWRQDFRPELQHGVLQJOHOLPLWEDVLV6SOLWOLPLWVDUHDFFHSWDEOHLIOLPLWVDUHDW OHDVW  $250,000 Bodily Injury per person /  $500,000 Bodily Injury per accident /  $100,000 Property Damage   6&'³&RQWUDFWRU¶V,QVXUDQFH´  7KH&RQWUDFWRU¶VFRQVWUXFWLRQDFWLYLWLHVZLOOUHTXLUHLWVHPSOR\HHVDJHQWVVXEFRQWUDFWRUVHTXLSPHQWDQG PDWHULDOGHOLYHULHVWRFURVVUDLOURDGSURSHUWLHVDQGWUDFNVRUSHUIRUPZRUNZLWKLQIHHWRIWKHFHQWHUOLQH RIWUDFNV[None].  7KH&RQWUDFWRUVKDOOFRQGXFWLWVRSHUDWLRQVRQUDLOURDGSURSHUWLHVLQVXFKDPDQQHUDVQRWWRLQWHUIHUHZLWK KLQGHURUREVWUXFWWKHUDLOURDGFRPSDQ\LQDQ\PDQQHUZKDWVRHYHULQWKHXVHRURSHUDWLRQRILWVWKHLUWUDLQV RURWKHUSURSHUW\6XFKRSHUDWLRQVRQUDLOURDGSURSHUWLHVPD\UHTXLUHWKDW&RQWUDFWRUWRH[HFXWHD³5LJKWRI (QWU\$JUHHPHQW´ZLWKWKHSDUWLFXODUUDLOURDGFRPSDQ\RUFRPSDQLHVLQYROYHGDQGWRWKLVHQGWKH &RQWUDFWRUVKRXOGVDWLVI\LWVHOIDVWRWKHUHTXLUHPHQWVRIHDFKUDLOURDGFRPSDQ\DQGEHSUHSDUHGWRH[HFXWH WKHULJKWRIHQWU\ LIDQ\ UHTXLUHGE\DUDLOURDGFRPSDQ\7KHUHTXLUHPHQWVVSHFLILHGKHUHLQOLNHZLVHUHODWH WRWKH&RQWUDFWRU¶VXVHRISULYDWHDQGRUFRQVWUXFWLRQDFFHVVURDGVFURVVLQJVDLGUDLOURDGFRPSDQ\¶V SURSHUWLHV  7KH&RQWUDFWXDO/LDELOLW\FRYHUDJHUHTXLUHGE\3DUDJUDSK'RIWKH*HQHUDO&RQGLWLRQVVKDOOSURYLGH FRYHUDJHIRUQRWOHVVWKDQWKHIROORZLQJDPRXQWVLVVXHGE\FRPSDQLHVVDWLVIDFWRU\WRWKH&LW\DQGWRWKH 5DLOURDG&RPSDQ\IRUDWHUPWKDWFRQWLQXHVIRUVRORQJDVWKH&RQWUDFWRU¶VRSHUDWLRQVDQGZRUNFURVV RFFXS\RUWRXFKUDLOURDGSURSHUW\    *HQHUDO$JJUHJDWH   $Confirm Limits with Railroad    (DFK2FFXUUHQFH$Confirm Limits with Railroad  Required for this Contract X Not required for this Contract       484  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018    :LWKUHVSHFWWRWKHDERYHRXWOLQHGLQVXUDQFHUHTXLUHPHQWVWKHIROORZLQJVKDOOJRYHUQ  :KHUHDVLQJOHUDLOURDGFRPSDQ\LVLQYROYHGWKH&RQWUDFWRUVKDOOSURYLGHRQHLQVXUDQFHSROLF\LQ WKH QDPH RI WKH UDLOURDG FRPSDQ\ +RZHYHU LI PRUH WKDQ RQH JUDGH VHSDUDWLRQ RU DWJUDGH FURVVLQJLVDIIHFWHGE\WKH3URMHFWDWHQWLUHO\VHSDUDWHORFDWLRQVRQWKHOLQHRUOLQHVRIWKHVDPH UDLOURDGFRPSDQ\VHSDUDWHFRYHUDJHPD\EHUHTXLUHGHDFKLQWKHDPRXQWVWDWHGDERYH  :KHUHPRUHWKDQRQHUDLOURDGFRPSDQ\LVRSHUDWLQJRQWKHVDPHULJKWRIZD\RUZKHUHVHYHUDO UDLOURDGFRPSDQLHVDUHLQYROYHGDQGRSHUDWHGRQWKHLURZQVHSDUDWHULJKWVRIZD\WKH&RQWUDFWRU PD\EHUHTXLUHGWRSURYLGHVHSDUDWHLQVXUDQFHSROLFLHVLQWKHQDPHRIHDFKUDLOURDGFRPSDQ\  ,ILQDGGLWLRQWRDJUDGHVHSDUDWLRQRUDQDWJUDGHFURVVLQJRWKHUZRUNRUDFWLYLW\LVSURSRVHGRQD UDLOURDGFRPSDQ\¶VULJKWRIZD\DWDORFDWLRQHQWLUHO\VHSDUDWHIURPWKHJUDGHVHSDUDWLRQRUDW JUDGHFURVVLQJLQVXUDQFHFRYHUDJHIRUWKLVZRUNPXVWEHLQFOXGHGLQWKHSROLF\FRYHULQJWKHJUDGH VHSDUDWLRQ  ,IQRJUDGHVHSDUDWLRQLVLQYROYHGEXWRWKHUZRUNLVSURSRVHGRQDUDLOURDGFRPSDQ\¶VULJKWRI ZD\DOOVXFKRWKHUZRUNPD\EHFRYHUHGLQDVLQJOHSROLF\IRUWKDWUDLOURDGHYHQWKRXJKWKHZRUN PD\EHDWWZRRUPRUHVHSDUDWHORFDWLRQV  1RZRUNRUDFWLYLWLHVRQDUDLOURDGFRPSDQ\¶VSURSHUW\WREHSHUIRUPHGE\WKH&RQWUDFWRUVKDOOEH FRPPHQFHGXQWLOWKH&RQWUDFWRUKDVIXUQLVKHGWKH&LW\ZLWKDQRULJLQDOSROLF\RUSROLFLHVRIWKHLQVXUDQFH IRUHDFKUDLOURDGFRPSDQ\QDPHGDVUHTXLUHGDERYH$OOVXFKLQVXUDQFHPXVWEHDSSURYHGE\WKH&LW\DQG HDFKDIIHFWHG5DLOURDG&RPSDQ\SULRUWRWKH&RQWUDFWRU¶VEHJLQQLQJZRUN  7KHLQVXUDQFHVSHFLILHGDERYHPXVWEHFDUULHGXQWLODOO:RUNWREHSHUIRUPHGRQWKHUDLOURDGULJKWRIZD\ KDVEHHQFRPSOHWHGDQGWKHJUDGHFURVVLQJLIDQ\LVQRORQJHUXVHGE\WKH&RQWUDFWRU,QDGGLWLRQ LQVXUDQFHPXVWEHFDUULHGGXULQJDOOPDLQWHQDQFHDQGRUUHSDLUZRUNSHUIRUPHGLQWKHUDLOURDGULJKWRIZD\ 6XFKLQVXUDQFHPXVWQDPHWKHUDLOURDGFRPSDQ\DVWKHLQVXUHGWRJHWKHUZLWKDQ\WHQDQWRUOHVVHHRIWKH UDLOURDGFRPSDQ\RSHUDWLQJRYHUWUDFNVLQYROYHGLQWKH3URMHFW  6&³3HUPLWVDQG8WLOLWLHV´  6&$³&RQWUDFWRUREWDLQHGSHUPLWVDQGOLFHQVHV´ 7KHIROORZLQJDUHNQRZQSHUPLWVDQGRUOLFHQVHVUHTXLUHGE\WKH&RQWUDFWWREHDFTXLUHGE\WKH&RQWUDFWRU  None.  6&%³&LW\REWDLQHGSHUPLWVDQGOLFHQVHV´ 7KHIROORZLQJDUHNQRZQSHUPLWVDQGRUOLFHQVHVUHTXLUHGE\WKH&RQWUDFWWREHDFTXLUHGE\WKH&LW\ 1. Parking Lot Permit 2. Irrigation Permit 3. TxDOT Permit   6&&³2XWVWDQGLQJSHUPLWVDQGOLFHQVHV´  7KHIROORZLQJLVDOLVWRINQRZQRXWVWDQGLQJSHUPLWVDQGRUOLFHQVHVWREHDFTXLUHGLIDQ\DVRI9/25/2020  2XWVWDQGLQJ3HUPLWVDQGRU/LFHQVHVWR%H$FTXLUHG 2:1(5 3(50,725/,&(16($1'/2&$7,21 7$5*(7'$7( 2)3266(66,21 None        485  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018  2:1(5 3(50,725/,&(16($1'/2&$7,21 7$5*(7'$7( 2)3266(66,21    6&%³7LWOH9,&LYLO5LJKWV$FWRIDVDPHQGHG´  'XULQJWKHSHUIRUPDQFHRIWKLV&RQWUDFWWKH&RQWUDFWRUIRULWVHOILWVDVVLJQHHVDQGVXFFHVVRUVLQLQWHUHVW KHUHLQDIWHUUHIHUUHGWRDVWKH&RQWUDFWRU DJUHHVDVIROORZV  &RPSOLDQFHZLWK5HJXODWLRQV7KH&RQWUDFWRUVKDOOFRPSO\ZLWKWKH5HJXODWLRQUHODWLYHWR QRQGLVFULPLQDWLRQLQ)HGHUDOO\DVVLVWHGSURJUDPVRIWKH'HSDUWPHQWRI7UDQVSRUWDWLRQ KHUHLQDIWHU ³'27´ 7LWOH&RGHRI)HGHUDO5HJXODWLRQV3DUWDVWKH\PD\EHDPHQGHGIURPWLPHWRWLPH KHUHLQDIWHUUHIHUUHGWRDVWKH5HJXODWLRQV ZKLFKDUHKHUHLQLQFRUSRUDWHGE\UHIHUHQFHDQGPDGHDSDUW RIWKLVFRQWUDFW  1RQGLVFULPLQDWLRQ7KH&RQWUDFWRUZLWKUHJDUGWRWKHZRUNSHUIRUPHGE\LWGXULQJWKHFRQWUDFWVKDOO QRWGLVFULPLQDWHRQWKHJURXQGVRIUDFHFRORURUQDWLRQDORULJLQLQWKHVHOHFWLRQDQGUHWHQWLRQRI VXEFRQWUDFWRUVLQFOXGLQJSURFXUHPHQWVRIPDWHULDOVDQGOHDVHVRIHTXLSPHQW7KH&RQWUDFWRUVKDOOQRW SDUWLFLSDWHHLWKHUGLUHFWO\RULQGLUHFWO\LQWKHGLVFULPLQDWLRQSURKLELWHGE\&)5VHFWLRQRIWKH 5HJXODWLRQVLQFOXGLQJHPSOR\PHQWSUDFWLFHVZKHQWKHFRQWUDFWFRYHUVDSURJUDPVHWIRUWKLQ $SSHQGL[%RIWKH5HJXODWLRQV  6ROLFLWDWLRQVIRU6XEFRQWUDFWRUV,QFOXGLQJ3URFXUHPHQWVRI0DWHULDOVDQG(TXLSPHQW,QDOO VROLFLWDWLRQVHLWKHUE\FRPSHWLWLYHELGGLQJRUQHJRWLDWLRQPDGHE\WKHFRQWUDFWRUIRUZRUNWREH SHUIRUPHGXQGHUDVXEFRQWUDFWLQFOXGLQJSURFXUHPHQWVRIPDWHULDOVRUOHDVHVRIHTXLSPHQWHDFK SRWHQWLDOVXEFRQWDFWRURUVXSSOLHUVKDOOEHQRWLILHGE\WKH&RQWUDFWRURIWKH&RQWUDFWRU VREOLJDWLRQV XQGHUWKLVFRQWUDFWDQGWKH5HJXODWLRQVUHODWLYHWRQRQGLVFULPLQDWLRQRQWKHJURXQGVRIUDFHFRORURU QDWLRQDORULJLQ  ,QIRUPDWLRQDQG5HSRUWV7KH&RQWUDFWRUVKDOOSURYLGHDOOLQIRUPDWLRQDQGUHSRUWVUHTXLUHGE\WKH 5HJXODWLRQVRUGLUHFWLYHVLVVXHGSXUVXDQWWKHUHWRDQGVKDOOSHUPLWDFFHVVWRLWVERRNVUHFRUGV DFFRXQWVRWKHUVRXUFHVRILQIRUPDWLRQDQGLWVIDFLOLWLHVDVPD\EHGHWHUPLQHGE\&LW\RUWKH7H[DV 'HSDUWPHQWRI7UDQVSRUWDWLRQWREHSHUWLQHQWWRDVFHUWDLQFRPSOLDQFHZLWKVXFK5HJXODWLRQVRUGHUV DQGLQVWUXFWLRQV:KHUHDQ\LQIRUPDWLRQUHTXLUHGRIDFRQWUDFWRULVLQWKHH[FOXVLYHSRVVHVVLRQRI DQRWKHUZKRIDLOVRUUHIXVHVWRIXUQLVKWKLVLQIRUPDWLRQWKHFRQWUDFWRUVKDOOVRFHUWLI\WRWKH&LW\RUWKH 7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQDVDSSURSULDWHDQGVKDOOVHWIRUWKZKDWHIIRUWVLWKDVPDGHWR REWDLQWKHLQIRUPDWLRQ  6DQFWLRQVIRU1RQFRPSOLDQFH,QWKHHYHQWRIWKH&RQWUDFWRU VQRQFRPSOLDQFHZLWKWKH QRQGLVFULPLQDWLRQSURYLVLRQVRIWKLV&RQWUDFW&LW\VKDOOLPSRVHVXFKFRQWUDFWVDQFWLRQVDVLWRUWKH 7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQPD\GHWHUPLQHWREHDSSURSULDWHLQFOXGLQJEXWQRWOLPLWHGWR  DZLWKKROGLQJRISD\PHQWVWRWKH&RQWUDFWRUXQGHUWKH&RQWUDFWXQWLOWKH&RQWUDFWRU FRPSOLHVDQGRU EFDQFHOODWLRQWHUPLQDWLRQRUVXVSHQVLRQRIWKH&RQWUDFWLQZKROHRULQSDUW  ,QFRUSRUDWLRQRI3URYLVLRQV7KH&RQWUDFWRUVKDOOLQFOXGHWKHSURYLVLRQVRISDUDJUDSKV  WKURXJK  LQHYHU\VXEFRQWUDFWLQFOXGLQJSURFXUHPHQWVRIPDWHULDOVDQGOHDVHVRIHTXLSPHQWXQOHVVH[HPSW E\WKH5HJXODWLRQVRUGLUHFWLYHVLVVXHGSXUVXDQWWKHUHWR7KH&RQWUDFWRUVKDOOWDNHVXFKDFWLRQZLWK UHVSHFWWRDQ\VXEFRQWUDFWRUSURFXUHPHQWDV&LW\RUWKH7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQPD\ GLUHFWDVDPHDQVRIHQIRUFLQJVXFKSURYLVLRQVLQFOXGLQJVDQFWLRQVIRUQRQFRPSOLDQFH3URYLGHG KRZHYHUWKDWLQWKHHYHQWDFRQWUDFWRUEHFRPHVLQYROYHGLQRULVWKUHDWHQHGZLWKOLWLJDWLRQZLWKD VXEFRQWUDFWRURUVXSSOLHUDVDUHVXOWRIVXFKGLUHFWLRQWKHFRQWUDFWRUPD\UHTXHVW&LW\WRHQWHULQWR       486  6833/(0(17$5<&21',7,216 3DJHRI  &,7<2)'(1721 IFB No. 7452 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176Project # 200004 5HYLVHGSeptember 20, 2018  VXFKOLWLJDWLRQWRSURWHFWWKHLQWHUHVWVRI&LW\DQGLQDGGLWLRQWKHFRQWUDFWRUPD\UHTXHVWWKH8QLWHG 6WDWHVWRHQWHULQWRVXFKOLWLJDWLRQWRSURWHFWWKHLQWHUHVWVRIWKH8QLWHG6WDWHV  $GGLWLRQDO7LWOH9,UHTXLUHPHQWVFDQEHIRXQGLQWKH$SSHQGL[  6&³&RRUGLQDWLRQ´  7KHLQGLYLGXDOVRUHQWLWLHVOLVWHGEHORZKDYHFRQWUDFWVZLWKWKH&LW\IRUWKHSHUIRUPDQFHRIRWKHUZRUNDW WKH6LWH  9HQGRU 6FRSHRI:RUN &RRUGLQDWLRQ$XWKRULW\ Byrne Construction Building Renovations CITY    6&³&RPPXQLFDWLRQVWR&RQWUDFWRU´  &RQWUDFWRUPD\QHHGWRFRPPXQLFDWHZLWK%\UQH&RQVWUXFWLRQZKRLVUHQRYDWLQJWKHEXLOGLQJRQVLWH7KH\ DUHVODWHGWRILQLVKUHQRYDWLRQVDQGEHRIIVLWHE\PLGWRODWH1RYHPEHURI  6&³&LW\¶V3URMHFW0DQDJHU´  7KH&LW\¶V3URMHFW0DQDJHUIRUWKLV&RQWUDFWLVTrevor CrainRUKLVKHUVXFFHVVRUSXUVXDQWWRZULWWHQ QRWLILFDWLRQIURPWKH&LW\(QJLQHHU  6&&³7HVWVDQG,QVSHFWLRQV´  None   6&&³0HWKRGVDQG3URFHGXUHV´  None    (1'2)6(&7,21   5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(          487 Exhibit CONFLICT OF INTEREST QUESTIONNAIRE - FORM CIQ For vendor or other person doing business with local governmental entity This questionnaire reflects changes made to the law by H.B. 23, 84th Leg., Regular Session. This questionnaire is being filed in accordance with Chapter 176, Local Government Code, by a vendor who has a business relationship as defined by Section 176.001(1-a) with a local governmental entity and the vendor meets requirements under Section 176.006(a). By law this questionnaire must be filed with the records administrator of the local government entity not later than the 7th business day after the date the vendor becomes aware of facts that require the statement to be filed. See Section 176.006(a-1), Local Government Code. A vendor commits an offense if the vendor knowingly violates Section 176.006, Local Government Code. An offense under this section is a misdemeanor. 1 Name of vendor who has a business relationship with local governmental entity. 2 Check this box if you are filing an update to a previously filed questionnaire. (The law requires that you file an updated completed questionnaire with the appropriate filing authority not later than the 7th business day after the date on which you became aware that the originally filed questionnaire was incomplete or inaccurate.) 3 Name of local government officer about whom the information in this section is being disclosed. Name of Officer This section, (item 3 including subparts A, B, C & D), must be completed for each officer with whom the vendor has an employment or other business relationship as defined by Section 176.001(1-a), Local Government Code. Attach additional pages to this Form CIQ as necessary. A. Is the local government officer named in this section receiving or likely to receive taxable income, other than investment income, from the vendor? Yes No B. Is the vendor receiving or likely to receive taxable income, other than investment income, from or at the direction of the local government officer named in this section AND the taxable income is not received from the local governmental entity? Yes No C. Is the filer of this questionnaire employed by a corporation or other business entity with respect to which the local government officer serves as an officer or director, or holds an ownership of one percent or more? Yes No D. Describe each employment or business and family relationship with the local government officer named in this section. 4 I have no Conflict of Interest to disclose. 5 Signature of vendor doing business with the governmental entity Date                      488 Certificate Of Completion Envelope Id: 698367FAAA5C4F1CACBFB9828E3E3BC0 Status: Completed Subject: Please DocuSign: City Council Contract 7452 - DDSC Parking Lot Source Envelope: Document Pages: 95 Signatures: 6 Envelope Originator: Certificate Pages: 6 Initials: 1 Laura Hermosillo AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 laura.hermosillo@cityofdenton.com IP Address: 198.49.140.104 Record Tracking Status: Original 10/12/2020 6:18:58 PM Holder: Laura Hermosillo laura.hermosillo@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Laura Hermosillo laura.hermosillo@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.104 Sent: 10/12/2020 6:23:22 PM Viewed: 10/12/2020 6:23:31 PM Signed: 10/12/2020 6:23:33 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 10/12/2020 6:23:36 PM Viewed: 10/13/2020 9:21:04 AM Signed: 10/13/2020 9:23:38 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Mack Reinwand mack.reinwand@cityofdenton.com City of Denton Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 10/13/2020 9:23:41 AM Viewed: 10/19/2020 8:55:37 AM Signed: 10/19/2020 8:59:04 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Mark Berry mark@msbconstructorsinc.com President Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 174.246.138.45 Signed using mobile Sent: 10/19/2020 8:59:09 AM Resent: 10/26/2020 9:05:34 AM Viewed: 10/26/2020 9:52:26 AM Signed: 10/26/2020 9:54:23 AM Electronic Record and Signature Disclosure: Accepted: 10/26/2020 9:52:26 AM ID: ae52c0d5-82cb-41b0-a0ca-32056126ac3c 489 Signer Events Signature Timestamp Rebecca Diviney Rebecca.Diviney@cityofdenton.com Director of Capital Projects/City Engineer Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 47.222.28.222 Sent: 10/26/2020 9:54:26 AM Viewed: 10/26/2020 10:03:28 AM Signed: 10/26/2020 10:04:31 AM Electronic Record and Signature Disclosure: Accepted: 10/26/2020 10:03:28 AM ID: 2cc6ad8d-bdbc-4632-9e93-4833726c05ea Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.104 Sent: 10/26/2020 10:04:35 AM Viewed: 11/11/2020 10:06:07 AM Signed: 11/11/2020 10:06:40 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Todd Hileman Todd.Hileman@cityofdenton.com City Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 47.184.93.41 Sent: 11/11/2020 10:06:44 AM Viewed: 11/11/2020 10:36:18 AM Signed: 11/11/2020 10:36:25 AM Electronic Record and Signature Disclosure: Accepted: 7/25/2017 11:02:14 AM ID: 57619fbf-2aec-4b1f-805d-6bd7d9966f21 Rosa Rios rosa.rios@cityofdenton.com City Secretary Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 11/11/2020 10:36:28 AM Viewed: 11/11/2020 1:29:30 PM Signed: 11/11/2020 1:29:53 PM Electronic Record and Signature Disclosure: Accepted: 11/11/2020 1:29:30 PM ID: 02e2f01e-4fcb-4f8b-993d-e6d2498626fe In Ierson Signer Events Signature Timestamp Editor DeliverI Events Status Timestamp Igent DeliverI Events Status Timestamp IntermediarI DeliverI Events Status Timestamp Certified DeliverI Events Status Timestamp CarIon CopI Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 10/12/2020 6:23:35 PM Electronic Record and Signature Disclosure: 490 CarIon CopI Events Status Timestamp Not Offered via DocuSign Sherri Thurman sherri.thurman@cityofdenton.com City of Denton Security Level: Email, Account Authentication (None) Sent: 10/26/2020 10:04:35 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Zolaina Parker Zolaina.Parker@cityofdenton.com City of Denton Security Level: Email, Account Authentication (None) Sent: 11/11/2020 1:29:57 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 11/11/2020 1:29:58 PM Viewed: 11/11/2020 1:35:28 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Iitness Events Signature Timestamp IotarI Events Signature Timestamp Envelope SummarI Events Status Timestamps Envelope Sent Hashed/Encrypted 10/12/2020 6:23:22 PM Certified Delivered Security Checked 11/11/2020 1:29:30 PM Signing Complete Security Checked 11/11/2020 1:29:53 PM Completed Security Checked 11/11/2020 1:29:58 PM IaIment Events Status Timestamps Electronic Record and Signature Disclosure 491 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. #!  !#$! " "$!!#       !#"!# ! !!& %&  " " 492 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 493 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 494 Docusign Transmittal Coversheet File Name Purchasing Contact Contract Expiration DocuSign Envelope ID: 149AA27A-FBC3-482A-88B2-617F9CC7C7E1 Cori Power N/A 7452 - DDSC Parking Lot Improvements CO#1 495 Contractor:MSB Constructor, INC. 103 Oak Grove Lane Boyd, TX. 76203 David Stansfield CHANGE ORDER NO.1 7452 PO #:195214 880005 Date Prepared:2/10/21 Contract BID Amount:899,966.00$ 5% Contingency Amount:44,998.30$ Prior Approved CAA's:-$ Available Contingency:44,998.30$ 32,756.49$ 20 Contingency Remaining:12,241.81$ 206 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price EA -$ -$ -$ -$ -$ -$ -$ $0.00 LS 1 1 32,756.49$ 32,756.49$ -$ -$ -$ -$ $32,756.49 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price 3 -$ 30 -$ $0.00 -$ -$ -$ -$ $0.00 $32,756.49 899,966.00$ DDSC Parking Lot Improvements $32,756.49 $932,722.49 3.640% Original BID/Contract Amount: Contingency funds are used at City's discretion per contract spec language OTHER FUNDING NEW ITEMS OTHER FUNDED CONTRACT CHANGES (CO) QUANTITY CHANGES TO EXISTING ITEMS NEW ITEMS OF WORK TOTAL OTHER FUNDED QTY CHANGES: Description of work TOTAL CAA NEW ITEMS: Revised Contract Amount: Percent Changes: Description of work included in Contract: Work includes reconstruction of the DDSC parking lot. It also includes drainage, irrigation, and landscaping upgrades. Project: IFB# CIP/ENG# This CAA Request: PROJECT SCOPE AND REASON FOR CHANGE New Contract Days: Total Change Request:32,756.49$ New Completion:6/19/2021 CITY OF DENTON CHANGE ORDER FORM City of Denton - Capital Projects 901-A Texas Street Denton, TX 76209 944,964.30$ -$ Days +/- by: Trevor Crain, Project Manager Extra site Demolition Reason for change: Additional site demolition: During site excavation, unforseen buried structures were found. These structures had to be removed in order to treat subgrade and install electrical and irrigation lines. CONTINGENCY ALLOWANCE AUTHORIZED (CAA) CONTRACT CHANGES QUANTITY CHANGES TO EXISTING ITEMS TOTAL CAA QTY CHANGES: NEW ITEMS OF WORK Description of work DDSC Parking Lot Improvements TOTAL OTHER FUNDED NEW ITEMS: TOTAL CO AMOUNT: Total CAA's & CO's: NO QTY CHANGES TO EXISTING CONTRACT ITEMS Prior Approved Other Funded CO's:-$ Current Contract Amount w CO's: This CO Other Funding Request: Current Completion:5/30/2021 DocuSign Envelope ID: 149AA27A-FBC3-482A-88B2-617F9CC7C7E1 496 Signatory Lines will be updated by Purchasing if required SUBMITTED BY:_______________________________ ACCEPTED BY CITY ENGINEER/DIRECTOR OF CAPITAL PROJECTS _______________________________ ACCEPTED BY CONTRACTOR: _______________________________________________________________ Name, Title PURCHASING:_______________________________ IS SUBJECT TO ALL CONTRACT STIPULATIONS AND COVENANTS. Signature Signature Signature THE AFOREMENTIONED CHANGE, AND WORK AFFECTED THEREBY, Project Manager Contractor Name Project Name - Phase CO#1 22,597.18 DocuSign Envelope ID: 149AA27A-FBC3-482A-88B2-617F9CC7C7E1 PresidentMark Berry 497 Project:DDSC Parking Lot Improvements Customer:City of Denton 901-A Texas Street, Date: 2/2/2021 Denton, TX 76209 Attn:Trevor Crain, PMP City of Denton - Capitol Projects Contract No: 7452 This proposal contains an itemized quotation for changes in the Contract Sum and/or Contract Time in response to proposed modifications to the Contract Documents based on existing unforseen conditions or quantity differences found. Item Total 1 Additional site demo encountered as excavation and demo work started, as follows:29,024.00$ Approx. 954 SF of 11" Thick Gradebeams Approx. 133 SF of 16" Thick Gradebeams Approx. 585 SF of 12-14" Thick Gradebeams (18) Existing Concrete Piers - to be cut down to depth needed to be out of the way Extra digging for discovery/investigation of items and moving dirt/materials around site. Price includes cutting, hammering, equipment, fuel, labor, hauling off of materials, & dump fees. Sub-total 29,024.00$ Insurance 348.29$ Bond 406.34$ Sub-total 29,778.63$ 10% Mark up 2,977.86$ Total 32,756.49$ Does Proposed Change involve a change in Contract Sum?[ ] No [x] Yes 32,756.49$ Does Proposed Change involve a change in Contract Time?[ ] No [x] Yes Days 20 MSB Constructors, Inc.City of Denton, Texas CONTRACTOR OWNER 103 Oak Grove Lane,901-A Texas Street, Boyd, Texas 76023 Denton, TX 76209 By:David Stanfield By: Signature:David Stanfield Signature: Date:2/2/2021 Date: Description Additional Demo Scope Items [Increase / Decrease] [Increase / Decrease] Change Order Request #1 DocuSign Envelope ID: 149AA27A-FBC3-482A-88B2-617F9CC7C7E1 498 CONFLICT OF INTEREST QUESTIONNAIRE - FORM CIQ For vendor or other person doing business with local governmental entity This questionnaire reflects changes made to the law by H.B. 23, 84th Leg., Regular Session. This questionnaire is being filed in accordance with Chapter 176, Local Government Code, by a vendor who has a business relationship as defined by Section 176.001(1-a) with a local governmental entity and the vendor meets requirements under Section 176.006(a). By law this questionnaire must be filed with the records administrator of the local government entity not later than the 7th business day after the date the vendor becomes aware of facts that require the statement to be filed. See Section 176.006(a-1), Local Government Code. A vendor commits an offense if the vendor knowingly violates Section 176.006, Local Government Code. An offense under this section is a misdemeanor. 1 Name of vendor who has a business relationship with local governmental entity. 2 Check this box if you are filing an update to a previously filed questionnaire. (The law requires that you file an updated completed questionnaire with the appropriate filing authority not later than the 7th business day after the date on which you became aware that the originally filed questionnaire was incomplete or inaccurate.) 3 Name of local government officer about whom the information in this section is being disclosed. Name of Officer This section, (item 3 including subparts A, B, C & D), must be completed for each officer with whom the vendor has an employment or other business relationship as defined by Section 176.001(1-a), Local Government Code. Attach additional pages to this Form CIQ as necessary. A. Is the local government officer named in this section receiving or likely to receive taxable income, other than investment income, from the vendor? Yes No B. Is the vendor receiving or likely to receive taxable income, other than investment income, from or at the direction of the local government officer named in this section AND the taxable income is not received from the local governmental entity? Yes No C. Is the filer of this questionnaire employed by a corporation or other business entity with respect to which the local government officer serves as an officer or director, or holds an ownership of one percent or more? Yes No D. Describe each employment or business and family relationship with the local government officer named in this section. 4 I have no Conflict of Interest to disclose. 5 Signature of vendor doing business with the governmental entity Date DocuSign Envelope ID: 149AA27A-FBC3-482A-88B2-617F9CC7C7E1 MSB Constructor, Inc. 3/5/2021 499 Certificate Of Completion Envelope Id: 149AA27AFBC3482A88B2617F9CC7C7E1 Status: Completed Subject: ***Purchasing Approval*** 7452 DDSC Parking Lot Improvements - Change Order #1 Source Envelope: Document Pages: 5 Signatures: 5 Envelope Originator: Certificate Pages: 6 Initials: 1 Cori Power AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 cori.power@cityofdenton.com IP Address: 198.49.140.104 Record Tracking Status: Original 3/4/2021 6:38:58 PM Holder: Cori Power cori.power@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.104 Sent: 3/4/2021 6:41:09 PM Viewed: 3/4/2021 6:41:16 PM Signed: 3/4/2021 6:43:29 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 3/4/2021 6:43:30 PM Viewed: 3/4/2021 7:03:11 PM Signed: 3/4/2021 7:04:44 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Signature Adoption: Drawn on Device Using IP Address: 70.237.27.78 Signed using mobile Sent: 3/4/2021 7:04:46 PM Viewed: 3/4/2021 7:37:42 PM Signed: 3/4/2021 7:37:59 PM Electronic Record and Signature Disclosure: Accepted: 3/4/2021 7:37:42 PM ID: 0ee2eca1-f91f-437e-a27d-8a4c40dc5261 Mark Berry mark@msbconstructorsinc.com President Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 107.178.5.74 Signed using mobile Sent: 3/4/2021 7:38:00 PM Viewed: 3/5/2021 6:56:00 AM Signed: 3/5/2021 6:56:12 AM Electronic Record and Signature Disclosure: Accepted: 3/5/2021 6:56:00 AM ID: f4fdcdff-96b3-4db2-a6dd-fec945c4ec88 500 Signer Events Signature Timestamp Rebecca Diviney Rebecca.Diviney@cityofdenton.com Director of Capital Projects/City Engineer Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 47.222.28.222 Sent: 3/5/2021 6:56:15 AM Viewed: 3/8/2021 9:57:54 AM Signed: 3/8/2021 9:59:27 AM Electronic Record and Signature Disclosure: Accepted: 3/8/2021 9:57:54 AM ID: 2be0d419-b0ea-4677-abb8-61398768d958 Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 3/8/2021 9:59:29 AM Viewed: 3/8/2021 10:08:55 AM Signed: 3/8/2021 10:09:00 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 3/8/2021 10:09:02 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 3/8/2021 10:09:02 AM Electronic Record and Signature Disclosure: Accepted: 3/4/2021 7:37:42 PM ID: 0ee2eca1-f91f-437e-a27d-8a4c40dc5261 Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 3/4/2021 6:41:09 PM Certified Delivered Security Checked 3/8/2021 10:08:55 AM Signing Complete Security Checked 3/8/2021 10:09:00 AM Completed Security Checked 3/8/2021 10:09:02 AM 501 Payment Events Status Timestamps Electronic Record and Signature Disclosure 502 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. Electronic Record and Signature Disclosure created on: 7/21/2017 3:59:03 PM Parties agreed to: Trevor Crain, Mark Berry, Rebecca Diviney, Trevor Crain 503 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 504 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 505 Docusign Transmittal Coversheet File Name Purchasing Contact Contract Expiration DocuSign Envelope ID: 05BB6E7B-9EDF-4AEE-A29C-03C69EC8CB83 N/A Cori Power 7454 - DDSC Parking Lot Improvements CO#2 506 Contractor:MSB Constructor, INC. 103 Oak Grove Lane Boyd, TX. 76203 David Stansfield CHANGE ORDER NO.2 7452 PO #:195214 NTP Date:12/7/2020 Project Complete Date: 6/30/2021 880005 Date Prepared:3/9/21 Contract BID Amount:899,966.00$ 5% Contingency Amount:44,998.30$ Prior Approved CAA's:32,756.49$ Available Contingency:12,241.81$ 12,241.81$ 5 Contingency Remaining:-$ 205 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price 8 02 41 15 sy 7,365 2,448 5.00$ 12,241.81$ -$ -$ $12,241.81 -$ $0.00 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price 12 02 41 15 sy 7,512 1,713 3.50$ 5,995.50$ 8 02 41 15 sy 7,512 287.64 5.00$ 1,438.19$ $7,433.69 ls 1 40,432.10$ 40,432.10$ -$ -$ $40,432.10 $60,107.60 899,966.00$ DDSC Parking Lot Improvements $92,864.09 $992,830.09 10.319% Revised Contract Amount: Percent Changes: Total CAA's & CO's: Project: IFB# CIP/ENG# This CAA Request: PROJECT SCOPE AND REASON FOR CHANGE New Contract Days: Total Change Request:60,107.60$ Approved CO Days: 20 944,964.30$ This CO Other Funding Request: Original Contract Days:180 47,865.79$ This CO Days Request: CITY OF DENTON CHANGE ORDER FORM City of Denton - Capital Projects 901-A Texas Street Denton, TX 76209 Trevor Crain, Project Manager Reason for change: Additional site demolition, excavation and dirt work: During site excavation, unsuitable subgrade was discovered. This material had to be removed and suitable material brought it. Overrun in asphalt and concrete removal item. CONTINGENCY ALLOWANCE AUTHORIZED (CAA) CONTRACT CHANGES QUANTITY CHANGES TO EXISTING ITEMS TOTAL CAA QTY CHANGES: NEW ITEMS OF WORK Description of work DDSC Parking Lot Improvements Prior Approved Other Funded CO's:-$ Current Contract Amount w CO's: Description of work included in Contract: Work includes reconstruction of the DDSC parking lot. It also includes drainage, irrigation, and landscaping upgrades. Remove Concrete Pavement Remove Concrete Pavement Description of work remove asphalt Pavement Original BID/Contract Amount: Contingency funds are used at City's discretion per contract spec language Extra site Excavation and Earthwork OTHER FUNDED CONTRACT CHANGES (CO) QUANTITY CHANGES TO EXISTING ITEMS NEW ITEMS OF WORK TOTAL OTHER FUNDED QTY CHANGES: TOTAL CAA NEW ITEMS: TOTAL OTHER FUNDED NEW ITEMS: TOTAL CO AMOUNT: DocuSign Envelope ID: 05BB6E7B-9EDF-4AEE-A29C-03C69EC8CB83 507 Signatory Lines will be updated by Purchasing if required SUBMITTED BY:_______________________________ ACCEPTED BY CITY ENGINEER/DIRECTOR OF CAPITAL PROJECTS _______________________________ ACCEPTED BY CONTRACTOR: ____________________________________________________________ Title PURCHASING:_______________________________ IS SUBJECT TO ALL CONTRACT STIPULATIONS AND COVENANTS. Signature Signature Signature THE AFOREMENTIONED CHANGE, AND WORK AFFECTED THEREBY, Project Manager DocuSign Envelope ID: 05BB6E7B-9EDF-4AEE-A29C-03C69EC8CB83 President 508 Project:DDSC Parking Lot Improvements Customer:City of Denton 901-A Texas Street, Date: 2/2/2021 Denton, TX 76209 Attn:Trevor Crain, PMP City of Denton - Capitol Projects Contract No: 7452 This proposal contains an itemized quotation for changes in the Contract Sum and/or Contract Time in response to proposed modifications to the Contract Documents based on existing unforseen conditions or quantity differences found. Item Total 1 Extra Excavation/Earthwork scope due to discovered unusable materials at subgrade.35,825.00$ Remove unusable fill material from designated area (approx. 110 LF x 174 LF x 12" deep) Load and haul away materials, including dump fees. Purchase and haul in new replacement common fill material and properly compact in lifts. Move stockpiled materials on site (from extra demo) and spread/compact back on site as needed. Price includes machinery, labor/operator costs, materials, trucking fees, and dump fees. Sub-total 35,825.00$ Insurance 429.90$ Bond 501.55$ Sub-total 36,756.45$ 10% Mark up 3,675.65$ Total 40,432.10$ Does Proposed Change involve a change in Contract Sum?[ ] No [x] Yes 40,432.10$ Does Proposed Change involve a change in Contract Time?[ ] No [x] Yes Days 5 MSB Constructors, Inc.City of Denton, Texas CONTRACTOR OWNER 103 Oak Grove Lane,901-A Texas Street, Boyd, Texas 76023 Denton, TX 76209 By:David Stanfield By: Signature:David Stanfield Signature: Date:2/2/2021 Date: Description [Increase / Decrease] [Increase / Decrease] Change Order Request #2 Additional Earthwork Scope Items Attachment A DocuSign Envelope ID: 05BB6E7B-9EDF-4AEE-A29C-03C69EC8CB83 Cori Power 5/6/2021 509 Certificate Of Completion Envelope Id: 05BB6E7B9EDF4AEEA29C03C69EC8CB83 Status: Completed Subject: ***Purchasing Approval*** 7452- Daybreak Parking Lot CO#2 Source Envelope: Document Pages: 4 Signatures: 5 Envelope Originator: Certificate Pages: 6 Initials: 1 Cori Power AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 cori.power@cityofdenton.com IP Address: 198.49.140.104 Record Tracking Status: Original 5/4/2021 4:18:53 PM Holder: Cori Power cori.power@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.104 Sent: 5/5/2021 8:23:15 AM Viewed: 5/5/2021 8:24:45 AM Signed: 5/5/2021 8:25:23 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 5/5/2021 8:25:25 AM Viewed: 5/5/2021 9:28:37 AM Signed: 5/5/2021 9:28:53 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 5/5/2021 9:28:54 AM Viewed: 5/5/2021 9:36:48 AM Signed: 5/5/2021 9:37:02 AM Electronic Record and Signature Disclosure: Accepted: 5/5/2021 9:36:48 AM ID: 9c2e38f9-41fa-414d-90c6-7525f2ba5256 Mark Berry mark@msbconstructorsinc.com President Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 107.178.5.74 Sent: 5/5/2021 9:28:55 AM Viewed: 5/5/2021 9:30:31 AM Signed: 5/5/2021 9:31:28 AM Electronic Record and Signature Disclosure: Accepted: 5/5/2021 9:30:31 AM ID: cf5fbcc9-480f-43f2-a015-ca6f1b96c956 510 Signer Events Signature Timestamp Rebecca Diviney Rebecca.Diviney@cityofdenton.com Director of Capital Projects/City Engineer Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 5/5/2021 9:37:04 AM Viewed: 5/6/2021 10:29:27 AM Signed: 5/6/2021 10:29:41 AM Electronic Record and Signature Disclosure: Accepted: 5/6/2021 10:29:27 AM ID: 11c86a89-71c7-4682-ae1d-44350b1b6c75 Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 5/6/2021 10:29:42 AM Viewed: 5/6/2021 10:45:28 AM Signed: 5/6/2021 10:45:38 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 5/6/2021 10:45:41 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Sent: 5/6/2021 10:45:41 AM Electronic Record and Signature Disclosure: Accepted: 5/5/2021 9:36:48 AM ID: 9c2e38f9-41fa-414d-90c6-7525f2ba5256 Tracy Holt Tracy.Holt@cityofdenton.com Administrative Assistant City of Denton Security Level: Email, Account Authentication (None) Sent: 5/6/2021 10:45:43 AM Viewed: 5/6/2021 11:03:21 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp 511 Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 5/5/2021 8:23:16 AM Certified Delivered Security Checked 5/6/2021 10:45:28 AM Signing Complete Security Checked 5/6/2021 10:45:38 AM Completed Security Checked 5/6/2021 10:45:43 AM Payment Events Status Timestamps Electronic Record and Signature Disclosure 512 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. Electronic Record and Signature Disclosure created on: 7/21/2017 3:59:03 PM Parties agreed to: Trevor Crain, Mark Berry, Rebecca Diviney, Trevor Crain 513 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 514 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 515 ORDINANCE NO. __________ AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORIZING THE APPROVAL OF CHANGE ORDER NO. 3 TO THE CONTRACT BETWEEN THE CITY OF DENTON AND MSB CONSTRUCTORS, INC., TO PROVIDE ADDITIONAL SERVICES FOR THE DEVELOPMENT SERVICES CENTER PARKING LOT IMPROVEMENTS PROJECT; PROVIDING FOR THE EXPENDITURE OF FUNDS THEREFOR; AND PROVIDING AN EFFECTIVE DATE (FILE 7452 – CHANGE ORDER NO. 3 IN THE NOT-TO-EXCEED AMOUNT OF $45,395.74, FOR A TOTAL CONTRACT AWARD AGGREGATED TO $1,038,225.83). WHEREAS, on November 10, 2020, by Ordinance No. 20-2223, the City Council awarded a contract to MSB Constructors, Inc., in the amount of $944,964.30, for the construction of the Denton Development Services Parking Lot Improvements Project for the City of Denton; and WHEREAS, on March 8, 2021, Purchasing awarded a Change Order No. 1 between the City of Denton and MSB Constructors, Inc., using contingency funds in the amount of $32,756.49; and WHEREAS, on May 6, 2021, Purchasing awarded Change Order No. 2 between the City of Denton and MSB Constructors, Inc., using contingency 12,241.81 and additional fund in the amount of $47,865.79; and WHEREAS, the Staff having recommended, and the City Manager having recommended to the Council that a change order be authorized to amend such contract agreement with respect to the scope of work and an increase in the payment amount; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. Change Order No. 3, increasing the amount of the contract between the City and MSB Constructors, Inc., which is on file in the office of the Purchasing Agent, in the amount of Forty-Five Thousand Three Hundred Ninety-Five and 74/100 ($45,395.74) dollars, is hereby approved, and the expenditure of funds therefore is hereby authorized in accordance with said change order which shall be attached hereto. The total purchase order amount increases to $1,038,225.83. SECTION 2. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. This ordinance was passed and approved by the following vote [___ - ___]: 516 517 Docusign City Council Transmittal Coversheet File Name Purchasing Contact City Council Target Date Piggy Back Option Contract Expiration Ordinance DocuSign Envelope ID: F15070D9-7CD7-4C89-A501-29EBC9D50223 IFB 7452 DDSC Parking Lot Improvements CO#3 Not Applicable Cori Power 518 Contractor:MSB Constructor, INC. 103 Oak Grove Lane Boyd, TX. 76203 David Stansfield CHANGE ORDER NO.3 7452 PO #:195214 12/7/2020 7/30/2021 880005 Date Prepared:6/10/21 Contract BID Amount:899,966.00$ 5% Contingency Amount:44,998.30$ 944,964.30$ Prior Approved CAA's:44,998.30$ Available Contingency:-$ -$ 30 Contingency Remaining:-$ 235 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price -$ -$ $0.00 -$ -$ -$ -$ $0.00 Item No.Spec. Section No.UOM BID QTY +/- QTY Unit Price Extended Price -$ -$ $0.00 1 LS 1 1 16,571.24$ 16,571.24$ 2 Electrical and Illumination Scope Change LS 1 1 11,597.22$ 11,597.22$ 3 LS 1 1 17,227.28$ 17,227.28$ $45,395.74 $45,395.74 899,966.00$ 944,964.30$ DDSC Parking Lot Improvement $44,998.30 $93,261.53 $1,038,225.83 100.00% 15.36% 9.869% This Change order is comprised of multiple scope changes. These scope changes include demolition and repair of exterior stairwell, electrical and illumination changes and pavement marking changes. CONTINGENCY ALLOWANCE AUTHORIZED (CAA) CONTRACT CHANGES QUANTITY CHANGES TO EXISTING ITEMS TOTAL CAA QTY CHANGES: Amount CAA approved to Date : TOTAL OTHER FUNDED NEW ITEMS: TOTAL CO AMOUNT: Total CAA's : Total Not to Exceed Amount : Revised Contract Amount: Total CO's : TOTAL CAA NEW ITEMS: QUANTITY CHANGES TO EXISTING ITEMS NEW ITEMS OF WORK TOTAL OTHER FUNDED QTY CHANGES: Description of work Project: IFB# CIP/ENG# This CAA Request: 992,830.09$ 45,395.74$ This CO Days Request: Trevor Crain, Project Manager DDSC Parking Lot Improvement Prior Approved Other Funded CO's:47,865.79$ Current NTE Contract Amount w CO's: CITY OF DENTON CHANGE ORDER FORM City of Denton - Capital Projects 901-A Texas Street Denton, TX 76209 Percent Changes over NTE: Work includes reconstruction of the DDSC parking lot. It also includes drainage, irrigation, and landscaping upgrades. Original BID/Contract Amount: Contingency funds are used at City's discretion per contract spec language Concrete Stairwell Scope Change Total Change Order over original Bid: Electrical, markings, and asphalt scope change OTHER FUNDED CONTRACT CHANGES (CO) NEW ITEMS OF WORK Description of work Description of work included in Contract: Reason for change: PROJECT SCOPE AND REASON FOR CHANGE New Contract Days: Total Change Request:45,395.74$ Approved CO Days:25 180 This CO Other Funding Request: NTP Date:Project Complete Date: Total NTE Amount : Original Contract Days: DocuSign Envelope ID: F15070D9-7CD7-4C89-A501-29EBC9D50223 519 Signatory Lines will be updated by Purchasing if required SUBMITTED BY:_______________________________ ACCEPTED BY CITY ENGINEER/DIRECTOR OF CAPITAL PROJECTS _______________________________ ACCEPTED BY CONTRACTOR: ____________________________________________________________ Name, Title CITY MANAGER:_______________________________ ATTEST: CITY SECRETERY _______________________________ PURCHASING:_______________________________ APPROVED AS TO LEGAL FORM:_______________________________ THE AFOREMENTIONED CHANGE, AND WORK AFFECTED THEREBY, Project Manager Signature IS SUBJECT TO ALL CONTRACT STIPULATIONS AND COVENANTS. Signature Signature Signature Signature Signature Contractor Name Project Name - Phase CO#3 $45,395.74 DocuSign Envelope ID: F15070D9-7CD7-4C89-A501-29EBC9D50223 Mark Berry President 520 Certificate Of Completion Envelope Id: F15070D97CD74C89A50129EBC9D50223 Status: Sent Subject: Please DocuSign: City Council Contract 7452 DDSC Parking Lot Improvements - CO#3 Source Envelope: Document Pages: 3 Signatures: 5 Envelope Originator: Certificate Pages: 6 Initials: 1 Cori Power AutoNav: Enabled EnvelopeId Stamping: Enabled Time Zone: (UTC-06:00) Central Time (US & Canada) 901B Texas Street Denton, TX 76209 cori.power@cityofdenton.com IP Address: 198.49.140.104 Record Tracking Status: Original 7/21/2021 10:13:41 AM Holder: Cori Power cori.power@cityofdenton.com Location: DocuSign Signer Events Signature Timestamp Cori Power cori.power@cityofdenton.com Senior Buyer City of Denton Security Level: Email, Account Authentication (None) Completed Using IP Address: 198.49.140.104 Sent: 7/21/2021 10:15:05 AM Viewed: 7/21/2021 10:15:20 AM Signed: 7/21/2021 10:15:54 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Lori Hewell lori.hewell@cityofdenton.com Purchasing Manager City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.104 Sent: 7/21/2021 10:15:56 AM Viewed: 7/21/2021 10:16:47 AM Signed: 7/21/2021 10:17:01 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Marcella Lunn marcella.lunn@cityofdenton.com Deputy City Attorney City of Denton Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 68.185.202.16 Sent: 7/21/2021 10:17:05 AM Viewed: 7/21/2021 10:17:39 AM Signed: 7/21/2021 10:18:11 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Trevor Crain Trevor.Crain@cityofdenton.com Security Level: Email, Account Authentication (None) Signature Adoption: Pre-selected Style Using IP Address: 198.49.140.10 Sent: 7/21/2021 10:18:13 AM Viewed: 7/21/2021 10:18:34 AM Signed: 7/21/2021 10:18:44 AM Electronic Record and Signature Disclosure: Accepted: 7/21/2021 10:18:34 AM ID: fd477d2f-0398-49b7-9c3a-488d90c911a0 521 Signer Events Signature Timestamp Mark Berry mark@msbconstructorsinc.com President Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 107.178.5.74 Sent: 7/21/2021 10:18:47 AM Viewed: 7/21/2021 10:22:40 AM Signed: 7/21/2021 10:22:54 AM Electronic Record and Signature Disclosure: Accepted: 7/21/2021 10:22:40 AM ID: 756d7f90-1aa2-4c42-8b15-fdb3a0733283 Rebecca Diviney Rebecca.Diviney@cityofdenton.com Director of Capital Projects/City Engineer Security Level: Email, Account Authentication (None)Signature Adoption: Pre-selected Style Using IP Address: 47.190.47.120 Signed using mobile Sent: 7/21/2021 10:18:47 AM Viewed: 7/21/2021 11:26:14 AM Signed: 7/21/2021 11:26:31 AM Electronic Record and Signature Disclosure: Accepted: 7/21/2021 11:26:13 AM ID: cdfa88b6-5ccd-4574-8b16-e9847d22aed7 Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/21/2021 11:26:34 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Sara Hensley sara.hensley@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Rosa Rios rosa.rios@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Accepted: 7/21/2021 12:47:30 PM ID: 54501930-1a4f-4139-a835-9f665ceae165 In Person Signer Events Signature Timestamp Editor Delivery Events Status Timestamp Agent Delivery Events Status Timestamp Intermediary Delivery Events Status Timestamp Certified Delivery Events Status Timestamp Carbon Copy Events Status Timestamp 522 Carbon Copy Events Status Timestamp Cheyenne Defee cheyenne.defee@cityofdenton.com Contract Administrator City of Denton Security Level: Email, Account Authentication (None) Sent: 7/21/2021 10:15:56 AM Electronic Record and Signature Disclosure: Not Offered via DocuSign Gretna Jones gretna.jones@cityofdenton.com Legal Secretary City of Denton Security Level: Email, Account Authentication (None) Sent: 7/21/2021 11:26:33 AM Viewed: 7/21/2021 12:48:09 PM Electronic Record and Signature Disclosure: Not Offered via DocuSign City Secretary Office citysecretary@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Carol Roberts Carol.Roberts@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Cheyenne Defee cheyenne.defee@cityofdenton.com Security Level: Email, Account Authentication (None) Electronic Record and Signature Disclosure: Not Offered via DocuSign Witness Events Signature Timestamp Notary Events Signature Timestamp Envelope Summary Events Status Timestamps Envelope Sent Hashed/Encrypted 7/21/2021 10:15:05 AM Payment Events Status Timestamps Electronic Record and Signature Disclosure 523 ELECTRONIC RECORD AND SIGNATURE DISCLOSURE From time to time, City of Denton (we, us or Company) may be required by law to provide to you certain written notices or disclosures. Described below are the terms and conditions for providing to you such notices and disclosures electronically through your DocuSign, Inc. (DocuSign) Express user account. Please read the information below carefully and thoroughly, and if you can access this information electronically to your satisfaction and agree to these terms and conditions, please confirm your agreement by clicking the 'I agree' button at the bottom of this document. Getting paper copies At any time, you may request from us a paper copy of any record provided or made available electronically to you by us. For such copies, as long as you are an authorized user of the DocuSign system you will have the ability to download and print any documents we send to you through your DocuSign user account for a limited period of time (usually 30 days) after such documents are first sent to you. After such time, if you wish for us to send you paper copies of any such documents from our office to you, you will be charged a $0.00 per-page fee. You may request delivery of such paper copies from us by following the procedure described below. Withdrawing your consent If you decide to receive notices and disclosures from us electronically, you may at any time change your mind and tell us that thereafter you want to receive required notices and disclosures only in paper format. How you must inform us of your decision to receive future notices and disclosure in paper format and withdraw your consent to receive notices and disclosures electronically is described below. Consequences of changing your mind If you elect to receive required notices and disclosures only in paper format, it will slow the speed at which we can complete certain steps in transactions with you and delivering services to you because we will need first to send the required notices or disclosures to you in paper format, and then wait until we receive back from you your acknowledgment of your receipt of such paper notices or disclosures. To indicate to us that you are changing your mind, you must withdraw your consent using the DocuSign 'Withdraw Consent' form on the signing page of your DocuSign account. This will indicate to us that you have withdrawn your consent to receive required notices and disclosures electronically from us and you will no longer be able to use your DocuSign Express user account to receive required notices and consents electronically from us or to sign electronically documents from us. All notices and disclosures will be sent to you electronically Unless you tell us otherwise in accordance with the procedures described herein, we will provide electronically to you through your DocuSign user account all required notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to you during the course of our relationship with you. To reduce the chance of you inadvertently not receiving any notice or disclosure, we prefer to provide all of the required notices and disclosures to you by the same method and to the same address that you have given us. Thus, you can receive all the disclosures and notices electronically or in paper format through the paper mail delivery system. If you do not agree with this process, please let us know as described below. Please also see the paragraph immediately above that describes the consequences of your electing not to receive delivery of the notices and disclosures electronically from us. Electronic Record and Signature Disclosure created on: 7/21/2017 3:59:03 PM Parties agreed to: Trevor Crain, Mark Berry, Rebecca Diviney, Rosa Rios 524 How to contact City of Denton: You may contact us to let us know of your changes as to how we may contact you electronically, to request paper copies of certain information from us, and to withdraw your prior consent to receive notices and disclosures electronically as follows: To contact us by email send messages to: purchasing@cityofdenton.com To advise City of Denton of your new e-mail address To let us know of a change in your e-mail address where we should send notices and disclosures electronically to you, you must send an email message to us at melissa.kraft@cityofdenton.com and in the body of such request you must state: your previous e-mail address, your new e-mail address. We do not require any other information from you to change your email address.. In addition, you must notify DocuSign, Inc to arrange for your new email address to be reflected in your DocuSign account by following the process for changing e-mail in DocuSign. To request paper copies from City of Denton To request delivery from us of paper copies of the notices and disclosures previously provided by us to you electronically, you must send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail address, full name, US Postal address, and telephone number. We will bill you for any fees at that time, if any. To withdraw your consent with City of Denton To inform us that you no longer want to receive future notices and disclosures in electronic format you may: i. decline to sign a document from within your DocuSign account, and on the subsequent page, select the check-box indicating you wish to withdraw your consent, or you may; ii. send us an e-mail to purchasing@cityofdenton.com and in the body of such request you must state your e-mail, full name, IS Postal Address, telephone number, and account number. We do not need any other information from you to withdraw consent.. The consequences of your withdrawing consent for online documents will be that transactions may take a longer time to process.. Required hardware and software Operating Systems: Windows2000? or WindowsXP? Browsers (for SENDERS): Internet Explorer 6.0? or above Browsers (for SIGNERS): Internet Explorer 6.0?, Mozilla FireFox 1.0, NetScape 7.2 (or above) Email: Access to a valid email account Screen Resolution: 800 x 600 minimum Enabled Security Settings: •Allow per session cookies •Users accessing the internet behind a Proxy Server must enable HTTP 1.1 settings via proxy connection ** These minimum requirements are subject to change. If these requirements change, we will provide you with an email message at the email address we have on file for you at that time providing you with the revised hardware and software requirements, at which time you will have the right to withdraw your consent. 525 Acknowledging your access and consent to receive materials electronically To confirm to us that you can access this information electronically, which will be similar to other electronic notices and disclosures that we will provide to you, please verify that you were able to read this electronic disclosure and that you also were able to print on paper or electronically save this page for your future reference and access or that you were able to e-mail this disclosure and consent to an address where you will be able to print on paper or save it for your future reference and access. Further, if you consent to receiving notices and disclosures exclusively in electronic format on the terms and conditions described above, please let us know by clicking the 'I agree' button below. By checking the 'I Agree' box, I confirm that: • I can access and read this Electronic CONSENT TO ELECTRONIC RECEIPT OF ELECTRONIC RECORD AND SIGNATURE DISCLOSURES document; and • I can print on paper the disclosure or save or send the disclosure to a place where I can print it, for future reference and access; and • Until or unless I notify City of Denton as described above, I consent to receive from exclusively through electronic means all notices, disclosures, authorizations, acknowledgements, and other documents that are required to be provided or made available to me by City of Denton during the course of my relationship with you. 526 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1406,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a First Amendment to Solid Waste Disposal Contract with Frontier Access, LLC; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™527 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Solid Waste and Recycling ACM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a First Amendment to Solid Waste Disposal Contract with Frontier Access, LLC; and providing an effective date. BACKGROUND On October 19, 2019, the City of Denton Solid Waste and Recycling Department entered into a Wholesale Disposal Agreement with Frontier Access, LLC to deliver guaranteed volume to the City of Denton Landfill in exchange for preferred rates. As part of this agreement, the City is required to maintain access to the working face during the landfill’s posted hours. Throughout the end of CY2019 and the beginning of CY2020 significant rain events in Denton resulted in a slowing of landfill traffic to the point of a several hours delay to dump collected material, significantly impacting Frontier’s ability to service their customers in a timely manner. As a result, Frontier found itself unable to deliver its entire commitment to the City of Denton Landfill in Year 1. Based on an evaluation of average delivery and days of significant operational impacts, Frontier and the City concur that 1,839.82 tons of waste were affected and undeliverable to the Denton Landfill. A request has been made to move 1,839.82 tons of the volume commitment, and associated costs, in Year 1 to the Year 2 delivery commitment. There is no change to the net tonnage delivered or fees collected of the life of the contract. RECOMMENDATION EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Ordinance and Contract Exhibit 3: Frontier Access LLC Respectfully submitted: Brian Boerner, 940-349-8001 Solid Waste Director City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 528 Page 1 ORDINANCE NO. ___________ AN ORDINANCE OF THE CITY OF DENTON, A TEXAS HOME-RULE MUNICIPAL CORPORATION, AUTHORIZING THE CITY MANAGER TO EXECUTE A FIRST AMENDMENT TO SOLID WASTE DISPOSAL CONTRACT WITH FRONTIER ACCESS, LLC.; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Council entered into a contract with Frontier Access, LLC. (“Contractor”) for the delivery of predictable tonnages of solid waste to the City of Denton Landfill for both revenue and management purposes; and WHEREAS, the Contractor did not meet the obligation for the first contract year of the term due to landfill accessibility, and wishes to transfer the additional amount to the current contract year; and WHEREAS, the City of Denton has determined that this First Amendment to the Solid Waste Disposal Contract is in the public interest; NOW THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The findings and recitations contained in the preamble of this Ordinance are incorporated herein by reference. SECTION 2. The City Council of the City of Denton hereby approves the First Amendment attached hereto. SECTION 3. The City Manager, or designee, is hereby authorized to execute the contract and to carry out the duties and responsibilities of the City as provided in the Contract. SECTION 4. This Ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________, the ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ 529 PASSED AND APPROVED this the _________ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Digitally signed by Catherine Clifton DN: dc=com, dc=cityofdenton, dc=codad, ou=Department Users and Groups, ou=General Government, ou=Legal, cn=Catherine Clifton, email=Catherine.Clifton@cityofdenton.co m Date: 2021.07.13 22:25:57 -05'00' 530 531 Digitally signed by Catherine Clifton DN: dc=com, dc=cityofdenton, dc=codad, ou=Department Users and Groups, ou=General Government, ou=Legal, cn=Catherine Clifton, email=Catherine.Clifton@cityofdenton.com Date: 2021.07.13 22:26:29 -05'00' 532 533 534 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1446,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,Texas,authorizing the Interim City Manager,or her designee,to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas,Texas Department of Public Safety,authorizing the Denton Police Department to perform Uniform Commercial Vehicle Weight Inspections and Enforcement; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™535 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: POLICE CM/ DCM/ ACM: Frank Dixon, Interim Assistant City Manager DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, Texas, authorizing the Interim City Manager, or her designee, to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas, Texas Department of Public Safety, authorizing the Denton Police Department to perform Uniform Commercial Vehicle Weight Inspections and Enforcement; and providing an effective date. BACKGROUND Since 2006, the Denton Police Department has worked cooperatively with the Texas Department of Public Safety (DPS) on commercial motor vehicle safety enforcement. The goal of Commercial Vehicle Enforcement is to reduce commercial motor vehicle accidents, fatalities, and injuries through consistent, uniform, and effective CMV safety programs. The CMV program detects, corrects or temporarily puts out of service commercial vehicles that exhibit safety defects, driver deficiencies, and unsafe motor carrier practices before they become contributing factors to crashes and a hazard to the citizens of Denton. DPS provides training, testing and certification of officers within the Traffic Section of the police department who are assigned to commercial motor vehicle enforcement activities. These officers may conduct random, in-person observation of weight enforcement inspections to ensure adherence to the Department of Public Safety certification standards. In order to perform enforcement activities under Chapter 621, the Police Department is required to enter a Memorandum of Understanding (MOU) with the Department of Public Safety that specifies the roles and obligations of each agency. This agreement must be renewed every two (2) years. The Department agrees to certification training of their officers, purchase the approved scales to meet State standards and provide the required annual reports on enforcement activities. RECOMMENDATION Staff recommends Council approve this ordinance. PRIOR ACTION/REVIEW (Council, Boards, Commissions) Council approved Ordinance 19-1916 on August 13, 2019. City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 536 FISCAL INFORMATION No cost to the City of Denton. EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Ordinance and MOU Respectfully submitted: Bobby Smith Assistant Chief of Police Prepared by: Robin Fox Senior Executive Assistant 537 ORDINANCE NO. _______________ AN ORDINANCE OF THE CITY OF DENTON, TEXAS, AUTHORIZING THE INTERIM CITY MANAGER, OR HER DESIGNEE, TO EXECUTE AN INTERLOCAL COOPERATION CONTRACT IN THE FORM OF A MEMORANDUM OF UNDERSTANDING WITH THE STATE OF TEXAS, TEXAS DEPARTMENT OF PUBLIC SAFETY, AUTHORIZING THE DENTON POLICE DEPARTMENT TO PERFORM UNIFORM COMMERCIAL VEHICLE WEIGHT INSPECTIONS AND ENFORCEMENT; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, pursuant to Texas Government Code Chapter 791, Interlocal Cooperation Contracts, the City wishes to establish through a Memorandum of Understanding (MOU) with the State of Texas, Texas Department of Public Safety, the parameters for the enforcement of state laws on uniform commercial vehicle weight enforcement within the Texas Transportation Code Chapter 621, Subchapter F; and WHEREAS, this MOU specifies responsibilities of the City and the Texas Department of Public Safety, including but not limited to approved state training, certification requirements, approved scale use, annual scale re-calibration, violation report requirements, and mandated reporting; and WHEREAS, the City believes that this MOU is in the best interests for the safety of the citizens of the City of Denton, and that a valid government purpose is served by said designation; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1: The findings and recitations contained in the preamble of this Ordinance are incorporated herein by reference. SECTION 2: The Interim City Manager, or her designee, is hereby authorized to execute the Memorandum of Understanding on behalf of the City of Denton with the State of Texas, Texas Department of Public Safety, authorizing the Denton Police Department to perform commercial motor vehicle inspections and enforcement, which is attached hereto as Exhibit “A,” made a part hereof by reference and is hereby approved. SECTION 3: That this Ordinance shall become effective immediately upon its passage and approval. The motion to approve this Ordinance was made by __________________________ and seconded by _________________________________; this Ordinance was passed and approved by the following vote [___ - ___]: 538 539 540 541 542 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1447,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton,Texas,authorizing the Interim City Manager,or her designee,to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas,Texas Department of Public Safety,establishing responsibilities,policies,and guidelines for the Denton Police Department to conduct Federal Safety Regulation Inspections;and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™543 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: POLICE CM/ DCM/ ACM: Frank Dixon, Interim Assistant City Manager DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton, Texas, authorizing the Interim City Manager, or her designee, to execute an Interlocal Cooperation Contract in the form of a Memorandum of Understanding with the State of Texas, Texas Department of Public Safety, establishing responsibilities, policies, and guidelines for the Denton Police Department to conduct Federal Safety Regulation Inspections; and providing an effective date. BACKGROUND Since 2006, the Denton Police Department has worked cooperatively with the Texas Department of Public Safety (DPS) on Commercial Motor Vehicle Safety Enforcement (CMV). The goal of CMV safety enforcement is to reduce commercial motor vehicle accidents, fatalities, and injuries through consistent, uniform, and effective CMV safety programs. The CMV program detects, corrects or temporarily puts out of service commercial vehicles that exhibit safety defects, driver deficiencies, and unsafe motor carrier practices before they become contributing factors to crashes and a hazard to the citizens of Denton. DPS provides training, testing and certification of officers within the Traffic Section of the police department who are assigned to commercial motor vehicle enforcement activities. These officers may conduct random, in-person observation of weight enforcement inspections to ensure adherence to the Department of Public Safety certification standards. In order to perform enforcement activities under Chapter 621, the Police Department is required to enter a Memorandum of Understanding (MOU) with the Department of Public Safety in order to ensure uniformity with state and federal enforcement guidelines. RECOMMENDATION Staff recommends Council approve this ordinance. PRIOR ACTION/REVIEW (Council, Boards, Commissions) Council approved Ordinance 19-1917 on August 13, 2019. FISCAL INFORMATION No cost to the City of Denton. City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 544 EXHIBITS Exhibit 1: Agenda Information Sheet Exhibit 2: Ordinance and MOU Respectfully submitted: Bobby Smith Assistant Chief of Police Prepared by: Robin Fox Senior Executive Assistant 545 ORDINANCE NO. _______________ AN ORDINANCE OF THE CITY OF DENTON, TEXAS, AUTHORIZING THE INTERIM CITY MANAGER, OR HER DESIGNEE, TO EXECUTE AN INTERLOCAL COOPERATION CONTRACT IN THE FORM OF A MEMORANDUM OF UNDERSTANDING WITH THE STATE OF TEXAS, TEXAS DEPARTMENT OF PUBLIC SAFETY, ESTABLISHING RESPONSIBILITIES, POLICIES, AND GUIDELINES FOR THE DENTON POLICE DEPARTMENT TO CONDUCT FEDERAL SAFETY REGULATION INSPECTIONS; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, pursuant to Texas Government Code Chapter 791, Interlocal Cooperation Contracts, the City wishes to establish through a Memorandum of Understanding (“MOU”) with the State of Texas, Texas Department of Public Safety, the parameters for enforcing Federal safety regulations; and WHEREAS, this MOU authorizes Denton Police officers to conduct Federal safety regulation inspections in accordance timeliness and accuracy standards imposed by the Federal Motor Carrier Safety Administration and through the implementation of procedures for compliance of the minimum standards outlined in the MOU, including minimum certification requirements in training programs and policies and guidelines for conducting Federal safety regulation inspections; and WHEREAS, the City believes this MOU is in the best interests for the safety of the citizens of the City of Denton, and that a valid government purpose is served by said designation; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1: The findings and recitations contained in the preamble of this Ordinance are incorporated herein by reference. SECTION 2: The Interim City Manager, or her designee, is hereby authorized to execute this MOU on behalf of the City of Denton with the Texas Department of Public Safety, establishing responsibilities, policies, and guidelines for the Denton Police Department to conduct Federal safety regulation inspections, which is attached hereto as Exhibit “A ,” and made a part hereof by reference and is hereby approved. SECTION 3: That this Ordinance shall become effective immediately upon its passage and approval. The motion to approve this Ordinance was made by __________________________ and seconded by _________________________________; this Ordinance was passed and approved by the following vote [___ - ___]: 546 547 548 549 550 551 552 553 554 555 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1552,Version:1 Consider approval of a resolution of the City of Denton abolishing The Community Development Advisory Committee; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™556 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Community Services CM/ DCM/ ACM: Sara Hensley, Interim City Manager DATE: July 27, 2021 SUBJECT Consider approval of a resolution of the City of Denton abolishing The Community Development Advisory Committee; and providing an effective date. BACKGROUND There are two committees that currently advise City Council on program development and funding granted through Community Services. The Community Development Advisory Committee (CDAC) was established in 1978 to advise on the processes and allocation of the Community Development Grant Program. In 1989, the Human Services Advisory Committee (HSAC) was established to advise and assist with the coordination of human services programming and funding supported by the City of Denton. Community Services staff support both the CDAC and HSAC. The CDAC advises on the allocation of federal funding allocated to the City by the Department of Housing and Urban Development (HUD): Community Development Block Grant (CDBG), HOME Investment Partnership (HOME). The HSAC advises on General Fund dollars allocated for human services grants to nonprofit organizations providing services in the City. DISCUSSION Each committee was established to advise and shepherd community funding and programs in the City, but the City’s engagement and role in assessing and responding to community needs has since changed. The City of Denton has expanded to fund community needs and engage with coalitions and committees beyond the single grant programs overseen by CDAC and HSAC. Increasingly, City Council has indicated support for the growing investment in initiatives that address complex social problems such as poverty, housing, homelessness, and more. The CDAC and HSAC are strategically more similar than different in purpose, operation, and knowledge. The purpose of each committee is to identify community needs and support the implementation of services to meet community needs. Operationally, the separation causes procedural barriers and results in duplication of efforts. Evaluation and recommendations are conducted concurrently, and the HSAC must wait for the CDAC to make decisions before they can make their final evaluations and recommendations. Currently staff track and communicate federal and local funding recommendations to Council separately. There is often overlap in communication and knowledge building processes. Staff is frequently scheduling two meetings to convey the same information in effort to provide committees with the data they need to make informed decisions on funding recommendations. On June 22, 2021 Staff presented a work session to City Council seeking direction regarding a staff recommendation to dissolve the CDAC and HSAC then create a new committee of community partners City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 557 who can look at community needs together around the same problem-solving table and implement a process that optimizes resources. The goal of a single committee to:  Optimize Existing City Resources.  Reduce Duplication of efforts.  Engage members around a year-round, strategic conversation for a community-wide coordinated response to identified community needs (instead of through two separate conversations).  Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.  Facilitate a more informed and comprehensive resource allocation process.  Facilitate resource allocation more quickly and efficiently. City Council provided direction to staff to proceed and requested that staff provide City Council with feedback from the current CDAC and HSAC members on the proposed dissolution of the current CDAC and HSAC together with the establishment of a new committee. The CDAC and HSAC were surveyed and the committees held a joint meeting on July 16, 2021. Survey Results Committee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session. Seventy percent (70%) members (14/20) responded. 1. Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? (86% Yes) o 12 Yes o 2 No (1 requested additional information behind the proposal) 3. Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? (92% Yes) o 13 Yes o 1 No Response (The member not returning) 4. Suggestions/Recommendations: o 7 (50%) – No suggestions o 4 (29%) – Supportive of new committee o 1 (7%) – Requested additional information o 1 (7%) – Scheduling questions related to meeting commitment requirements o 1 (7%) – Against the new committee Joint CDAC/HSAC Meeting on July 16, 2021  Discussion on potential downsides: Members discussed potential negatives to the committee changes. o For existing members who like the specialized role they currently serve, the change in the committee focus from only the two (2) grant program to advising more programs and the ongoing strategic work may not be desired. o As a result of forming new committee, some members may not be selected to continue to serve. There is concern who would still get to serve if a new committee is formed. o There may be fewer citizens involved in the conversation.  Discussion in support: Members discussed potential positives to the committee changes. o Aligns with Denton’s growth and changing community needs o Improves responsiveness and the ability to distribute funding faster o It will be a better use of City resources (streamline efforts, creates efficiencies) 558 o One committee for staff to regularly seek advice and guidance in response to the City’s broader initiatives addressing complex social needs such as poverty, housing and homelessness, including opportunities for new funding, programs, and community services o Better service to the community from a more nimble single committee with a greater ability to make more informed strategic recommendations to City Council. o Move from a single application process to a proactive process to encourage community partners to address identified gaps in current community services.  Discussion on Size/Quorum: Members discussed what would be optimal committee size and other issues related to the committee composition of a new committee. o In effort to ensure adequate community input while optimizing size for quorum needs, there was consensus to make the recommendation for a minimum of 11 and a max of 15 members if a new committee is formed. o Members discussed what action can be taken in a meeting when a quorum is present and when a quorum in not present? A quorum is needed to hold a meeting and to take action. o Options were discussed for other ways to engage in wider Citizen Participation Activities that do not require committee membership. o Other options were discussed that required clarification from legal:  Options where discussed for utilizing subcommittees to engage larger community. Staff reviewed with legal what authorities could be granted through resolution for the committee to form subcommittees including options for both subcommittees of current committee member and subcommittees of non-committee members. After discussion with legal and in alignment with the members goals, staff is recommending that rather than establishing subcommittees, the Committee could hold public hearings for the purpose of soliciting and receiving public feedback. The Committee could also invite special guests (e.g., agencies) to make a presentation with staff.  Options where discussed on how to use committee alternates to positively effect quorum. Staff reviewed with legal the possibility of using alternates with voting authority as needed to meet quorum. Consideration was also reviewed for alternate terms that would not negatively affect an alternate who later becomes a member and an alternate’s impact to current City Boards and Commissions Attendance Policy. After discussion with legal, while naming alternates is permissible, currently alternates have only been named for City boards having judicial or quasi-judicial authority such as the Board of Ethics, Health and Building Standards Commission and Zoning Board of Adjustment and for the regional Denton County Transportation Authority. In consideration that the result of advisory committee deliberations is a recommendation to Council, not a ruling, staff is recommending that alternates not be considered at this time.  Discussion on Appointment process: Members discussed what would the appointment process look like for a new committee o The appointment process was reviewed. o An option was discussed for a recommendation to Council to prioritize members of the former CDAC and HSAC for appointment to the new committee as appropriate.  Discussion on Ex-officio United Way: Members discussed the option for a United Way representative to serve as ex-officio member to the new committee o There was not consensus on the inclusion of the ex-officio. o Consensus was to recommend it not be considered in the forming but to leave this question to the new committee to decide (and amend resolution later if desired).  Against the committee changes: o One (1) Member who was not able to attend the joint meeting indicated by email to the HSAC Chair being against the committee changes. 559 Based on direction from City Council and with majority consensus of the CDAC and HSAC members, staff is recommending: 1. abolishing the current CDAC, and 2. repealing the HSAC, and 3. creating a Community Services Advisory Committee. Staff will present to Council on July 27 the three actions in a single presentation. ID 21-1552: ABOLISHING THE COMMUNITY DEVELOPMENT ADVISORY COMMITTEE The CDAC was created through a resolution approved on SEPTEMBER 19, 1978 (resolutions not numbered at that time). Per Code Section 2-29(h)(2), staff has prepared a resolution to abolish the CDAC. ID 21-1553: REPEALING THE HUMAN SERVICES ADVISORY COMMITTEE The HSAC was codified by ordinance in Chapter 14, Article III of the Code of Ordinances of the City of Denton. Staff has prepared an ordinance to repeal Article III, including Sections 14.61 and 14.62, from Chapter 14 of the Code. ID 21-979: CREATING A COMMUNITY SERVICES ADVISORY COMMITTEE Per Code Section 2-29(h)(2), staff is recommending the creation by resolution of a Community Services Advisory Committee with committee composition of eleven (11) members, with each Council Member appointing one committee member and four committee members appointed at large by a vote of at least four Council Members, unless otherwise directed by City Council on the number and appointment of members. At its inception, to create staggered terms for the committee members, the seven committee members appointed by each Council Member would serve a two-year term and the four committee members appointed at large would serve a one-year term. Thereafter, all members would be appointed for a two-year term, with seven members appointed in odd numbered years and four members appointed in even numbered years. Upon approval of the resolution creating the Community Services Advisory Committee, staff from Community Services and City Secretary’s office would implement the plan for the initial committee period starting September 1. TIMELINE  July 27, 2021 – o Council approves Resolution to abolish CDAC, and o Council approves and Ordinance to repeal the HSAC, and o Council approves the Resolution to create the Community Services Advisory Committee  August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule.  September 2021 – New committee meets for the first time. OPTIONS  Approve Resolution (ID 21-1552) to abolish CDAC as presented, and  Do not approve the Resolution EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Community Development Advisory Committee Resolution Exhibit 3 – Resolution Exhibit 4 – Presentation 560 Respectfully submitted: Courtney Cross Assistant Community Services Manager Dani Shaw Director of Community Services 561 AT A REGULAR MEETING OF THE CITY COUNCIL OF THE CITY OF DENTON, TEXAS, HELD IN THE MUNICIPAL BUILDING OF SAID CITY ON THE 19TH DAY OF SEPTEMBER, A. D. 1978. RESOLUTION WHEREAS, the City of Denton, Texas has a history of involving its cltlzens in all facets of decision making; and WHEREAS, the C~ty of Denton w~ll continue to be ~nvolved ~n the Community Development Block Grant Program; and WHEREAS, it ~s recognized that the City of Denton needs a Com- munity Development Advisory Commlttee an order to assure clt~zen part~c~patlon in all stages of the grant process. NOWt T}IEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF DENTON, TEXAS: 1. That there is hereby created a Community Development Advi- sory Committee to be composed of n~ne (9) members appolnted by the C~ty Council for two (2) year terms. The commattee members shall have staggered terms with f~ve (5) members being appointed during even numbered years and four (4) members being appolnted during odd numbered years. At its lnceptlon, the Caty Councll shall appoint fave (5) members to the Committee for a two (2) year term and four 4) members to the committee for a one (1) year term. Members of the committee may be removed by the City Council for cause Vacan- cies shall be f~lled ~n the same manner provided for regular appoint- ments. 2. That the C~ty Manager or his designee shall be an ex-off,cIo member of the ¢ommlttee. He shall attend all meetings of the com- mittee and shall have the r~ght to discuss any matter that as under conslderatlon by the committee but shall have no vote. 3. That members of the committee shall be catlzens of the City of Denton. 4. That at the first meeting each year after members have been sworn an, the committee shall select from ~ts owner membership a chairperson and vice chairperson. Any f~ve of the regularly appointed members shall constitute a quorum. The commlttee shall determlne ~ts 562 own rules and order of business, and shall meet as necessary All meetings shall be open to the public and a permanent record of pro- ceedlngs maintaIned 5. It shall be the duty of the Community Development Advisory Committee: a) To act in an advisory capacity to the City Council in the determination of priorities and program development for Community Development Grant Programs. b) To act as a recommending body for subsequent amendments to the Community Development Grant Program c) To serve in a leadership role in the process of planning, lmplementzng, and assessing the Community Development Program and implementing the Cztlzen Partzc~patlon Plan PASSED and APPROVED this the 19th day of September, A. D 1978. C~MITCHEL~, MAYOR OF DENTON, TEXAS ATTEST. ITY SECRETARY CITY OF DENTON, TEXAS APPROVED AS TO LEGAL FOR~: PAUL C. ISHAM, CITY ATTORNEY CITY OF DENTON, TEXAS 563 RESOLUTION NO.________________ A RESOLUTION OF THE CITY OF DENTON ABOLISHING THE COMMUNITY DEVELOPMENT ADVISORY COMMITTEE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, there are two committees currently advising the City Council on program development and funding regarding community services: the Community Development Advisory Committee (“CDAC”), created September 19, 1978 by resolution, and the Human Services Advisory Committee (“HSAC”), codified August 18th, 1989 by Ordinance No. 1989-098 and currently set forth in Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas; and WHEREAS, originally the missions of the CDAC and HSAC were distinct; however, in recent years their missions are strategically more similar than different in purpose and the separation of their activities into two committees causes procedural barriers and duplication of efforts; and WHEREAS, the City Council finds that it is in the public interest to abolish the CDAC by resolution and to repeal Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas by separate ordinance and further finds that it would promote improved communication, effectiveness and results to create by separate resolution a new committee to advise the City Council regarding a coordinated community-wide response to meet prioritized community needs; and WHEREAS, the City Council finds that it is in the public interest to abolish the CDAC in anticipation of creating a new advisory committee; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY RESOLVES: SECTION l. That the findings and recitations contained in the preamble of this resolution are incorporated herein by reference as true and as if fully set forth in the body of this resolution. SECTION 2. That the Community Development Advisory Committee is hereby abolished and shall immediately cease to exist. SECTION 3. This resolution shall become effective immediately upon its passage and approval. 564 The motion to approve this resolution was made by __________________________ and seconded by _________________________________. The resolution was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Gerard Hudspeth, Mayor: Vicki Byrd, District 1: Brian Beck, District 2: Jesse Davis, District 3: Alison Maguire, District 4: Deb Armintor, At Large Place 5: Paul Meltzer, At Large Place 6: PASSED AND APPROVED this the _________ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Kendra Kennedy 565 Formation  of Community Services Advisory CommitteeCOMMUNITY SERVICESWORKING TO PROVIDE QUALITY AFFORDABLE HOUSING, A SUITABLE LIVING ENVIRONMENT, AND EXPANDING ECONOMIC OPPORTUNITY, PRINCIPALLY FOR PERSONS OF LOW TO MODERATE INCOME.566 COMMITTEE BACKGROUNDCOMMUNITY DEVELOPMENT ADVISORY COMMITTEEEstablished: 1978Composition: 9 members, 1 appointment per Council member and 2 at‐largeFunction: Make recommendations to City Council for Community Development GrantFunding Source(s):oCommunity Development Block Grant ProgramoHOME Investment Partnership Program oCommunity Development Block Grant CARES Act ProgramHUMAN SERVICES ADVISORY COMMITTEEEstablished: 1989Composition: 11 members, 1 appointment per Council member and 4 at‐largeFunction: Make recommendations to City Council for Human Services GrantFunding Source(s):oCity of Denton General FundoCommunity Development Block Grant ProgramID 21‐979, 21‐1552, 21‐1553567 COMMITTEE FUTUREThe goal of a single committee will:Optimize Existing City Resources.Reduce Duplication of efforts.Engage members around a year‐round, strategic conversation for a community‐wide coordinated response to identified community needs. Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.Facilitate a more informed and comprehensive resource allocation process.Facilitate resource allocation more quickly and efficiently. ID 21‐979, 21‐1552, 21‐1553568 SURVEY FEEDBACKCommittee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session.14 of 20 (70%) members responded1.Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? 86% Yeso12 Yes o2 No (1 requested additional information behind the proposal)2.Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? 92% Yeso13 Yes o1 No Response (The member not returning)3.Suggestions/Recommendations:o7 (50%) – No suggestionso4 (29%) – Supportive of new committeeo1   (7%) – Requested additional informationo1   (7%) – Scheduling questions related to meeting commitment requirementso1   (7%) – Against the new committee ID 21‐979, 21‐1552, 21‐1553569 CDAC/HSAC JOINT MEETING FEEDBACKDiscussion on potential downside: oChange in current processes may not be desired by all and more meetings may impact time commitments for membersoAs a result forming new committee, some current members may not be selected to continue to serve. oFewer citizens involved in the conversationDiscussion in support:oAligns with Denton’s growth and changing needsoImproves responsiveness and use of City resources. Examples included: get funding out more quickly and efficiently, streamline processes, improve recommendations to meet community needs)oProvides staff with a committee to regularly seek advice and guidance for addressing complex social needs such as poverty, affordable housing, homelessnessoProviding better service to community with a better informed committee, making strategic recommendations to inform policy direction from Council Discussion on Size/Quorum: oWhat is the right balance to ensure community input while optimizing size for quorum. Recommendation for a minimum of 11, max of 15oDiscussed options for subcommittees and/or alternates and option to address quorum requirementsoClarification about reappointment process and what would be the impact to current members serving on new committeeDiscussion on Ex‐officio United Way: oMixed input to include a dedicated United Way ex‐officio roleoConsensus was to not include at this time but leave to the new committee to decide later (and amend resolution later if desired)Against:o1 Member by EmailID 21‐979, 21‐1552, 21‐1553570 CURRENT COMMITTEESID 21‐979, 21‐1552, 21‐1553COUNCIL CDAC Term HSAC Term1 (Byrd) Nancy Crisco (08/31/21‐p) HudspethAnne ScaggsNEW(08/31/21‐p) Johnson2 (Beck) Jane Piper‐Lunt(08/31/21‐2) BriggsGretchen Busl(08/31/22‐2) Baker3 (Davis) Doray Hill(08/31/22‐1) DavisPatricia LaBeau(08/31/21‐1) DavisWilling to step down4 (Maguire)Kimberly Lewis NEW(08/31/21‐p) McGuireRhonda Love(08/31/22‐2) Ryan5 (Armintor)John Catlin NEW(08/31/22‐p) ArmintorNathaniel Johnson(08/31/21‐p) Armintor6 (Meltzer)Fran Witte(08/31/21‐2) MeltzerWill not seek reappointmentMark Courts(08/31/21‐p) Meltzer7 (Hudspeth)Mary Beth Cottingham+(08/31/21‐3) Watts Terms out Aug 2021Roy Onyebetor+(08/31/21‐2) WattsAll – 1Randi Skinner(08/31/21‐2) BriggsDale Tampke(08/31/22‐p) DavisAll – 2Jodi Vicars‐Nance(08/31/22‐3) Baker  Jim Mann NEW(08/31/22‐p) RyanAll – 3Pat Cheek NEW(08/31/xx‐p) MeltzerAll ‐ 4Hannah Garcia*(08/31/22‐3) Baker*Chair +Vice Chair 571 TIMELINEJuly 27, 2021 –o1. Council approves Resolution to abolish CDAC, and o2. Council approves and Ordinance to repeal the HSAC, and o3. Council approves the Resolution to create the Community Services Advisory Committee August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule September 2021 – New committee meets for the first time and initiates a annual calendarID 21‐979, 21‐1552, 21‐1553572 OPTIONS ID 21‐1552Approve the Resolution to abolish the CDACDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553573 OPTIONS ID 21‐1553Approve the Ordinance to repeal the HSAC Do not approve the OrdinanceID 21‐979, 21‐1552, 21‐1553574 OPTIONS ID 21‐979Approve the Resolution as presented to create the Community Services Advisory CommitteeApprove the Resolution with changesDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553575 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1553,Version:1 Consider adoption of an ordinance of the City of Denton repealing Article III,“Human Services Committee,”of Chapter 14 of the Code of the City of Denton, Texas; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™576 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Community Services CM/ DCM/ ACM: Sara Hensley, Interim City Manager DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton repealing Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas; and providing an effective date. BACKGROUND There are two committees that currently advise City Council on program development and funding granted through Community Services. The Community Development Advisory Committee (CDAC) was established in 1978 to advise on the processes and allocation of the Community Development Grant Program. In 1989, the Human Services Advisory Committee (HSAC) was established to advise and assist with the coordination of human services programming and funding supported by the City of Denton. Community Services staff support both the CDAC and HSAC. The CDAC advises on the allocation of federal funding allocated to the City by the Department of Housing and Urban Development (HUD): Community Development Block Grant (CDBG), HOME Investment Partnership (HOME). The HSAC advises on General Fund dollars allocated for human services grants to nonprofit organizations providing services in the City. DISCUSSION Each committee was established to advise and shepherd community funding and programs in the City, but the City’s engagement and role in assessing and responding to community needs has since changed. The City of Denton has expanded to fund community needs and engage with coalitions and committees beyond the single grant programs overseen by CDAC and HSAC. Increasingly, City Council has indicated support for the growing investment in initiatives that address complex social problems such as poverty, housing, homelessness, and more. The CDAC and HSAC are strategically more similar than different in purpose, operation, and knowledge. The purpose of each committee is to identify community needs and support the implementation of services to meet community needs. Operationally, the separation causes procedural barriers and results in duplication of efforts. Evaluation and recommendations are conducted concurrently, and the HSAC must wait for the CDAC to make decisions before they can make their final evaluations and recommendations. Currently staff track and communicate federal and local funding recommendations to Council separately. There is often overlap in communication and knowledge building processes. Staff is frequently scheduling two meetings to convey the same information in effort to provide committees with the data they need to make informed decisions on funding recommendations. On June 22, 2021 Staff presented a work session to City Council seeking direction regarding a staff recommendation to dissolve the CDAC and HSAC then create a new committee of community partners City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 577 who can look at community needs together around the same problem-solving table and implement a process that optimizes resources. The goal of a single committee to:  Optimize Existing City Resources.  Reduce Duplication of efforts.  Engage members around a year-round, strategic conversation for a community-wide coordinated response to identified community needs (instead of through two separate conversations).  Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.  Facilitate a more informed and comprehensive resource allocation process.  Facilitate resource allocation more quickly and efficiently. City Council provided direction to staff to proceed and requested that staff provide City Council with feedback from the current CDAC and HSAC members on the proposed dissolution of the current CDAC and HSAC together with the establishment of a new committee. The CDAC and HSAC were surveyed and the committees held a joint meeting on July 16, 2021. Survey Results Committee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session. Seventy percent (70%) members (14/20) responded. 1. Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? (86% Yes) o 12 Yes o 2 No (1 requested additional information behind the proposal) 3. Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? (92% Yes) o 13 Yes o 1 No Response (The member not returning) 4. Suggestions/Recommendations: o 7 (50%) – No suggestions o 4 (29%) – Supportive of new committee o 1 (7%) – Requested additional information o 1 (7%) – Scheduling questions related to meeting commitment requirements o 1 (7%) – Against the new committee Joint CDAC/HSAC Meeting on July 16, 2021  Discussion on potential downsides: Members discussed potential negatives to the committee changes. o For existing members who like the specialized role they currently serve, the change in the committee focus from only the two (2) grant program to advising more programs and the ongoing strategic work may not be desired. o As a result of forming new committee, some members may not be selected to continue to serve. There is concern who would still get to serve if a new committee is formed. o There may be fewer citizens involved in the conversation.  Discussion in support: Members discussed potential positives to the committee changes. o Aligns with Denton’s growth and changing community needs o Improves responsiveness and the ability to distribute funding faster o It will be a better use of City resources (streamline efforts, creates efficiencies) 578 o One committee for staff to regularly seek advice and guidance in response to the City’s broader initiatives addressing complex social needs such as poverty, housing and homelessness, including opportunities for new funding, programs, and community services o Better service to the community from a more nimble single committee with a greater ability to make more informed strategic recommendations to City Council. o Move from a single application process to a proactive process to encourage community partners to address identified gaps in current community services.  Discussion on Size/Quorum: Members discussed what would be optimal committee size and other issues related to the committee composition of a new committee. o In effort to ensure adequate community input while optimizing size for quorum needs, there was consensus to make the recommendation for a minimum of 11 and a max of 15 members if a new committee is formed. o Members discussed what action can be taken in a meeting when a quorum is present and when a quorum in not present? A quorum is needed to hold a meeting and to take action. o Options were discussed for other ways to engage in wider Citizen Participation Activities that do not require committee membership. o Other options were discussed that required clarification from legal:  Options where discussed for utilizing subcommittees to engage larger community. Staff reviewed with legal what authorities could be granted through resolution for the committee to form subcommittees including options for both subcommittees of current committee member and subcommittees of non-committee members. After discussion with legal and in alignment with the members goals, staff is recommending that rather than establishing subcommittees, the Committee could hold public hearings for the purpose of soliciting and receiving public feedback. The Committee could also invite special guests (e.g., agencies) to make a presentation with staff.  Options where discussed on how to use committee alternates to positively effect quorum. Staff reviewed with legal the possibility of using alternates with voting authority as needed to meet quorum. Consideration was also reviewed for alternate terms that would not negatively affect an alternate who later becomes a member and an alternate’s impact to current City Boards and Commissions Attendance Policy. After discussion with legal, while naming alternates is permissible, currently alternates have only been named for City boards having judicial or quasi-judicial authority such as the Board of Ethics, Health and Building Standards Commission and Zoning Board of Adjustment and for the regional Denton County Transportation Authority. In consideration that the result of advisory committee deliberations is a recommendation to Council, not a ruling, staff is recommending that alternates not be considered at this time.  Discussion on Appointment process: Members discussed what would the appointment process look like for a new committee o The appointment process was reviewed. o An option was discussed for a recommendation to Council to prioritize members of the former CDAC and HSAC for appointment to the new committee as appropriate.  Discussion on Ex-officio United Way: Members discussed the option for a United Way representative to serve as ex-officio member to the new committee o There was not consensus on the inclusion of the ex-officio. o Consensus was to recommend it not be considered in the forming but to leave this question to the new committee to decide (and amend resolution later if desired).  Against the committee changes: o One (1) Member who was not able to attend the joint meeting indicated by email to the HSAC Chair being against the committee changes. 579 Based on direction from City Council and with majority consensus of the CDAC and HSAC members, staff is recommending: 1. abolishing the current CDAC, and 2. repealing the HSAC, and 3. creating a Community Services Advisory Committee. Staff will present to Council on July 27 the three actions in a single presentation. ID 21-1552: ABOLISHING THE COMMUNITY DEVELOPMENT ADVISORY COMMITTEE The CDAC was created through a resolution approved on SEPTEMBER 19, 1978 (resolutions not numbered at that time). Per Code Section 2-29(h)(2), staff has prepared a resolution to abolish the CDAC. ID 21-1553: REPEALING THE HUMAN SERVICES ADVISORY COMMITTEE The HSAC was codified by ordinance in Chapter 14, Article III of the Code of Ordinances of the City of Denton. Staff has prepared an ordinance to repeal Article III, including Sections 14.61 and 14.62, from Chapter 14 of the Code. ID 21-979: CREATING A COMMUNITY SERVICES ADVISORY COMMITTEE Per Code Section 2-29(h)(2), staff is recommending the creation by resolution of a Community Services Advisory Committee with committee composition of eleven (11) members, with each Council Member appointing one committee member and four committee members appointed at large by a vote of at least four Council Members, unless otherwise directed by City Council on the number and appointment of members. At its inception, to create staggered terms for the committee members, the seven committee members appointed by each Council Member would serve a two-year term and the four committee members appointed at large would serve a one-year term. Thereafter, all members would be appointed for a two-year term, with seven members appointed in odd numbered years and four members appointed in even numbered years. Upon approval of the resolution creating the Community Services Advisory Committee, staff from Community Services and City Secretary’s office would implement the plan for the initial committee period starting September 1. TIMELINE  July 27, 2021 – o Council approves Resolution to abolish CDAC, and o Council approves and Ordinance to repeal the HSAC, and o Council approves the Resolution to create the Community Services Advisory Committee  August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule.  September 2021 – New committee meets for the first time. OPTIONS  Approve Ordinance (ID 21-1553) to repeal the HSAC as presented  Do not approve the Resolution EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Article III of Chapter 14 Exhibit 3 – Resolution to create the Community Services Advisory Committee Exhibit 4 – Presentation 580 Respectfully submitted: Courtney Cross Assistant Community Services Manager Dani Shaw Director of Community Services 581 7/21/2021 Denton, TX Code of Ordinances 1/2 (a) (b) (c) (d) (1) (2) ARTICLE III. - HUMAN SERVICES COMMITTEE Footnotes: --- (2) --- Charter reference— Boards and commissions, § 14.16. Cross reference— Boards, commissions and committees, § 2-61 et seq. Sec. 14-61. - Created. There is hereby created a human services committee to be composed of eleven (11) members appointed by the city council for two-year terms. The committee members shall have staggered terms with six (6) members being appointed during even-numbered years and five (5) members being appointed during odd-numbered years. At its inception, the city council shall appoint six (6) members to the committee for two-year terms and five (5) members to the committee for one- year terms. Members of the committee may be removed by the city council for cause. Vacancies shall be filled in the same manner provided for regular appointments. The city manager shall be an ex officio member of the committee. He shall attend all meetings of the committee and shall have the right to discuss any matter that is under consideration by the committee, but shall have no vote. Members of the committee shall be citizens of the city. At the first meeting each year after new members have been sworn in, the committee shall select from its own membership a chairman, vice-chairman and secretary. Any five (5) of the regularly appointed members shall constitute a quorum. The committee shall determine its own rules and order of business and shall meet as necessary. All meetings shall be open to the public and a permanent record of proceedings maintained. (Ord. No. 89-098, § I(2-80), 8-1-89) Sec. 14-62. - Duties. It shall be the duty of the human services committee to act in an advisory capacity to the city council and to assist in the coordination of all human services agencies with authority to hold public hearings and to study and recommend policies relating to the promotion, planning, research and related matters involving human services relations and human services delivery in the city. In addition, the human services committee shall have the duty to: Interact with community groups in order to bring about improvements in the human services delivery system and provide a forum which promotes better communication and coordination among the agencies; Serve in an advisory capacity and encourage continuing in-depth evaluation of the 582 7/21/2021 Denton, TX Code of Ordinances 2/2 (3) effectiveness of the social service delivery system in the city; and Recommend to the city council actions for implementation that would improve human services in the city. (Ord. No. 89-098, § I(2-81), 8-1-89) Secs. 14-63—14-85. - Reserved. 583 ORDINANCE NO.________________ AN ORDINANCE OF THE CITY OF DENTON REPEALING ARTICLE III, “HUMAN SERVICES COMMITTEE,” OF CHAPTER 14 OF THE CODE OF THE CITY OF DENTON, TEXAS; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, there are two committees currently advising the City Council on program development and funding regarding community services: the Community Development Advisory Committee (“CDAC”), created September 19, 1978 by resolution, and the Human Services Committee, sometimes referred to as the Human Services Advisory Committee, (“HSAC”), codified August 18th, 1989 by Ordinance No. 1989-098 and currently set forth in Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas (the “Code”); and WHEREAS, originally the missions of the CDAC and HSAC were distinct; however, in recent years their missions are strategically more similar than different in purpose and the separation of their activities into two committees causes procedural barriers and duplication of efforts; and WHEREAS, the City Council finds that it is in the public interest to abolish the CDAC by separate resolution and to repeal Article III, “Human Services Committee,” of Chapter 14 of the Code by separate ordinance and further finds that it would promote improved communication, effectiveness and results to create by separate resolution a new committee to advise the City Council regarding a community-wide response to meet prioritized community needs; and WHEREAS, the City Council finds that it is in the public interest to repeal Article III, “Human Services Committee,” of Chapter 14 of the Code and Ordinance No. 1989-098 in anticipation of creating a new advisory committee; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION l. The findings and recitations contained in the preamble of this ordinance are incorporated herein by reference as true and as if fully set forth in the body of this resolution. SECTION 2. Article III, “Human Services Committee,” of Chapter 14 of the Code of Ordinances of the City of Denton, Texas, including Sections 14-61 and 14-62 thereof, and Ordinance No. 89-098 are hereby repealed immediately and the Human Services Committee, sometimes referred to as the Human Services Advisory Committee, shall immediately cease to exist. 584 SECTION 3. This ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________. The ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Gerard Hudspeth, Mayor: Vicki Byrd, District 1: Brian Beck, District 2: Jesse Davis, District 3: Alison Maguire, District 4: Deb Armintor, At Large Place 5: Paul Meltzer, At Large Place 6: PASSED AND APPROVED this the _________ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Kendra Kennedy 585 Formation  of Community Services Advisory CommitteeCOMMUNITY SERVICESWORKING TO PROVIDE QUALITY AFFORDABLE HOUSING, A SUITABLE LIVING ENVIRONMENT, AND EXPANDING ECONOMIC OPPORTUNITY, PRINCIPALLY FOR PERSONS OF LOW TO MODERATE INCOME.586 COMMITTEE BACKGROUNDCOMMUNITY DEVELOPMENT ADVISORY COMMITTEEEstablished: 1978Composition: 9 members, 1 appointment per Council member and 2 at‐largeFunction: Make recommendations to City Council for Community Development GrantFunding Source(s):oCommunity Development Block Grant ProgramoHOME Investment Partnership Program oCommunity Development Block Grant CARES Act ProgramHUMAN SERVICES ADVISORY COMMITTEEEstablished: 1989Composition: 11 members, 1 appointment per Council member and 4 at‐largeFunction: Make recommendations to City Council for Human Services GrantFunding Source(s):oCity of Denton General FundoCommunity Development Block Grant ProgramID 21‐979, 21‐1552, 21‐1553587 COMMITTEE FUTUREThe goal of a single committee will:Optimize Existing City Resources.Reduce Duplication of efforts.Engage members around a year‐round, strategic conversation for a community‐wide coordinated response to identified community needs. Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.Facilitate a more informed and comprehensive resource allocation process.Facilitate resource allocation more quickly and efficiently. ID 21‐979, 21‐1552, 21‐1553588 SURVEY FEEDBACKCommittee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session.14 of 20 (70%) members responded1.Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? 86% Yeso12 Yes o2 No (1 requested additional information behind the proposal)2.Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? 92% Yeso13 Yes o1 No Response (The member not returning)3.Suggestions/Recommendations:o7 (50%) – No suggestionso4 (29%) – Supportive of new committeeo1   (7%) – Requested additional informationo1   (7%) – Scheduling questions related to meeting commitment requirementso1   (7%) – Against the new committee ID 21‐979, 21‐1552, 21‐1553589 CDAC/HSAC JOINT MEETING FEEDBACKDiscussion on potential downside: oChange in current processes may not be desired by all and more meetings may impact time commitments for membersoAs a result forming new committee, some current members may not be selected to continue to serve. oFewer citizens involved in the conversationDiscussion in support:oAligns with Denton’s growth and changing needsoImproves responsiveness and use of City resources. Examples included: get funding out more quickly and efficiently, streamline processes, improve recommendations to meet community needs)oProvides staff with a committee to regularly seek advice and guidance for addressing complex social needs such as poverty, affordable housing, homelessnessoProviding better service to community with a better informed committee, making strategic recommendations to inform policy direction from Council Discussion on Size/Quorum: oWhat is the right balance to ensure community input while optimizing size for quorum. Recommendation for a minimum of 11, max of 15oDiscussed options for subcommittees and/or alternates and option to address quorum requirementsoClarification about reappointment process and what would be the impact to current members serving on new committeeDiscussion on Ex‐officio United Way: oMixed input to include a dedicated United Way ex‐officio roleoConsensus was to not include at this time but leave to the new committee to decide later (and amend resolution later if desired)Against:o1 Member by EmailID 21‐979, 21‐1552, 21‐1553590 CURRENT COMMITTEESID 21‐979, 21‐1552, 21‐1553COUNCIL CDAC Term HSAC Term1 (Byrd) Nancy Crisco (08/31/21‐p) HudspethAnne ScaggsNEW(08/31/21‐p) Johnson2 (Beck) Jane Piper‐Lunt(08/31/21‐2) BriggsGretchen Busl(08/31/22‐2) Baker3 (Davis) Doray Hill(08/31/22‐1) DavisPatricia LaBeau(08/31/21‐1) DavisWilling to step down4 (Maguire)Kimberly Lewis NEW(08/31/21‐p) McGuireRhonda Love(08/31/22‐2) Ryan5 (Armintor)John Catlin NEW(08/31/22‐p) ArmintorNathaniel Johnson(08/31/21‐p) Armintor6 (Meltzer)Fran Witte(08/31/21‐2) MeltzerWill not seek reappointmentMark Courts(08/31/21‐p) Meltzer7 (Hudspeth)Mary Beth Cottingham+(08/31/21‐3) Watts Terms out Aug 2021Roy Onyebetor+(08/31/21‐2) WattsAll – 1Randi Skinner(08/31/21‐2) BriggsDale Tampke(08/31/22‐p) DavisAll – 2Jodi Vicars‐Nance(08/31/22‐3) Baker  Jim Mann NEW(08/31/22‐p) RyanAll – 3Pat Cheek NEW(08/31/xx‐p) MeltzerAll ‐ 4Hannah Garcia*(08/31/22‐3) Baker*Chair +Vice Chair 591 TIMELINEJuly 27, 2021 –o1. Council approves Resolution to abolish CDAC, and o2. Council approves and Ordinance to repeal the HSAC, and o3. Council approves the Resolution to create the Community Services Advisory Committee August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule September 2021 – New committee meets for the first time and initiates a annual calendarID 21‐979, 21‐1552, 21‐1553592 OPTIONS ID 21‐1552Approve the Resolution to abolish the CDACDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553593 OPTIONS ID 21‐1553Approve the Ordinance to repeal the HSAC Do not approve the OrdinanceID 21‐979, 21‐1552, 21‐1553594 OPTIONS ID 21‐979Approve the Resolution as presented to create the Community Services Advisory CommitteeApprove the Resolution with changesDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553595 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-979,Version:1 Consider approval of a resolution of the City of Denton creating a Community Services Advisory Committee to advise the city council on programs, services, and use of public resources to address complex social problems such as economic instability, housing, and homelessness and for meeting community service needs; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™596 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Community Services CM/ DCM/ ACM: Sara Hensley, Interim City Manager DATE: July 27, 2021 SUBJECT Consider approval of a resolution of the City of Denton creating a Community Services Advisory Committee to advise the city council on programs, services, and use of public resources to address complex social problems such as economic instability, housing, and homelessness and for meeting community service needs; and providing an effective date. BACKGROUND There are two committees that currently advise City Council on program development and funding granted through Community Services. The Community Development Advisory Committee (CDAC) was established in 1978 to advise on the processes and allocation of the Community Development Grant Program. In 1989, the Human Services Advisory Committee (HSAC) was established to advise and assist with the coordination of human services programming and funding supported by the City of Denton. Community Services staff support both the CDAC and HSAC. The CDAC advises on the allocation of federal funding allocated to the City by the Department of Housing and Urban Development (HUD): Community Development Block Grant (CDBG), HOME Investment Partnership (HOME). The HSAC advises on General Fund dollars allocated for human services grants to nonprofit organizations providing services in the City. DISCUSSION Each committee was established to advise and shepherd community funding and programs in the City, but the City’s engagement and role in assessing and responding to community needs has since changed. The City of Denton has expanded to fund community needs and engage with coalitions and committees beyond the single grant programs overseen by CDAC and HSAC. Increasingly, City Council has indicated support for the growing investment in initiatives that address complex social problems such as poverty, housing, homelessness, and more. The CDAC and HSAC are strategically more similar than different in purpose, operation, and knowledge. The purpose of each committee is to identify community needs and support the implementation of services to meet community needs. Operationally, the separation causes procedural barriers and results in duplication of efforts. Evaluation and recommendations are conducted concurrently, and the HSAC must wait for the CDAC to make decisions before they can make their final evaluations and recommendations. Currently staff track and communicate federal and local funding recommendations to Council separately. There is often overlap in communication and knowledge building processes. Staff is frequently scheduling two meetings to convey the same information in effort to provide committees with the data they need to make informed decisions on funding recommendations. City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 597 On June 22, 2021 Staff presented a work session to City Council seeking direction regarding a staff recommendation to dissolve the CDAC and HSAC then create a new committee of community partners who can look at community needs together around the same problem-solving table and implement a process that optimizes resources. The goal of a single committee to:  Optimize Existing City Resources.  Reduce Duplication of efforts.  Engage members around a year-round, strategic conversation for a community-wide coordinated response to identified community needs (instead of through two separate conversations).  Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.  Facilitate a more informed and comprehensive resource allocation process.  Facilitate resource allocation more quickly and efficiently. City Council provided direction to staff to proceed and requested that staff provide City Council with feedback from the current CDAC and HSAC members on the proposed dissolution of the current CDAC and HSAC together with the establishment of a new committee. The CDAC and HSAC were surveyed and the committees held a joint meeting on July 16, 2021. Survey Results Committee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session. Seventy percent (70%) members (14/20) responded. 1. Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? (86% Yes) o 12 Yes o 2 No (1 requested additional information behind the proposal) 3. Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? (92% Yes) o 13 Yes o 1 No Response (The member not returning) 4. Suggestions/Recommendations: o 7 (50%) – No suggestions o 4 (29%) – Supportive of new committee o 1 (7%) – Requested additional information o 1 (7%) – Scheduling questions related to meeting commitment requirements o 1 (7%) – Against the new committee Joint CDAC/HSAC Meeting on July 16, 2021  Discussion on potential downsides: Members discussed potential negatives to the committee changes. o For existing members who like the specialized role they currently serve, the change in the committee focus from only the two (2) grant program to advising more programs and the ongoing strategic work may not be desired. o As a result of forming new committee, some members may not be selected to continue to serve. There is concern who would still get to serve if a new committee is formed. o There may be fewer citizens involved in the conversation.  Discussion in support: Members discussed potential positives to the committee changes. o Aligns with Denton’s growth and changing community needs o Improves responsiveness and the ability to distribute funding faster o It will be a better use of City resources (streamline efforts, creates efficiencies) 598 o One committee for staff to regularly seek advice and guidance in response to the City’s broader initiatives addressing complex social needs such as poverty, housing and homelessness, including opportunities for new funding, programs, and community services o Better service to the community from a more nimble single committee with a greater ability to make more informed strategic recommendations to City Council. o Move from a single application process to a proactive process to encourage community partners to address identified gaps in current community services.  Discussion on Size/Quorum: Members discussed what would be optimal committee size and other issues related to the committee composition of a new committee. o In effort to ensure adequate community input while optimizing size for quorum needs, there was consensus to make the recommendation for a minimum of 11 and a max of 15 members if a new committee is formed. o Members discussed what action can be taken in a meeting when a quorum is present and when a quorum in not present? A quorum is needed to hold a meeting and to take action. o Options were discussed for other ways to engage in wider Citizen Participation Activities that do not require committee membership. o Other options were discussed that required clarification from legal:  Options where discussed for utilizing subcommittees to engage larger community. Staff reviewed with legal what authorities could be granted through resolution for the committee to form subcommittees including options for both subcommittees of current committee member and subcommittees of non-committee members. After discussion with legal and in alignment with the members goals, staff is recommending that rather than establishing subcommittees, the Committee could hold public hearings for the purpose of soliciting and receiving public feedback. The Committee could also invite special guests (e.g., agencies) to make a presentation with staff.  Options where discussed on how to use committee alternates to positively effect quorum. Staff reviewed with legal the possibility of using alternates with voting authority as needed to meet quorum. Consideration was also reviewed for alternate terms that would not negatively affect an alternate who later becomes a member and an alternate’s impact to current City Boards and Commissions Attendance Policy. After discussion with legal, while naming alternates is permissible, currently alternates have only been named for City boards having judicial or quasi-judicial authority such as the Board of Ethics, Health and Building Standards Commission and Zoning Board of Adjustment and for the regional Denton County Transportation Authority. In consideration that the result of advisory committee deliberations is a recommendation to Council, not a ruling, staff is recommending that alternates not be considered at this time.  Discussion on Appointment process: Members discussed what would the appointment process look like for a new committee o The appointment process was reviewed. o An option was discussed for a recommendation to Council to prioritize members of the former CDAC and HSAC for appointment to the new committee as appropriate.  Discussion on Ex-officio United Way: Members discussed the option for a United Way representative to serve as ex-officio member to the new committee o There was not consensus on the inclusion of the ex-officio. o Consensus was to recommend it not be considered in the forming but to leave this question to the new committee to decide (and amend resolution later if desired).  Against the committee changes: o One (1) Member who was not able to attend the joint meeting indicated by email to the HSAC Chair being against the committee changes. 599 Based on direction from City Council and with majority consensus of the CDAC and HSAC members, staff is recommending: 1. abolishing the current CDAC, and 2. repealing the HSAC, and 3. creating a Community Services Advisory Committee. Staff will present to Council on July 27 the three actions in a single presentation. ID 21-1552: ABOLISHING THE COMMUNITY DEVELOPMENT ADVISORY COMMITTEE The CDAC was created through a resolution approved on SEPTEMBER 19, 1978 (resolutions not numbered at that time). Per Code Section 2-29(h)(2), staff has prepared a resolution to abolish the CDAC. ID 21-1553: REPEALING THE HUMAN SERVICES ADVISORY COMMITTEE The HSAC was codified by ordinance in Chapter 14, Article III of the Code of Ordinances of the City of Denton. Staff has prepared an ordinance to repeal Article III, including Sections 14.61 and 14.62, from Chapter 14 of the Code. ID 21-979: CREATING A COMMUNITY SERVICES ADVISORY COMMITTEE Per Code Section 2-29(h)(2), staff is recommending the creation by resolution of a Community Services Advisory Committee with committee composition of eleven (11) members, with each Council Member appointing one committee member and four committee members appointed at large by a vote of at least four Council Members, unless otherwise directed by City Council on the number and appointment of members. At its inception, to create staggered terms for the committee members, the seven committee members appointed by each Council Member would serve a two-year term and the four committee members appointed at large would serve a one-year term. Thereafter, all members would be appointed for a two-year term, with seven members appointed in odd numbered years and four members appointed in even numbered years. Upon approval of the resolution creating the Community Services Advisory Committee, staff from Community Services and City Secretary’s office would implement the plan for the initial committee period starting September 1. TIMELINE  July 27, 2021 – o Council approves Resolution to abolish CDAC, and o Council approves and Ordinance to repeal the HSAC, and o Council approves the Resolution to create the Community Services Advisory Committee  August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule.  September 2021 – New committee meets for the first time. OPTIONS If Council approved Resolution (ID 21-1552) to abolish CDAC as presented, and Ordinance (ID 21-1553) to repeal the HSAC as presented then options for ID 21-979 are provided for consideration.  Approve Resolution (ID 21-979) to create the CSAC as presented  Approve Resolution (ID 21-979) with changes  Do not approve the Resolution 600 EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Community Development Advisory Committee Resolution Exhibit 3 – Article III of Chapter 14 Exhibit 4 – Resolution to create the Community Services Advisory Committee Exhibit 5 – Presentation Respectfully submitted: Courtney Cross Assistant Community Services Manager Dani Shaw Director of Community Services 601 AT A REGULAR MEETING OF THE CITY COUNCIL OF THE CITY OF DENTON, TEXAS, HELD IN THE MUNICIPAL BUILDING OF SAID CITY ON THE 19TH DAY OF SEPTEMBER, A. D. 1978. RESOLUTION WHEREAS, the City of Denton, Texas has a history of involving its cltlzens in all facets of decision making; and WHEREAS, the C~ty of Denton w~ll continue to be ~nvolved ~n the Community Development Block Grant Program; and WHEREAS, it ~s recognized that the City of Denton needs a Com- munity Development Advisory Commlttee an order to assure clt~zen part~c~patlon in all stages of the grant process. NOWt T}IEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF DENTON, TEXAS: 1. That there is hereby created a Community Development Advi- sory Committee to be composed of n~ne (9) members appolnted by the C~ty Council for two (2) year terms. The commattee members shall have staggered terms with f~ve (5) members being appointed during even numbered years and four (4) members being appolnted during odd numbered years. At its lnceptlon, the Caty Councll shall appoint fave (5) members to the Committee for a two (2) year term and four 4) members to the committee for a one (1) year term. Members of the committee may be removed by the City Council for cause Vacan- cies shall be f~lled ~n the same manner provided for regular appoint- ments. 2. That the C~ty Manager or his designee shall be an ex-off,cIo member of the ¢ommlttee. He shall attend all meetings of the com- mittee and shall have the r~ght to discuss any matter that as under conslderatlon by the committee but shall have no vote. 3. That members of the committee shall be catlzens of the City of Denton. 4. That at the first meeting each year after members have been sworn an, the committee shall select from ~ts owner membership a chairperson and vice chairperson. Any f~ve of the regularly appointed members shall constitute a quorum. The commlttee shall determlne ~ts 602 own rules and order of business, and shall meet as necessary All meetings shall be open to the public and a permanent record of pro- ceedlngs maintaIned 5. It shall be the duty of the Community Development Advisory Committee: a) To act in an advisory capacity to the City Council in the determination of priorities and program development for Community Development Grant Programs. b) To act as a recommending body for subsequent amendments to the Community Development Grant Program c) To serve in a leadership role in the process of planning, lmplementzng, and assessing the Community Development Program and implementing the Cztlzen Partzc~patlon Plan PASSED and APPROVED this the 19th day of September, A. D 1978. C~MITCHEL~, MAYOR OF DENTON, TEXAS ATTEST. ITY SECRETARY CITY OF DENTON, TEXAS APPROVED AS TO LEGAL FOR~: PAUL C. ISHAM, CITY ATTORNEY CITY OF DENTON, TEXAS 603 7/21/2021 Denton, TX Code of Ordinances 1/2 (a) (b) (c) (d) (1) (2) ARTICLE III. - HUMAN SERVICES COMMITTEE Footnotes: --- (2) --- Charter reference— Boards and commissions, § 14.16. Cross reference— Boards, commissions and committees, § 2-61 et seq. Sec. 14-61. - Created. There is hereby created a human services committee to be composed of eleven (11) members appointed by the city council for two-year terms. The committee members shall have staggered terms with six (6) members being appointed during even-numbered years and five (5) members being appointed during odd-numbered years. At its inception, the city council shall appoint six (6) members to the committee for two-year terms and five (5) members to the committee for one- year terms. Members of the committee may be removed by the city council for cause. Vacancies shall be filled in the same manner provided for regular appointments. The city manager shall be an ex officio member of the committee. He shall attend all meetings of the committee and shall have the right to discuss any matter that is under consideration by the committee, but shall have no vote. Members of the committee shall be citizens of the city. At the first meeting each year after new members have been sworn in, the committee shall select from its own membership a chairman, vice-chairman and secretary. Any five (5) of the regularly appointed members shall constitute a quorum. The committee shall determine its own rules and order of business and shall meet as necessary. All meetings shall be open to the public and a permanent record of proceedings maintained. (Ord. No. 89-098, § I(2-80), 8-1-89) Sec. 14-62. - Duties. It shall be the duty of the human services committee to act in an advisory capacity to the city council and to assist in the coordination of all human services agencies with authority to hold public hearings and to study and recommend policies relating to the promotion, planning, research and related matters involving human services relations and human services delivery in the city. In addition, the human services committee shall have the duty to: Interact with community groups in order to bring about improvements in the human services delivery system and provide a forum which promotes better communication and coordination among the agencies; Serve in an advisory capacity and encourage continuing in-depth evaluation of the 604 7/21/2021 Denton, TX Code of Ordinances 2/2 (3) effectiveness of the social service delivery system in the city; and Recommend to the city council actions for implementation that would improve human services in the city. (Ord. No. 89-098, § I(2-81), 8-1-89) Secs. 14-63—14-85. - Reserved. 605 RESOLUTION NO.________________ A RESOLUTION OF THE CITY OF DENTON CREATING A COMMUNITY SERVICES ADVISORY COMMITTEE TO ADVISE THE CITY COUNCIL ON PROGRAMS, SERVICES, AND USE OF PUBLIC RESOURCES TO ADDRESS COMPLEX SOCIAL PROBLEMS SUCH AS ECONOMIC INSTABILITY, HOUSING, AND HOMELESSNESS AND FOR MEETING COMMUNITY SERVICE NEEDS; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, there are two committees currently advising the City Council on program development and funding regarding community services: the Community Development Advisory Committee (“CDAC”), created September 19, 1978 by resolution, and the Human Services Advisory Committee (“HSAC”), codified August 18th, 1989 by Ordinance No. 1989-098 and currently set forth in Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas; and WHEREAS, originally the missions of the CDAC and HSAC were distinct; however, in recent years their missions are strategically more similar than different in purpose and the separation of their activities into two committees causes procedural barriers and duplication of efforts; and WHEREAS, the City Council finds that it is in the public interest to abolish the CDAC by separate resolution and to repeal Article III, “Human Services Committee,” of Chapter 14 of the Code of the City of Denton, Texas by separate ordinance and further finds that it would promote improved communication, effectiveness and results to create a new committee to advise the City Council regarding a community-wide response to meet prioritized community needs; and WHEREAS, the City Council finds that it is in the public interest to create a new Community Services Advisory Committee to assure citizen participation in community services program development and resource allocation and to advise the City Council on programs, services, and use of public resources to address complex social problems such as economic instability, housing, and homelessness and for meeting community service needs; NOW THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY RESOLVES: SECTION 1. That there is hereby created a Community Services Advisory Committee to be composed of eleven (11) members, with each City Council member appointing one committee member and with the City Council appointing four at large committee members each by a vote of at least four (4) City Council members. A quorum of the committee members must be present to hold a committee meeting or to take committee action, with six (6) members considered a quorum. Members shall be appointed for two-year terms, except as provided herein at the inception of the committee. The committee members shall have staggered terms with seven (7) members being 606 appointed during odd numbered years and four (4) members being appointed during even numbered years. At the inception of the committee, the seven (7) members appointed by individual City Council members shall be appointed for a two (2) year term and the four (4) at large members shall be appointed for a one (1) year term. SECTION 2. That the Community Services Advisory Committee shall perform the following duties: A. To act in an advisory capacity to the City Council providing advice and making recommendations to address complex social problems such as economic instability, housing, and homelessness and for meeting community service needs; and B. To assess and prioritize local community needs, and to make recommendations to the City Council regarding a coordinated community-wide response to meet prioritized community needs; and C. To assess and make recommendations to the City Council regarding proposals for programs, services and projects for meeting the prioritized community needs; and D. To develop and utilize a comprehensive allocation assessment process for grant funding and other public resources to enhance accountability and effectiveness, and to make recommendations to City Council based on such assessment process for the allocation of federal, state and local funding and public resources annually and periodically, as appropriate or as necessary in emergency situations, to support a coordinated community- wide response to meet prioritized community needs; and E. To perform such other duties as specified from time to time by the City Council. SECTION 3. That with respect to any topic not covered by this resolution, to the extent applicable to the City’s advisory committees and the advisory committees’ members, the Texas Open Meetings Act, TEX. GOV’T CODE Chapter 551, the Charter of the City of Denton, the Code of the City of Denton, Texas including, but not limited to, Section 2-29 and Article III of Chapter 2, and the City of Denton Handbook for Boards, Commissions, and Council Committees, each as amended from time to time, shall govern with respect to the rules, procedures, operation and affairs of the Community Services Advisory Committee. SECTION 4. This resolution shall become effective immediately upon its passage and approval. The motion to approve this resolution was made by __________________________ and seconded by _________________________________. The resolution was passed and approved by the following vote [___ - ___]: 607 Aye Nay Abstain Absent Gerard Hudspeth, Mayor: Vicki Byrd, District 1: Brian Beck, District 2: Jesse Davis, District 3: Alison Maguire, District 4: Deb Armintor, At Large Place 5: Paul Meltzer, At Large Place 6: PASSED AND APPROVED this the _________ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Kendra Kennedy 608 Formation  of Community Services Advisory CommitteeCOMMUNITY SERVICESWORKING TO PROVIDE QUALITY AFFORDABLE HOUSING, A SUITABLE LIVING ENVIRONMENT, AND EXPANDING ECONOMIC OPPORTUNITY, PRINCIPALLY FOR PERSONS OF LOW TO MODERATE INCOME.609 COMMITTEE BACKGROUNDCOMMUNITY DEVELOPMENT ADVISORY COMMITTEEEstablished: 1978Composition: 9 members, 1 appointment per Council member and 2 at‐largeFunction: Make recommendations to City Council for Community Development GrantFunding Source(s):oCommunity Development Block Grant ProgramoHOME Investment Partnership Program oCommunity Development Block Grant CARES Act ProgramHUMAN SERVICES ADVISORY COMMITTEEEstablished: 1989Composition: 11 members, 1 appointment per Council member and 4 at‐largeFunction: Make recommendations to City Council for Human Services GrantFunding Source(s):oCity of Denton General FundoCommunity Development Block Grant ProgramID 21‐979, 21‐1552, 21‐1553610 COMMITTEE FUTUREThe goal of a single committee will:Optimize Existing City Resources.Reduce Duplication of efforts.Engage members around a year‐round, strategic conversation for a community‐wide coordinated response to identified community needs. Empower members to set measurable goals and achieve a greater sense of shared accountability of public resources.Facilitate a more informed and comprehensive resource allocation process.Facilitate resource allocation more quickly and efficiently. ID 21‐979, 21‐1552, 21‐1553611 SURVEY FEEDBACKCommittee members were asked to share feedback via survey regarding the proposed new committee ahead of the work session.14 of 20 (70%) members responded1.Do you think combining the Community Development and Human Services Advisory Committees would be beneficial? 86% Yeso12 Yes o2 No (1 requested additional information behind the proposal)2.Would you be willing to serve on a committee that meets more regularly to review items and provide feedback? 92% Yeso13 Yes o1 No Response (The member not returning)3.Suggestions/Recommendations:o7 (50%) – No suggestionso4 (29%) – Supportive of new committeeo1   (7%) – Requested additional informationo1   (7%) – Scheduling questions related to meeting commitment requirementso1   (7%) – Against the new committee ID 21‐979, 21‐1552, 21‐1553612 CDAC/HSAC JOINT MEETING FEEDBACKDiscussion on potential downside: oChange in current processes may not be desired by all and more meetings may impact time commitments for membersoAs a result forming new committee, some current members may not be selected to continue to serve. oFewer citizens involved in the conversationDiscussion in support:oAligns with Denton’s growth and changing needsoImproves responsiveness and use of City resources. Examples included: get funding out more quickly and efficiently, streamline processes, improve recommendations to meet community needs)oProvides staff with a committee to regularly seek advice and guidance for addressing complex social needs such as poverty, affordable housing, homelessnessoProviding better service to community with a better informed committee, making strategic recommendations to inform policy direction from Council Discussion on Size/Quorum: oWhat is the right balance to ensure community input while optimizing size for quorum. Recommendation for a minimum of 11, max of 15oDiscussed options for subcommittees and/or alternates and option to address quorum requirementsoClarification about reappointment process and what would be the impact to current members serving on new committeeDiscussion on Ex‐officio United Way: oMixed input to include a dedicated United Way ex‐officio roleoConsensus was to not include at this time but leave to the new committee to decide later (and amend resolution later if desired)Against:o1 Member by EmailID 21‐979, 21‐1552, 21‐1553613 CURRENT COMMITTEESID 21‐979, 21‐1552, 21‐1553COUNCIL CDAC Term HSAC Term1 (Byrd) Nancy Crisco (08/31/21‐p) HudspethAnne ScaggsNEW(08/31/21‐p) Johnson2 (Beck) Jane Piper‐Lunt(08/31/21‐2) BriggsGretchen Busl(08/31/22‐2) Baker3 (Davis) Doray Hill(08/31/22‐1) DavisPatricia LaBeau(08/31/21‐1) DavisWilling to step down4 (Maguire)Kimberly Lewis NEW(08/31/21‐p) McGuireRhonda Love(08/31/22‐2) Ryan5 (Armintor)John Catlin NEW(08/31/22‐p) ArmintorNathaniel Johnson(08/31/21‐p) Armintor6 (Meltzer)Fran Witte(08/31/21‐2) MeltzerWill not seek reappointmentMark Courts(08/31/21‐p) Meltzer7 (Hudspeth)Mary Beth Cottingham+(08/31/21‐3) Watts Terms out Aug 2021Roy Onyebetor+(08/31/21‐2) WattsAll – 1Randi Skinner(08/31/21‐2) BriggsDale Tampke(08/31/22‐p) DavisAll – 2Jodi Vicars‐Nance(08/31/22‐3) Baker  Jim Mann NEW(08/31/22‐p) RyanAll – 3Pat Cheek NEW(08/31/xx‐p) MeltzerAll ‐ 4Hannah Garcia*(08/31/22‐3) Baker*Chair +Vice Chair 614 TIMELINEJuly 27, 2021 –o1. Council approves Resolution to abolish CDAC, and o2. Council approves and Ordinance to repeal the HSAC, and o3. Council approves the Resolution to create the Community Services Advisory Committee August 2021 – City Secretary’s Office recruits members for new committee along regular appointment schedule September 2021 – New committee meets for the first time and initiates a annual calendarID 21‐979, 21‐1552, 21‐1553615 OPTIONS ID 21‐1552Approve the Resolution to abolish the CDACDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553616 OPTIONS ID 21‐1553Approve the Ordinance to repeal the HSAC Do not approve the OrdinanceID 21‐979, 21‐1552, 21‐1553617 OPTIONS ID 21‐979Approve the Resolution as presented to create the Community Services Advisory CommitteeApprove the Resolution with changesDo not approve the ResolutionID 21‐979, 21‐1552, 21‐1553618 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1538,Version:1 AGENDA CAPTION Consider approval of a resolution of the City Council of the City of Denton for the appointment of one member to the Board of Managers of the Denco Area 9-1-1 District for a two-year term beginning on October 1, 2021 and ending on September 30, 2023, and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™619 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Police Department / Public Safety Communications CM/ DCM/ ACM: Frank Dixon DATE: July 27, 2021 SUBJECT Consider approval of a resolution of the City Council of the City of Denton for the appointment of one member to the Board of Managers of the Denco Area 9-1-1 District for a two-year term beginning on October 1, 2021 and ending on September 30, 2023, and providing an effective date. BACKGROUND The Denco Area 9-1-1 District was created in 1987 and is governed by a board of managers appointed by the County, participating cities, and the Denton County Fire Chief's Association. Each year, the term of one of the two members appointed by participating municipalities expires. This year, the term of Ms. Sue Tejml expires on September 30, 2021. Board members serve in two-year staggered terms and are eligible for reappointment. Members are eligible for consecutive terms. Ms. Tejml has expressed her desire to serve another term. Staff sent an informal staff report to the City Council on May 10, 2021 requesting nominations. Since no nominations were sent to staff to place on a City Council agenda, no nominations were submitted to Denco. On June 1, 2021 the City received notice (Exhibit 3) from Denco requesting that the City vote for one of the nominees on the slate of nominees and advise them of its selection, if any, prior to July 30, 2021. Four nominees for the position were submitted by area cities. The nominees are Brandon Barth, Mark Klingele, Sue Tejml, and David Terre. The resumes of the nominees are included in Exhibit 3. The nominee with the most votes will be the municipalities’ representative to the District’s Board of Managers for the two-year term beginning October 1, 2021. OPTIONS Candidate Brandon Barth, nominated by the Town of Flower Mound Candidate Mark Klingele, nominated by the City of Corinth Candidate Sue Tejml, nominated by various cities and towns in Denton County Candidate David Terre, nominated by the City of The Colony PRIOR ACTION/REVIEW (Council, Boards, Commissions) None FISCAL INFORMATION City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 620 None EXHIBITS 1. Agenda Information Sheet 2. Resolution 3. Denco Area 9-1-1 District Letter dated June 1, 2021 4. Current Denco 9-1-1 Board of Managers 5. Presentation Respectfully submitted: Suzanne Kaletta Public Safety Communications Division Manager 621 RESOLUTION NO. _______________ A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF DENTON FOR THE APPOINTMENT OF ONE MEMBER TO THE BOARD OF MANAGERS OF THE DENCO AREA 9-1-1 DISTRICT FOR A TWO-YEAR TERM BEGINNING ON OCTOBER 1, 2021 AND ENDING ON SEPTEMBER 30, 2023, AND PROVIDING AN EFFECTIVE DATE. WHEREAS, Chapter 772 of the Texas Health and Safety Code provides that two voting members of the Board of Managers of an Emergency Communication District shall be appointed jointly by participating municipalities located in whole or in part of the District; and WHEREAS, it is the intent of the City of Denton, Texas to vote for a nominee to the Board of Managers for the Denco Area 9-1-1 District for a two-year term beginning on October 1, 2021 and ending on September 30, 2023; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY RESOLVES: SECTION 1. The City of Denton, Texas hereby votes for _________________________ as a member to the Board of Managers for the Denco Area 9-1-1 District to serve a two-year term beginning on October 1, 2021 and ending on September 30, 2023. SECTION 2: If any one or more sections or clauses of this Resolution is judged to be unconstitutional or invalid, such judgement shall not affect, impair, or invalidate the remaining provisions of this Resolution and the remaining provisions of this Resolution shall be interpreted as if the offending section or clause never existed. SECTION 3: That this Resolution shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________; the ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Mayor Gerard Hudspeth: ______ ______ ______ ______ Vicki Byrd, District 1: _____ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ 622 623 www.denco.org TO: Denco Area 9-1-1 District Participating Municipal Jurisdictions FROM: Greg Ballentine, Executive Director DATE: June 1, 2021 RE: Appointment to the Denco Area 9-1-1 District Board of Managers On March 31, 2021, the Denco Area 9-1-1 District requested municipalities to nominate a representative to the district board of managers for the two-year term beginning October 1, 2021. Denco received the following nominations by the May 31, 2021 deadline: Nominee City/Town Making Nomination Brandon Barth Town of Flower Mound Mark Klingele City of Corinth Sue Tejml City of Aubrey City of Highland Village City of Justin City of Krugerville City of Lewisville City of Oak Point City of Pilot Point Town of Argyle Town of Bartonville Town of DISH Town of Double Oak Town of Hickory Creek Town of Lakewood Village Town of Northlake Town of Providence Village Town of Trophy Club David Terre City of The Colony The Denco Area 9-1-1 District requests that each municipality vote for one of the candidates and advise the district of its selection by 5 p.m. on July 30, 2021. No votes will be accepted after that time. If a nominating municipality does not formally vote, it’s nomination will automatically count as a vote for its nominee. Please send a copy of the resolution recording council action. I have attached a sample resolution you may wish to use and resumes for the candidates. Also attached is a list of current board members. Please send a copy of your council’s office action to the Denco Area 9-1-1 District, 1075 Princeton Street, Lewisville, TX 75067 or to Melinda Camp at melinda.camp@denco.org. We will acknowledge receipt of all votes. Thank you for your assistance in this matter. 624 Council Resolution No. _________________ A RESOLUTION FOR THE APPOINTMENT OF ONE MEMBER TO THE BOARD OF MANAGERS OF THE DENCO AREA 9-1-1 DISTRICT. WHEREAS, Section 772, Health and Safety Code, provides that two voting members of the Board of Managers of an Emergency Communications District shall be appointed jointly by all cities and towns lying wholly or partly within the District; NOW THEREFORE BE IT RESOLVED BY THE COUNCIL OF THE CITY / TOWN OF ______________________________, TEXAS: Section 1 The City / Town of hereby VOTES TO APPOINT as a member of the Board of Managers of the Denco Area 9-1-1 District for the two-year term beginning October 1, 2021. Section 2 That this resolution shall become effective immediately upon its passage and approval. PASSED AND APPROVED this the _____ day of _____________________, 2021. Mayor ___________________________________________ City / Town of _____________________________________ ___________________________ City / Town Secretary 625 Brandon Barth, CEM® PROFILE SUMMARY Results-oriented, dependable professional with 15 years of emergency response and fire rescue experience. Certified and skilled in emergency management, media, and public relations. Possesses superior communication and multi- tasking skills with an acute attention to detail in a fast-paced, high-stress environment. PROFESSIONAL EXPERIENCE Flower Mound Fire Department, Flower Mound, TX Emergency Management Officer March 2014-Present •Leads, manages, directs, and supervises the functions and programs of the Emergency Management Division. •Assists in the development, planning, and implementation of Departmental goals and objectives. •Participates in the development and administration of the Emergency Management Division budget, including the financial planning for staffing, equipment, and supplies for the Emergency Management Division. •Responds to incidents and provides Emergency Management Support •Assists the Suppression Division during times of emergency as an officer of the Flower Mound Fire Department •Manages the Town’s Mobile Incident Command Vehicle and supervises the trained driver/operators of the vehicle. •Serves as the Public Information Officer for the Fire Department, providing news releases/statements, coordinates projects with the Town’s Communications Department, and oversees the FMFD website and social media accounts. •Oversees administrative compliance and scheduling of the AMBUS with the North Central Texas Trauma Regional Advisory Council and the State of Texas Emergency Medical Task Force. •Serves as the North Central Texas Trauma Regional Advisory Council’s Finance Committee Chair Elect. •Serves as a Medical Incident Support Team member as part of the Texas Emergency Medical Task Force. •Maintains information and Tier II reports on hazardous materials that are stored in the Town of Flower Mound and project manages hazardous materials spills within the Town. •Performs various special research projects and responsible for administering special programs. •Secures technical and financial assistance through grants and Public/Private partnerships. •Wrote the FY 2018 Staffing for Adequate Fire & Emergency Response (SAFER) Grant and was awarded $2,768,534.25 •Led the Flower Mound Fire Department’s COVID-19 vaccination efforts; vaccinating 1,200 people •Prepares and presents public awareness programs to civic groups, medical facilities, schools, and other organizations. •Reviews Special Event Permits and works with other Town departments to plan for special events and to prepare Special Event Emergency Operations Plans. •Examines potential disaster events and evaluates the effect on the Town. •Produces the Town's Debris Management Plan and master Emergency Operations Plan and 22 supporting Annexes. Plans the Town's response to disasters and ensures that all entities can respond as outlined in the Emergency Operations Plan. •Serves in the Town's Emergency Operation Center (EOC) as the EOC Manager, if activated. •Responsible for designing, training, and evaluation of periodic exercises to test elements of emergency plan. •Provides expert knowledge and advice to operating departments on special conditions and operating requirements that would be imposed by disasters. •Responsible for ensuring operability of 27 outdoor warning sirens and securing interlocal agreements and easements for the installation of sirens (installed 16 new sirens since 2014). •Manage the Town’s Everbridge emergency notification system. Attachment 2 626 Brandon Barth, CEM® • Serves as liaison with community, state and federal authorities concerned with disaster planning, response, and recovery. • Responsible for seeking FEMA reimbursement post-disaster or reimbursement from the State of Texas post- deployment of Town resources to other disaster or emergency events; over $1.3 million in the last 3.5 years • Secured Homeland Security grant funding for a debris response trailer for the Town’s Public Works Department as part of the region’s Public Works Emergency Response Team • Serve as the co-chair for the North Central Texas EOC Support Team Allied International Emergency, LLC – Fort Worth, TX May 2011- March 2014 Operations Manager September 2013-March 2014 •Managed the daily operations and supervised a staff of 8 employees for the Allied International Emergency’s corporate branch. •Oversaw 500+ annual hazardous materials and environmental remediation projects daily in a rapid paced environment with multiple deadlines. •Prepared bids and proposals to current and future customers. •Ensured that all supplies and equipment at the facility are in a constant state of operational readiness. •Provided response and laboratory reports to customers as well as state regulatory agencies regarding hazardous material/environmental incidents. •Executed service agreements with new customers during numerous emergency responses. •Maintained an up-to-date survey that tracks employees' training, certifications, fit tests, and physical exams to ensure conformance with OSHA regulations. •Conducted training classes for employees and customers on subjects such as hazardous materials, confined space entry, and fall protection. Project Manager May 2011-September 2013 •Managed personnel at various types of hazardous materials and environmental incidents ranging from tractor-trailer accidents to chemical plant fires per OSHA 1910.120 and requiring travel to various cities and states on a moment's notice. •Supervised projects through the emergency response, mitigation, remediation, and closure phases. •Oversaw the decontamination of Naturally Occurring Radioactive Materials (NORM) as a Radiation Safety Officer. •Performed confined space entry and confined space rescue standby as outlined by OSHA 1910.146. •Interacted with customers as well as state regulatory agencies such as the Texas Railroad Commission and the Texas Commission on Environmental Quality during hazardous materials incidents as well as environmental emergencies. •Responsible for the profiling and disposal of hazardous, non-hazardous, and RCRA E&P exempt waste streams. •Conducted sampling of water, air, and soil to determine potential contamination. •Wrote policies for new hires to the company. Attachment 2 627 Brandon Barth, CEM® Baldwin County Fire Rescue – Milledgeville, GA January 2005- March 2011 Full-time Firefighter/Public Information Officer January 2007-March 2011 •Presented a marketing/communications plan to the department's executive staff, thus creating the position of a PIO as well as creating the department's social media accounts. •Conducted interviews with local media outlets: newspaper, radio, and TV. •Wrote news releases and operated the department's social media site. •Redesigned the department's report writing system and making a quick reference guide to assist those. •Worked in conjunction with the Executive Staff of the fire department in projecting their message to the public. •Assisted with grant and compliance research on behalf of the executive staff. •Worked 24-hour shifts; responding to various types of emergency incidents including emergency medical calls, vehicle accidents, and fires. •Served as the acting-officer in charge; certified through the National Professional Qualifications Pro Board as a Fire Officer 1; overseeing the day-to-day tasks and emergency operations of the on-duty personnel when the shift officer was absent. •Served as part of the regional Hazardous Materials Team; certified through the National Professional Qualifications Pro Board as a Hazardous Materials Technician •Assisted in the training of firefighters; certified through the National Professional Qualifications Pro Board as a Fire Instructor 1. •Provided fire safety demonstrations and classes to children in the local school system. • Conducted pre-incident/safety inspections of commercial properties to assess dangers and to determine proper mitigation procedures based on building layout, hazards, and building construction. • Drove and operated fire apparatus to include engines, tankers, aerials, and rescue trucks. • Awarded Firefighter of the Year – Baldwin County Fire Rescue 2008-2009. Part-time/Volunteer Firefighter January 2005-January 2007 While pursuing bachelor's degree, worked part-time covering shifts for full-time personnel who were on leave. Was entrusted to work alone at stations in rural parts of the county that only had one person on-duty during a shift. Maintained attendance in more than 80% of emergency calls and training drills and responded to emergencies via notification by pager. EDUCATION Bachelor of Business Administration, International Business Georgia College & State University - Milledgeville, GA May 2007 PROFESSIONAL CERTIFICATIONS Certified Emergency Manager, International Association of Emergency Managers Fire Service Chief Executive Officer, Texas A&M Engineering Extension Service Advanced Professional Series, Federal Emergency Management Agency Professional Development Series, Federal Emergency Management Agency Amateur Radio License, Federal Communications Commission Advanced Structural Firefighter, Texas Commission on Fire Protection Advanced Fire Investigator, Texas Commission on Fire Protection Attachment 2 628 Brandon Barth, CEM® Fire Officer IV, IFSAC/Texas Commission on Fire Protection Fire Instructor II, IFSAC/Texas Commission on Fire Protection Incident Safety Officer, IFSAC/Texas Commission on Fire Protection Hazardous Materials Operations, IFSAC/Texas Commission on Fire Protection Firefighter II, IFSAC/Texas Commission on Fire Protection Emergency Medical Technician-Basic, National Registry and Texas Department of State Health Services Wildland Firefighter, Texas Commission on Fire Protection and Texas A&M Forest Service ICS 100, 200, 300, 400, 700, and 800, Federal Emergency Management Agency AWARDS AND COMMENDATIONS North Central Texas Council of Governments Regional Service Excellence Award International Association of Fire Chiefs Ready, Set, Go! Excellence Award Van Zandt County, TX Tornado Deployment Ribbon Hurricane Harvey Deployment Ribbon Flower Mound Fire Department “All In” Award Hurricanes Marco & Laura Deployment Ribbon El Paso, TX COVID-19 Deployment Ribbon Attachment 2 629 Mark C. Klingele 2711 Vistaview Dr. Corinth, TX 76210 Tel. 940.395.0846 mcklingele3@gmail.com _________________________________________________________________________________________________________ Objec&ve To be a valuable team member with an organization that is respected worldwide. Experience University of North Texas 1/2012 - 12/2019 ■Adjunct Professor ■Design, develop and teach courses in within the Alternative Dispute Resolution Program. Denton Fire Department 4/1983 – 7/2014 ■Deputy Fire Chief, Captain, Driver/Operator, and Fire Fighter. United States Air Force Ac&ve and Reserves 8/1977 - 5/1988 • Crash/Fire Rescue Fire Fighter, Driver/Operator, Station Captain, and Communications. Educa&on University of North Texas 2002 - 2011 ▪2011 Alternative Dispute Resolution University of North Texas ▪2007 Master of Business Administration University of North Texas ▪2002 Bachelor of Business Administration University of North Texas ▪2002 Staff and Command Maryland Fire & Rescue Inst. Na&onal Fire Academy 3/2008 ▪2008 Executive Fire Officer National Fire Academy TCFP Cer&fica&ons ▪Master Firefighter, Fire Service Instructor II, Driver/Operator, and ARFF Skills During my more than 31 years of municipal government experience I spent more than 5½ years managing a large organization including supervising more than 142 employees in communications, emergency medical intervention, emergency scene mitigation, financial management, budgeting, strategic planning, and emergency management. My certifications from Texas Commission on Fire Protection are currently inactive due to my retirement and should be able to renew based on affiliation. Since I obtained my Dispute Resolution Certificate from UNT I have had the opportunity to hone my negotiation, mediation, and problem solving skills through and in conjunction with the University of North Texas. As an Adjunct Professor I have become very comfortable in front of people and am able to handle any public speaking request. Resume 2021 630 Sue Rosson Tejml stejml@aol.com Cell: 940-368-1085 835 Orchid Hill Lane, Argyle-Copper Canyon, TX 76226-4526 Photo: March 2019 – photograph by Bill Castleman PERSONAL: Native Texan; Copper Canyon resident last 31 years Three adult children, seven grandchildren (ages 8-33) Married 60+ years to Emil Tejml (engineer & attorney) (In case you wondered, his Czech name rhymes - A mull TAY mull.) With corporate moves - we have lived in 4 states, 6 Texas cities, and worked abroad Stay-at-home mother, until I became an attorney at age 40. EDUCATION: University of Texas at Austin (B.A. History) Texas A&M University at Kingsville (M.A. History) Rice University (full scholarship for Ph.D. History, lack dissertation for Ph.D. degree) New York University Law School: 2 years, Top 10 United States Law School University of Houston Law School (LL.B. Degree.) MAYOR: Town of Copper Canyon for 14 years; re-elected unopposed 7th term 2017-2019 2004 Master Plan: Maintained Rural Feeling of Town north of FM 407 Town Center! MINIMUM ONE ACRE home lots for 15 years! 2019: 42% Town is Ag Exempt with fields, trees! “What’s Happening in Copper Canyon” For 14 years I have personally written this Monthly Mayor’s Column in the Cross Timbers Gazette, a local newspaper with 47,000 circulation. (Second in circulation in Denton County only to the Dallas Morning News.) My attempt to keep residents informed of events in our Town and subjects of general interest in our area – roads, water, gas well drilling, etc. Government transparency is my primary goal! Argyle Volunteer Fire District Board (Served 14 years, 2005 to 2019) Denton County Emergency Services District #1 Our small town’s dilemma was inability to adequately fund emergency services. ESD’s Founding Committee’s task was to educate residents on the benefits of an ESD. The ESD would collectively provide emergency fire and ambulance medical services to the towns of Argyle, Bartonville, Copper Canyon, Corral City, Northlake, and FWSD #6 and #7 in Lantana. But a specific property tax would be needed to fund it. ESD#1 was created in 2006 by a 62% positive vote in a district-wide special election over 65 square miles. Citizens voted themselves a tax increase for the specific benefit of Emergency Fire & Medicine. Neighborhood Watch and Crime Prevention Copper Canyon does not have a police department. Resident Block Captains were recruited for all 40 streets in town. Our Town Council contracted with the Denton County Sheriff for Deputies dedicated to Copper Canyon. Every shift a Deputy drives each street in Copper Canyon at least once and provides Rush Hour Traffic Patrol. Result is a virtually crime free community for past decade! Dallas Morning News: Copper Canyon named one of 10 Best Communities in DFW Metroplex! Spring 2016. Town rated #6 for safety – a prime concern for all individuals and families! Maintained Same Low Tax Rate for 6 Years (2014-2019): .297505 includes road bond. Under spend budget each fiscal year. Roll budget surplus into Road Fund or Crime Prevention Fund. 631 2009 Road Taskforce: Composed of one person from almost all 40 roads in Town. Town Wide Election approves $2.5 million bond to rebuild 90% of 25-35 year old asphalt interior residential roads. Standard & Poors rating AA- (now AA+.) Denton County funds $14 million to rebuild perimeter commuter roads through Town in concrete: Copper Canyon Rd, Orchid Hill Ln, Chinn Chapel Rd. Drafting Committee: 2010 “Best Practices for Municipalities and Gas Pipelines” A collaborative effort of Denton County Mayors, Commissioners Court, and the Texas Pipeline Association. Goal was to expedite safe pipeline construction, but with a minimal impact on landowners, local businesses, and future development plans of each city. All affected parties signed! Copper Canyon sponsors Annual Denton County Mayors Crime Luncheon: 7 years (2012-2019) Goal was to coordinate information on area crime between the Denton County Mayors, their Police Chiefs, Denton County Sheriff’s Office, Commissioners Court, Legislative representatives, and our Congressman Michael Burgess. CoServ Co-Sponsors this annual event with food & financial funds! DENCO 911: Vice Chair, Board of Managers. 8 years (2013-2021.) Elected to 4 terms by 32 Denton County city members. 2019 re-elected by unanimous vote of 24 of 28 City Councils voting. Personally update 8 city councils each year on our outstanding Denco 911 District! Recognized nationally! NENA - National Emergency Number Association: Attended 5 Texas & 5 National Conferences. LEGAL: Solo Attorney 15 years: General Civil Practice - family law, oil & gas, wills, probate, contracts Matagorda County Bar Association - President, Texas State Bar - CLE Committee, District 5 Admissions, Texas Bar Foundation Life Member FAMILY LAW: State Bar Board Certified in Family Law 10 years – Divorce and Child Custody Texas Supreme Court: Committees on Child Support Guidelines and on Child Visitation Guidelines MUNICIPAL: Bay City, Texas: City Attorney - 6 years. Estimated 18-20,000 population. Municipal Prosecutor & Legal Advisor to Police Department Home Rule Charter: City wide elected Public Office, Co-Chairman VOLUNTEER: Denton County CASA - Court Appointed Special Advocate for Abused Children Denton County Children’s Advocacy Center - Gave $10,000 for new Office HUG Romania – Volunteer in a Romanian orphanage for 3 weeks. INTERESTS: Home Design: Designed 5 of our family homes, including last one in Copper Canyon Misc.: Computer, cooking, dollhouse miniatures, hunting, organic gardening, new science Read: Biography, history, current political and global events, 1800’s British romance novels TRAVEL: Selected “Eisenhower People to People Ambassador” – Texas Representative to China’s Department of Justice. One-month tour of China for 50 United States women attorneys & judges. Visited for a week to a month each: Alaska, Australia, Bermuda, Beirut, Canada, China, Czech Republic, England, France, Germany, Greece, Hawaii, Ireland, Italy, Japan, Mexico, Norway, Romania, Russia, Saudi Arabia, Scotland, Singapore, South Korea, Switzerland, Tahiti, Turkey, Venezuela, Wales. Hope to visit: Africa, Argentina, Brazil, Egypt, India, Israel, New Zealand, Peru, Tasmania, Yangtze River. Love travel in our beautiful United States! Especially Texas Hill Country-Padre Island! Wish to see Big Bend! 632 See reverse David Terre 3941 Teal Cove The Colony, Texas 75056 972-740-4526 terre.david@yahoo.com O B J E C T I V E If elected to a fourth term, I will continue to work hard, be organized, use common sense, and always apply the golden rule. This approach has enabled me to make significant contributions during my previous three terms. E D U C AT I O N Drake University/ Moberly Community College BS-Business Administration and a Minor in economics E M P L O Y M E N T H I S T O RY Vice President of Sales | Wilson Sporting Goods Retired 46 Year Career Successfully retired after a wonderful 46 year career where I rose through the ranks to become Vice President of Sales responsible for all domestic sales. Directed European Sales Operations while living in Germany Experience in Marketing Achieved successful coordination of new product introductions Managed West Coast Distribution Operations L E A D E R S H I P The Colony City Council 2011-Present 2011 - Received the honor of being elected Mayor Pro Tem during my first term on City Council 2012 - Appointed to the Local Development Corporation Board of Directors to oversee new Grandscape (Nebraska Furniture Mart) Development 2013 - First Council Member from The Colony, Texas to be elected and serve on the Denton County Tax Appraisal District Board of Directors 2020 - Reelected to a 4th term on City Council receiving 86% of the total vote The Colony Planning & Zoning Commission 2008-2011 Served as Vice Chair 633 David Terre Page 2 H O N O R S  1982 – Drake University Basketball Hall of Fame  1994 – Moberly Community College Basketball Hall of Fame  1995-2003 – Three-time Senior Olympics Gold Medal Winner for USA Basketball Team  1999 – Wilson Wall of Fame Honor  2007- Moberly Community College Outstanding Alumni of the year  2013 –Washington High School Hall of Fame  2018 –Roaring Lambs Hall of Fame D C A D A C C O M P L I S H M E N T S I have worked with my fellow Board Members to achieve the following meaningful results:  Ensure a Quorum is established by being present at each meeting while achieving perfect attendance record.  Make informed decisions doing the necessary preparation prior to each meeting  Assisted in developing an Annual Operating Budget to ensure spending stays within budgeted funds while always looking for opportunities to reduce expenses  Participate in the development and evaluation of the Chief Appraisal Officer each year  To better serve Denton County Property owners, opened a convenient offsite location in the Lewisville Career Center to handle property tax protests  Launched an online service permitting property owners to file property tax protests electronically  Implemented a successful, structured flex work schedule as a benefit and morale Booster for ALL employees 634 Denco Area 9-1-1 District Board of Managers FY2021 Bill Lawrence, Chairman • Appointed by Denton County Commissioners Court • Member since October 2006 • Term expires September 2021 • Former Mayor of Highland Village • Businessman, Highland Village Sue Tejml, Vice Chair • Appointed by member cities in Denton County • Member since 2013 • Term expires September 2021 • Attorney at Law Chief Terry McGrath, Secretary  Appointed by Denton County Fire Chief’s Association  Member since October 2011  Term expires September 2021  Assistant Fire Chief, City of Lewisville Jim Carter • Appointed by member cities in Denton County • Member since October 2014 • Term expires September 2022 • President of Emergency Services District #1 • Former Mayor of Trophy Club and Denton County Commissioner Jason Cole • Appointed by Denton County Commissioners Court • Member since October 2020 • Term expires September 2022 • Businessman, Denton George Karatzis  Non-voting member appointed by largest telephone company (Verizon)  Member since 2021  Serves until replaced by telephone company  Director, Network Field Engineering, Verizon All voting members serve two-year terms and are eligible for re-appointment. 635 Denco Area 9-1-1 Board Nomination Suzanne Kaletta Public Safety Communications Division Manager Technology Services July 27, 2021 ID 21-1538, July 27, 2021 636 Background •The Denco Area 9-1-1 District was created in 1987 •Governed by Board of Managers, appointed by the County, participating cities, and the Denton Fire Chief’s Association •Each year the term of one of the two members appointed by municipalities expires •The term of Board Member, Sue Tejml expires on September 30, 2021 •Ms. Tejml is seeking reelection ID 21-1538, July 27, 2021 637 Background •On May 10, 2021 an informal staff report was submitted requesting nominees for the Denco Board of Managers •Since no nominees were sent to staff to place on a Council agenda, no nominations were submitted to Denco •Four nominees were selected by participating cities ID 21-1538, July 27, 2021 638 Objective •On June 1, 2021, the City received a request from Denco for a City vote on the slated nominees and then •Notify Denco of the Council’s selection by July 31, 2020 •Nominees: •Brandon Barth •Mark Klingele •Sue Tejml •David Terre ID 21-1538, July 27, 2021 639 Questions? Suzanne Kaletta Public Safety Communications Division Manager Technology Services ID 21-1538, July 27, 2021 640 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-791,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a Roadway Development Agreement between the City of Denton and Sagebrook Denton,LP,for the dedication and installation of transportation infrastructure at or adjacent to the Sagebrook Addition;authorizing the expenditure of funds therefor;authorizing acceptance of land and improvements;and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™641 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Capital Projects/Engineering DCM: David Gaines DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a Roadway Development Agreement between the City of Denton and Sagebrook Denton, LP, for the dedication and installation of transportation infrastructure at or adjacent to the Sagebrook Addition; authorizing the expenditure of funds therefor; authorizing acceptance of land and improvements; and providing an effective date. BACKGROUND On February 18, 2020, the City Council approved the annexation of a majority of the property that will ultimately be developed into the Sagebrook single-family residential development. Following annexation, the Planning and Zoning Commission approved preliminary plat PP20-0019 on September 16, 2020, which included approximately 490 single-family lots that will be developed in four different construction phases. On July 21, 2020, planned development PD20-0001f was approved that included the following key components: • 490 residential lots • Approximately 6.9 acres dedicated to homeowner’s association (HOA) amenity space – amenity center, ponds, walking trails (12.96 acres of total HOA open space) • Central 10-foot trail connection between future park and Brush Creek Road • Approx. 15.3 acres to be dedicated to City for future trail extension (12.8-acre floodplain) • Plugged gas well • Extension of Brush Creek Road and relocation of railroad crossing from Bonnie Brae to the future Brush Creek extension Final Plat FP20-0028a was approved on April 21, 2021, for phase 1 of the Sagebrook development. During the review of the final plat application and associated review of engineering plans for the first phase of the Sagebrook development, staff held several internal meetings and conversations with the Sagebrook developer regarding the sequencing of necessary roadway improvements. One of the key items discussed included the timing of the Brush Creek extension, which would require removal of the Bonnie Brae rail crossing and the opening of a new crossing at the future intersection of US 377. While the City’s Mobility Plan supports the Brush Creek extension, which would extend Brush Creek from US 377 to ultimately connect to Allred Road, there is not a current capital project or City funding identified to bring the project to fruition. Additionally, staff could not guarantee timing of Union Pacific Railroad’s (UPRR) review and City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 642 approval of the proposed closure of the current Bonnie Brae rail crossing and opening of the proposed Brush Creek rail crossing. The sole existing access point to the proposed Sagebrook development is Allred Road, which is currently in poor condition and needs to be reconstructed to commercial collector standards to accommodate planned growth in the area and align with proposed revisions to the Mobility Plan. The future Brush Creek extension will ultimately lead to a southern entrance of the Sagebrook development. Since timing of the Brush Creek extension cannot be guaranteed, a secondary interim access point will need to be identified once thirty homes are constructed to ensure compliance with 2012 International Fire Code Section D107. Sagebrook Denton, LP has proposed to construct an interim secondary access point off Bonnie Brae with the option to potentially relocate the secondary access point off Allred as construction progresses. To address the considerations described above along with other right-of-way dedication and improvement requirements, City staff and representatives from Sagebrook Denton, LP drafted a proposed Roadway Development Agreement outlining responsibilities of both parties. Key elements of the Roadway Development Agreement are described below and are further explained in Exhibit 2 (attached). Allred Road Developer Commitments: • Dedication of 20-80-foot-wide right-of-way to the City, with the portion of Allred Road right-of- way from Bonnie Brae to the neighborhood’s northern entry point dedicated with the first phase of the development. o Remaining dedication of Allred Road right-of-way will occur with earliest of the following scenarios: ▪ Filing of the final plat for the final phase of the development; ▪ Within 90 days of the City’s request for dedication if the City is able to substantiate proof of funding to design and construct Southwest Park or other projects located in the right-of-way; or ▪ Prior to the developer’s conveyance of ownership of any portion of the Allred Road right-of-way. • Construction of two lanes of Allred Road from Bonnie Brae to the Sagebrook development’s western boundary to commercial collector standards on a phase-by-phase basis. Construction will include a 25-foot wide portion of roadway, including a left turn lane and 8-foot sidewalks on the south side of Allred Road. o Prior to occupancy of the first home, construction will be completed from Bonnie Brae to the development’s northern entry point at “Oak Leaf Trail.” • Completion of a traffic impact analysis related to primary access of the development being from Allred Road due to unavailability of access from Brush Creek Road. o If warranted, developer will construct deceleration and acceleration to the development’s northern entry point of Allred at “Oak Leaf Trail.” • Construction of an access drive from Allred Road to Southwest Park as shown in the Southwest Park Master Plan. • Execution of a three-party development contract between the City, developer and developer’s contractor for the construction of developer’s portion of Allred Road and the associated 8-foot sidewalk. City Commitment: • Provide specific location of Southwest Park access drive by September 1, 2021. • Future completion of the reconstruction of Allred Road from Bonnie Brae to the end of the City limits to commercial collector standards. 643 Brush Creek Road (Brush Creek Extension) Developer Commitment: • Dedication of 120-feet of right-of-way width as shown on the preliminary plat. o Right-of-way dedication will be consistent with the final plat, with the remaining dedication to occur on a phase-by phase basis. City Commitment: • City to construct Brush Creek extension and associated UPRR rail crossing along with closure of existing Bonnie Brae rail crossing after funding is secured and the project is incorporated into the Capital Improvement Plan. Bonnie Brae Street Developer Commitment: • Construction of an interim secondary access drive to the first phase of the development in compliance with residential street specifications prior to the occupancy of the thirtieth home. o Developer will have the ability to relocate and install the secondary drive to Allred Road, which the developer or homeowner’s association will be required to remove once southern access at Brush Creek is available. Roadway Impact Fees Developer Commitment: • Developer has a Roadway Impact Fee assessment of $980,000.00 for the Sagebrook development. City Commitment: • City will grant Roadway Impact Fee credits in the amount of $417,600.00 for the dedication of Brush Creek Road right-of-way after such dedication is made. RECOMMENDATION Staff recommends approval of the Roadway Development Agreement with Sagebrook Denton, LP to ensure adequate right-of-way dedication and roadway improvements are made to accommodate the additional 490 homes and additional traffic generated by the proposed Sagebrook development. EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Ordinance Exhibit 3 – PP20-0019 Exhibit 4 – PD20-0001f Exhibit 5 – FP20-0028a Exhibit 6 – CEP21-0030 Exhibit 7 – Presentation Respectfully submitted: Rebecca Diviney, P.E. Director Capital Projects/City Engineer Prepared by: Rachel Wood, Deputy Director of Capital Projects 644 ORDINANCE NO.__________ AN ORDINANCE OF THE CITY OF DENTON AUTHORIZING THE CITY MANAGER TO EXECUTE A ROADWAY DEVELOPMENT AGREEMENT BETWEEN THE CITY OF DENTON AND SAGEBROOK DENTON, LP, FOR THE DEDICATION AND INSTALLATION OF TRANSPORTATION INFRASTRUCTURE AT OR ADJACENT TO THE SAGEBROOK ADDITION; AUTHORIZING THE EXPENDITURE OF FUNDS THEREFOR; AUTHORIZING ACCEPTANCE OF LAND AND IMPROVEMENTS; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, Sagebrook Denton, LP (the “Developer”), owns and is currently developing a 143.133 acre parcel of property within the City of Denton, known as Sagebrook Addition, and requests to dedicate and construct certain public roadways in accordance with the City’s Code of Ordinances; and WHEREAS, the Developer proposes to dedicate and construct portions of Allred Road, construct access drives, and dedicate right-of-way for Brush Creek Road in exchange for roadway impact fee credits; and WHEREAS, the City of Denton and Developer have negotiated the Agreement for the mutual benefit of the parties and the general public, WHEREAS, the City Manager recommends, and the City Council deems it in the public interest that the City enter into the Roadway Development Agreement attached hereto; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The findings and recitations contained in the preamble of this Ordinance are incorporated herein by reference. SECTION 2. The City Manager is hereby authorized to execute on behalf of the City, the Roadway Development Agreement as attached hereto and incorporated by reference herein. SECTION 3. The City Manager, or her designee, is hereby authorized to receive dedication of right-of-way and improvements, make expenditures, and to undertake the obligations as set forth in the Roadway Development Agreement in accordance with the terms of the Roadway Development Agreement. SECTION 4. This Ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________, the ordinance was passed and approved by the following vote [___ - ___]: DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 645 Aye Nay Abstain Absent Gerard Hudspeth, Mayor: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _____ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Digitally signed by Mack Reinwand Date: 2021.07.23 13:00:55 -05'00' DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 646 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 647 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 648 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 649 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 650 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 651 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 652 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 653 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 654 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 655 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 656 Digitally signed by Mack Reinwand Date: 2021.07.23 13:00:31 -05'00' DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E Capital Projects - Engineering City Engineer - Capital Projects 7/23/2021 657 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 658 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 659 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 660 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 661 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 662 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 663 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 664 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 665 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 666 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 667 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 668 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 669 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 670 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 671 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 672 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 673 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 674 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 675 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 676 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 677 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 678 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 679 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 680 DocuSign Envelope ID: 0C1383D9-43C7-46BA-9697-1D99A38BE35E 681 APPROX. SURFACE LOCATION OF MCCUTCHIN WELL NO. 1H PER WELL LOCATION PLAT PREPARED FOR REICHMAN PETROLEUM CORP. DATED 10-26-05 (WELL HEAD NOT OBSERVED AT TIME OF SURVEY) B.B.B. & C. R.R. Co. SURVEY ABSTRACT No. 160 APPROXIMATE SURVEY AND CITY LIMIT LINE DENTON COUNTY CITY OF DENTON 18222 PROJECT SITE PRELIMINARY PLAT L E G E N D 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 682 APPROXIMATE LOCATION OF UNDEFINED EASEMENT TO D.A. LITTLE AND R. MURRY JOHNSON FOR TELEPHONE LINES ALONG THE SOUTH AND WEST SIDE OF THE PUBLIC ROAD RIGHT-OF-WAY AND IN LINE WITH FENCE ON NORTH AND EAST SIDE OF LAND. VOL. 304, PG. 122 ~ D.R.D.C.T. (Item 10h) APPROXIMATE LOCATION OF 20' CITY OF DENTON PUBLIC UTILITY EASEMENT VOL. 5406, PG. 6400 R.P.R.D.C.T. (Item 10l) ∆ 18222 PROJECT SITE 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 683 BARNETT GATHERING COMPANY, LLC 2.693 ACRE SURFACE SITE EASEMENT DOC. NO. 2004-143401 O.R.D.C.T. (Item 10n) 30' ENERGY TRANSFER, L.P. EASEMENT DOC. NO. 2006-43510 DOC. NO. 2007-17522 DOC. NO. 2007-27998 O.R.D.C.T. 0.129 AC. ENERGY TRANSFER, L.P. SURFACE SITE EASEMENT DOC. NO. 2006-43510 DOC. NO. 2007-17522 DOC. NO. 2007-27998 O.R.D.C.T. 30' ENERGY TRANSFER, L.P. EASEMENT DOC. NO. 2007-109012 O.R.D.C.T. 30' ENERGY TRANSFER, L.P. EASEMENT DOC. NO. 2006-43510 DOC. NO. 2007-17522 DOC. NO. 2007-27998 O.R.D.C.T. JAMES SEVERE SURVEY ABSTRACT NO. 1164 APPROXIMATE SURVEY LINE D E N T O N C O U N T Y C I T Y O F D E N T O N APPROXIMATE SURVEY AND CITY LIMIT LINE DENTON COUNT Y CITY OF DENTON A PPR O XIMATE C ITY L IMIT LINE 18222 PROJECT SITE 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 684 ZONE X(UNSHADED)ZONE AZONE X (UNSHADED) Z ONE AZ ONE X( UNSHADED) APPROXIMATE LIMITS OF 100 YEAR FLOODPLAIN PER FEMA MAP ZONE A B.B.B. & C. R.R. CO. SURVEY ABSTRACT No. 159 HENRY H. HAGGOOD SURVEY ABSTRACT No. 517 B.B.B. & C. R.R. CO. SURVEY ABSTRACT No. 160 APPROXIMATE SURVEY LINE APPROXIMATE SURVEY AND CITY LIMIT LINE APPROXIMATE SURVEY AND CITY LIMIT LINE DENTON COUNTY CITY OF DENTON DENTON COUNTY CITY OF DENTON 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. 18222 PROJECT SITE PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 685 18222 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 686 STREET (50' R.O.W.) STREET (50' R.O.W.) 18222 “ “ ” ” ” “ ” ” ” “ ” ” “ ” ” “ ” ” ” ” ” ” “ ” ” ” ” ” ” ” 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 687 ZONE AZONE A ZONE X (UNSHADED) ZONE A ZONE X(UNSHADED) APPROXIMATE LIMITS OF 100 YEAR FLOODPLAIN PER FEMA MAP ZONE A PHASE II PHASE IA PHASE IV PHASE III B.B.B. & C. R.R. CO. SURVEY ABSTRACT No. 159 HENRY H. HAGGOOD SURVEY ABSTRACT No. 517 B.B.B. & C. R.R. Co. SURVEY ABSTRACT No. 160 B.B.B. & C. R.R. CO. SURVEY ABSTRACT No. 160 JAMES SEVERE SURVEY ABSTRACT NO. 1164 APPROXIMATE SURVEY LINE APPROXIMATE SURVEY LINE APPROXIMATE SURVEY LINE APPROXIMATE SURVEY LINE APPROXIMATE SURVEY LINE ∆ PHASE IB PHASE IA PHASE III PHASE IV PHASE II 18222 PROJECT SITE 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.gacon.com www.mcadamsco.com The John R. McAdams Company, Inc. PRELIMINARY PLAT Planning Approved 09/16/20 Hayley Zagurski PP20-0019 P&Z Approved 09/16/20 PP20-0019 P&Z Approved 09/16/20 Hayley Zagurski 688 S:\Legal\Our Documents\Ordinances\20\PD20-0001 Rezoning Ordinance For Sagebrook - FINAL.Docx ORDINANCE NO. PD20-0001f AN ORDINANCE OF THE CITY OF DENTON, TEXAS REGARDING AN INITIAL ZONING OF PLANNED DEVELOPMENT (PD) DISTRICT ON APPROXIMATELY 128.94 ACRES AND A ZONING CHANGE FROM RESIDENTIAL 6 (R-6) DISTRICT TO PLANNED DEVELOPMENT (PD) DISTRICT ON APPROXIMATELY 14.19 ACRES, FOR A TOTAL OF APPROXIMATELY 143.14 ACRES OF LAND GENERALLY LOCATED SOUTH OF ALLRED ROAD AND WEST OF SOUTH BONNIE BRAE STREET AND FORT WORTH DRIVE, IN THE CITY OF DENTON, DENTON COUNTY, TEXAS; ADOPTING AN AMENDMENT TO THE CITY'S OFFICIAL ZONING MAP; PROVIDING FOR A PENALTY IN THE MAXIMUM AMOUNT OF $2,000.00 FOR VIOLATIONS THEREOF; PROVIDING A SEVERABILITY CLAUSE AND AN EFFECTIVE DATE. (PD20-0001; Sagebrook) WHEREAS, Douglas Powell of McAdams, applied on behalf of property owner, Sharon Losak McCutchin, in her capacity as (i) Trustee of the Tamara McCutchin Saxe Trust and (ii) Trustee of the McCutchin Marital Non Exempt Trust, for an initial zoning of Planned Development PD) District on approximately 128.94 acres and for a zoning change from Residential 6 (R-6) District to Planned Development (PD) District on approximately 14.19 acres, for a total of approximately 143.14 total acres of land legally described in Exhibit "A," attached hereto and incorporated herein by reference (hereinafter, the "Property"); and WHEREAS, on May 6, 2020, the Planning and Zoning Commission, in compliance with the laws of the State of Texas, gave the requisite notices by publication and otherwise, and held due hearings and afforded full and fair hearings to all property owners interested in this regard, and postponed discussion and making a recommendation on this application to May 20, 2020; and WHEREAS, on May 20, 2020, the Planning and Zoning Commission postponed making a recommendation on this application to June 3, 2020; and WHEREAS, on June 3, 2020, the Planning and Zoning Commission postponed making a recommendation on this application to July 8, 2020; and WHEREAS, on July 8, 2020 the Planning and Zoning Commission reviewed this application and recommended approval [6-1 ] of the initial zoning and zoning change; and WHEREAS, on July 21, 2020, the City Council likewise conducted a public hearing as required by law, and finds that the request meets and complies with all substantive and procedural standards for a rezoning to PD set forth in Section 2.7.3 of the Denton Development Code, and is consistent with the Denton Plan 2030 and the Denton Development Code; WHEREAS, the Planning and Zoning Commission and the City Council of the City of Denton, in considering the application for a change in the zoning classification of the property , have determined that the proposed use is in the best interest of the health, safety, morals, and general welfare of the City of Denton, and accordingly, the City Council of the City of Denton is of the opinion and finds that said zoning change is in the public interest and should be granted as set forth herein; NOW THEREFORE, 689 THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The findings and recitations contained in the preamble of this ordinance are incorporated herein by reference and found to be true. SECTION 2. The initial zoning district and use classification is Planned Development PD) on 128.94 acres of the Property and the zoning district and use classification is changed from R6 District to PD District on 14.19 acres of the Property. The Development Standards for the PD are described in Exhibit "B," attached hereto and incorporated herein by reference, and the PD Development Plan Map is depicted in Exhibits "C" and "D," also attached hereto and incorporated herein by reference. Conceptual landscape, tree preservation, fence, trail, and amenity plans are depicted in Exhibits "E" through "P," also attached hereto and incorporated herein by reference. Development of the Property shall be in accordance with the standards in Exhibit "B" and the Development Plan Map and conceptual plans shown in Exhibits "C" through "P". SECTION 3. The City's official zoning map is hereby amended to show the changes in the zoning district and use classification. SECTION 4. If any provision of this ordinance or the application thereof to any person or circumstance is held invalid by any court, such invalidity shall not affect the validity of the provisions or applications, and to this end the provisions of this ordinance are severable. SECTION 5. Any person, firm, partnership or corporation violating any provision of this ordinance shall, upon conviction, be deemed guilty of a misdemeanor and shall be punished by fine in a sum not exceeding $2,000.00 for each offense. Each day that a provision of this ordinance is violated shall constitute a separate and distinct offense. SECTION 6. That an offense committed before the effective date of this ordinance is governed by prior law and the provisions of the Denton Code of Ordinances, as amended, in effect when the offense was committed and the former law is continued in effect for this purpose. SECTION 7. In compliance with Section 2.09(c) of the Denton Charter, this ordinance shall become effective fourteen (14) days from the date of its passage, and the City Secretary is hereby directed to cause the caption of this ordinance to be published twice in the Denton Record - Chronicle, a daily newspaper published in the City of Denton, Texas, within ten (10) days of the date of its passage. Page 2 of 3 690 The motion to approve #tthm, ordina e was made by and seconded by, the rdinance was passed d approved by the following -]: Aye Nay Abstain Absent Mayor Chris Watts: , Gerard Hudspeth, District 1: Keely G. Briggs, District 2: Jesse Davis, District 3: John Ryan, District 4: Deb Armintor, At Large Place 5:_ Paul Meltzer, At Large Place 6: PASSED AND APPROVED this the day of ATTEST: ROSA RIOS, CITY SECRETARY BY: APPROVED AS TO LEGAL FORM: AARON LEAL, CITY ATTORNEY BY: CHRIS WATT", AYOR 40, Page 3 of 3 N. I 2020. 691 EXHIBIT A Legal description for McCutchin Tract 143.137 Acres BEING all that certain lot, tract or parcel of land situated in the B.B.B. & C.R.R Company Survey, Abstract No. 160, Denton County, Texas, and being part of a called 147.58 acre tract of land described in deed to Sharon McCutchin, Sole Trustee of the Tamara McCutchin Saxe Exempt Trust and the McCutchin Non Exempt Trust, as recorded in Document Nos. 2009-95582 and 2013-9779 of the Official Records, Denton County, Texas and being more particularly described as follows; BEGINNING at a 1/2" rebar found with cap stamped "TN&P" at the northwest corner of said 147.58 acres, same being in the east line of a called 34.937 acre tract of land described in deed to Angela Dominguez and Michael John Barber recorded in Document No. 1999-58950, Official Records, Denton County, Texas from which a 1/2 inch rebar found at the northeast corner thereof bears N 00°11'20" W, a distance of 19.91 feet; THENCE N 89°59'20" E, a distance of 3556.55 feet to a 1/2" rebar with cap stamped "TN&P" found in the east line of a called 0.317 acre tract of land described in deed to the City of Denton, recorded in Document No. 2004-149094, Official Records, Denton County, Texas ; THENCE S 01°01'40" E, with the west line of said 0.317 acre tract a distance of 34.99 feet to a 1/2" rebar found with cap stamped "Alliance"; THENCE S 05°24'10" E, continuing with the west line of said 0.317 acre tract a distance of 173.20 feet to a 1/2" rebar set with cap stamped "McAdams"; THENCE S 01°05'50" W, continuing with the west line of said 0.317 acre tract a distance of 369.64 feet to a 1/2" rebar found; THENCE southeasterly with a curve to the left having a radius of 179.30 feet, a central angle of 13°34'05", an arc length of 42.46 feet and whose chord bears S 05°41'04" E, a distance of 42.36 feet to a PK nail found in the west line of the Texas & Pacific railroad; THENCE S 27°30'30" W, with the west line of said Texas & Pacific railroad a distance of 1415.80 feet to a cross tie fence corner post being in the northeast corner of a called 93.95 acre tract of land described in deed to Angela Dominguez and Michael John Barber recorded in Document No. 2004-11388, Official Records, Denton County, Texas; 692 THENCE S 88°46'25" W, with the north line of said 93.95 acre tract passing a 1/2" rebar found at a distance of 2083.75 feet, being the northwest corner of said 93.95 acre tract same being the northwest corner of a called 13.64 acre tract of land described in deed to Angela Dominguez and Michael John Barber recorded in Document No. 2003-208519, Official Records, Denton County, Texas and continuing a total distance of 2910.96 feet to a 1/2" rebar set with cap stamped "McAdams; THENCE N 00°11'20" W, a distance of 597.66 feet; THENCE N 89°38'30" E, a distance of 390.63 feet; THENCE northwesterly with a curve to the left having a radius of 1062.00 feet, a central angle of 41°03'47", an arc length of 761.12 feet, and whose chord bears N 25°44'15" W, a distance of 744.93 feet; THENCE northwesterly with a curve to the right having a radius of 688.00 feet, a central angle of 21°25'35", an arc length of 257.28 feet, and whose chord bears N 15°55'03" W, a distance of 255.79 feet; THENCE N 00°11'20" W, a distance of 424.24 feet to the POINT OF BEGINNING and containing approximately 143.137 acres of land. PD Amendment 693 EXHIBIT B Development Standards for P D20-0001 SAGEBROOK —Planned Development (PD) District For 143.137 Acres City of Denton, Denton County, Texas SECTION 1: Purpose. The regulations set forth in this section of the development standards are for the Planned Development PD) District. This Planned Development (PD) District provides for development standards for the above referenced tract which is comprised of the McCutchin Tract that total 143.137 acres and is provided as Exhibit A. The regulations for the R6 - Residential District and all other provisions of the City of 2019 Denton Development Code (DDC) effective date 10/11/2019, shall apply except as modified herein. Deviations from the City of Denton's Transportation Criteria Manual for standard street and sidewalk sections are proposed within this plan. Street and sidewalk sections identified within this planned development (PD) are subject to approval at platting. The proposed subdivision layout is shown on the Development Plan Map sheets provided as C and D. SECTION 2: Use Regulations. Allowable uses shall be limited to single-family detached; park, playground, open space; amenity center; and those accessory and temporary uses permitted in R6 — Residential. SECTION 3: Maximum Density. The maximum number of Single -Family Detached Dwellings shall be Four -hundred Ninety (490) for a maximum density of 3.43 dwelling units per acre. Open Space/Homeowner's Association (HOA) lots do not count against the Maximum Density. SECTION 4: Dimensional Standards. If not specifically stipulated below, Dimensional Standards shall follow the R6 Zoning District as stated in DDC Section 3.2.6. Minimum Front Yard Setback (Sec 3.7.3) 20 feet Minimum Side Yard Setback' (Sec 3.7.3) 5 feet Lot Width (Sec 3.7.2) 50 feet PD Amendment 3 694 Notes: 1) Minimum Side Yard Setback shall be 10' on corner lots. 2) Lot Width shall be measured at the building setback for cul de sac or knuckle lots. SECTION 5: Tree Preservation and Landscape Standards. The development will comply with the DDC Section 7.7.4. The Developer shall submit a detailed tree survey prepared and submitted with the preliminary plat that complies with the Tree Preservation Plan attached as Exhibit F. Preparation of the final plat and construction drawings will be used to establish actual tree removal. In addition to the landscaping requirement so the DDC, the following regulations shall apply along with those listed is Section 7 below: 1. Street Trees Street trees will be planted with a spacing of one tree per thirty -feet (30'). These trees will be the responsibility of the homebuilder at time of home construction. Street trees shall be constructed within the parkway, four -feet (4') off of the back -of -curb. The trees will be a minimum of three caliper inches, measured 12 inches off of the root ball. The species will be selected according to the approved street tree list as shown on the Parkway Tree List as provided as Exhibit N. 2. Front Yard Landscaping Minimum Requirements Trees One 2 inch caliper tree measured 12 inches from the ground. Medium Shrubs 12 three- to five -gallon shrubs. Border plants 10 one -gallon perennial plants. Lawn Sod is required. Ground cover is permitted up to 30 percent. Gravel is not permitted. Lawns must have a minimum of 30% pervious coverage. 3. Corner Lot Landscaping Requirements In addition to the minimum front yard requirements, corner lots shall comply with the following: Ornamental trees Two 1% inch Crepe Myrtle, Red Bud, Mexican Plum, Desert Willow, etc. (in addition to parkway trees). PD Amendment 4 695 Evergreen landscaping All side yard foundations visible from the street on corner lots Wood fencing must be screened. Fencing All wrought iron style fences on corner lots must be accompanied by an evergreen hedge or other evergreen landscape that will mature to a minimum height of six feet. SECTION 6: Building Design Regulations. Building Design shall be per the DDC, Subchapter 7: Development Standards. 1. Sidewalks A minimum four -foot wide all-weather walkway shall be constructed from the front porch to either the driveway or the sidewalk in the parkway. 2. Fencing There are several fencing types based on location and adjacent land use within the development. Below are the fence requirements for lots, development perimeter fencing is described in section 8.3. For lots adjacent to the development perimeter, open space, and/or neighborhood entrances, fencing shall be consistent with Exhibit M. The following table applies to the fencing requirements for all other lots: Corner lots Corner lots that side up against a street shall have wood fencing consistent with the requirements listed below. Wood fencing Wood fencing is required between homes, along the side yard lot lines and rear yard lot lines. The wood fence must be a minimum of six-foot (6') and a maximum of eight -foot (8') tall Cedar or Spruce on galvanized metal poles. The side without poles must face out when adjacent to vacant lots or visible from the ROW. Fencing may not be placed within ten -feet (10') of the front elevation of the house. SECTION 7: Amenities. The following community amenities are being provided for in the development. The Sagebrook development is directly adjacent to the City's Southwest Park. 1. Open Space adjacent to Brush Creek. An approximately 666,468 square feet (15.30 acres) in area of land adjacent to Brush Creek on the southern edge of the property is to be dedicated to the City. The Parks Department is interested in the land to expand and extend the master plan trail system for the area. PD Amendment 5 696 2. HOA Areas. Interior to the development is a primary open space devoted to the community's amenity center and generally located at the southeast corner of the site providing for a visual impact from US 377 and Brush Creek Road. A smaller open space area is located on the northeast corner of the property. The open spaces can be seen on the Conceptual Landscape Plan as provided as Exhibit E. All of the open spaces and HOA lots will be landscaped and maintained by the HOA and consists of approximately 12 acres of land, including the landscape buffers. The first and primary open space is located and intended as a primary focal point of the community near the entrance to the community. This primary area will be devoted to recreation including an amenity center with pool and changing room cabana, walking trails, landscaping improvements and may also include shade structures, playground type facilities consisting of basketball/play courts, playground type equipment or a combination thereof. The existing pond located within this open space area will be improved by adding a fountain for aesthetics and aeration to provide an additional amenity to the community. This area will be connected to Allred Road and the proposed Southwest Park by a boulevard roadway that will contain a 10' hike/bike trail. A second open space is provided near the northeast corner of the property. This area will include an improved retention pond enhanced with landscaping and a perimeter sidewalk with benches. Internal sidewalks and the proposed 10' trail will provide connectivity throughout the community. The north, south and east perimeter of the development will include landscape buffering adjacent to the boundary streets and railroad. The landscaping for these areas are reflected in Exhibit E, the corresponding fencing and wall treatment is indicated on Exhibit M. The trees in this area will be spaced every 30 linear feet. The trees in the area between the railroad and Sage Trail along Brush Creek may be grouped within the adjacent HOA x -lot. The primary community entrances will include medians, subdivision monument signs and enhanced landscaping as indicated in Exhibit H. Special treatment and location of enhanced plantings will be provided within the linear park to provide a pleasant experience for pedestrians and to ensure that there is adequate visibility at the road crossings. SECTION 8: Development Standards. 1. Street Standards The development will be comprised of local Residential Streets that are a maximum of thirty-one feet wide (31' back to back) and constructed in a maximum fifty foot right-of-way (50' ROW). 2. Sidewalk Standards A five-foot (5') wide concrete sidewalk along both sides of the street will be standard throughout the Sagebrook development. Pedestrian pathways associated with the Open Spaces will be a minimum of five -feet (5') wide and will be constructed either of concrete, crushed granite, or other suitable surface. A ten -foot (10') wide hike/bike trail section will be constructed in the PD Amendment 697 center median of the north -south boulevard. Enhanced crosswalks and signage will be provided for the hike/bike trail. Exterior to the site a sidewalk will be constructed along the north side of Brush Creek Road and no sidewalk will be constructed along Bonnie Brae Road or Allred Road by the Developer. 3. Perimeter Fencing Perimeter fencing will be provided along all sides of the development that abuts an existing right- of-way or the railroad tracks. The perimeter fencing will be maintained by the HOA. The fencing along the roadways will be a combination of masonry, tubular steel, or board on board as shown on the Site Fencing Exhibit as provided and reflected in Exhibit M. Perimeter fence along Masonry wall along lots that back up to the roadway and tubular Brush Creek. steel along lots that back to open space, with a height of six -feet 6'). Perimeter fence along Solid wooden fence, board -on -board, with a height of six -feet Allred, Bonnie Brae, & 6'). Masonry columns will be placed at the interaction of the railroad. perimeter fence and property lines along the Allred frontage. Adjacent to open Tubular steel fence, with a height of six -feet (6'). space areas. 4. Lot Grading Mass grading (benching) of lots will occur within the proposed phases of the development. Four phases are anticipated as shown on the Development Plan. No grading is anticipated within the x -lot south of the Brush Creek extension right-of-way dedication. SECTION 9: Existing on-site gas well. The abandoned gas well has been plugged in accordance with all applicable local, state and federal law. The location is within a lot that will be dedicated to the HOA. SECTION 10: Development Schedule. The proposed development is projected to be built in four phases as shown on Exhibits C and D. Phase 1 projected to begin in 2020 and built out by 2029. Two lanes of Brush Creek Road are to be constructed along with the phases as shown on Exhibits C and D. The off-site sewer extension will be completed with Phase 1, and all other public infrastructure will be constructed as required by phase. Park land and trail dedications as well as coordination of the railroad crossing and signal participation at Brush Creek and Highway 377 will be determined during the platting process. PD Amendment 698 AO A O Oto m CITY OF DENTON, TEXAS n o u CALLED 196.467 ACRES m m DOC. NO. 2008-123172 z O. R. D. C. T. t7 a _ mar ^• _ I to kI 4 (1 Propos Pond l .7 I G I II to k SEM I / ty. 7EWALKEAPII BIO I.18t A t 1 rr we-,31'tz-Ro t I I OC ` \/ I ty 31 ffDD a to k 1 Blo ty' 6 / Bloc Qty 17 Qty. 21 1 / I I I I 1 SIDEWALK A C rr / Pond _ I X I Open z Space / I 319.19 HOA g Lot 359.14" A s oX 1 I \ 359.14' 557.0' _ OWND DEVELOP ER U - ZENA LAND DEVELOPMENT LP TWO LANES OF BRUSH CREEK 218WEST WAL STREET GRAPEVNE, TEXASPROVEEN _ _ / Ph. (8171 873-0520 contact Roo Banat - NOTE* 1. Discharge from any detention pond outfall or storm drain outfall may require an offsite drainage easement to accommodate the flow. If an offsite drainage easement is required, a study shall be made of the off-site property to determine the size of the drainage easement to accommodate the flow. 2. Acceptance of the drainage features identified on the Planned Development Exhibits and Plans are subject to change during the platting process and do not constitute subsequent approval of same. The City reserves the right to require additional data or studies to ensure compliance with City of Denton Subdivision and Land Regulations, Drainage Criteria and Comprehensive Master Drainage Plan. 3. Deviations from the City of Denton's Transportation Criteria Manual for standard street and sidewalk sections are proposed within this plan. Street and sidewalk sections identified within this planned development (PD) are subject to approval at platting. 4. The Sagebrook development shall dedicate the right-of-way for the Brush Creek extension with each phase of development as described in the approved PD, and as such, the right-of-way dedication shown hereon shall only apply to the Sagebrook property and shall not be interpreted or otherwise implied as right-of-way dedication of any part of the adjacent properties. OPOSE LSUFF V Q B6, m Q v) 100 0 100 200 300 Feel SCALE :1 •'=100' Lo[Requirements W Total Units W of Total Area I Min. Lot Min. Lot Building Setbacks VV LLJ QPQS Q Area Width Pads (F/S/R) m2`P Oo`' pry ,moo A AC 8.0% O OZ: k l B ACC 22 4.5% 32.6' OPOSE LSUFF V Q B6, m Q v) 100 0 100 200 300 Feel SCALE :1 •'=100' Vicinity Map 1'.1000' EXHIBIT C Concept Plan SAGEBROOK Denton, Texas NAJUNE2020 McADAMS Lo[Requirements Unit Quantity Total Units Acres of Total Area Min. Lot Min. Lot Building Setbacks Area Width Pads (F/S/R) A 39 8.0% 6,000 SO 3,200 20/5/10 B 6,000 SO 3,200 20/S/10 22 4.5% C 6,000 50 3,200 20/5/10 26 5.3% 0 6,000 50 3,200 20/5/10 25 5.1% E 6,000 50 3,200 20/5/10 24 4.9% F 6,000 50 3,200 20/5/10 21 4.3% G 6,000 50 3,200 20/5/10 18 3.7% H 6,000 50 3,200 20/S/10 22 4.5% 6,000 50 3,200 20/5/10 21 5.5% 102.47 71.6% 1 6,000 SO 3,200 20/5/10 91 18.6% K 6,000 50 3,200 20/5/10 18 3.7% L 6,000 50 3,200 20/5/10 37 7.6% M 6,000 50 3,200 20/5/10 31 6.3% N 6,000 50 3,200 20/5/10 25 5.1% 0 6,000 50 3,200 20/5/10 21 4.3% P 6,000 50 3,200 20/5/10 17 3.5% Q 6,000 50 3,200 20/5/10 26 5.3% TOTAL: 490 Phase 151 Phase 11 135 Phase 111 100 Phase IV 104 Open Space Dedicated N/A N/A N/A N/A 2.51 1.8% Open Space in HOA N/A N/A N/A N/A 12.96 9.1% Floodplain N/A N/A N/A N/A 12.79 8.9% Perimeter ROW N/A N/A N/A N/A 12.45 8.7% Vicinity Map 1'.1000' EXHIBIT C Concept Plan SAGEBROOK Denton, Texas NAJUNE2020 McADAMS 699 PETRUS INVESTMENT, L.P. TRACT 11- CALLED 917.60 ACRES VOL. 4246, PG. 574 R_P_RJXC-T _ I Lot Requirements Unit of Total L31 CI L) Quantity I Min. Lot Min. Lot Building Setbacks Q y. 5 Area Width Pads (F/S/R) VA A 39 8.0% 6,000 50 3,200 20/5/10 B 6,000 50 3,200 20/5/10 I 4.5% C 6,000 50 3,200 20/5/10 26 5.3% I D 1 1 E 6,000 50 3,200 20/5/10 24 4.9% F O 4.3% G CL; 31' 50' R W 18 3.7% Ir H 6,000 50 3,200 20/5/10 22 1 6,000 50 3,200 20/5/10 27 5.5% 1 1 6,000 50 3,200 20/5/10 91 18.6% DOMINGUEZAND \\\ I MICHAEL JOHN BARBER P E III IANGELA L 6,000 50 3,200 20/5/10 37 7.6% M 6,000 50 3,200 20/5/10 31 CALLED 34.937 ACRES VOL. 4357, PG. 240 Bl ck E N 6,000 50 3,200 20/5/10 25 5.1% R.P.R.D.C.T. 21 4.3% P 6,000 50 3,200 20/5/10 17 3.5% O 6,000 50 3,200 20/5/10 26 5.3% TOTAL: 490 1 Phase 151 1 135 Phase 111 100 S2 TO BE OWNE"Y ' 104 69 N/A N/A N/A N/A 2.51 ANGELA DO, INGUEZ AND Open Space in HOA N/A N/A N/A N/A 12.96 9.1% MICHAEL JOHN BARER 12.79 8.9% Perimeter ROW N/A N/A N/A N/A a 12.45 8.7% 490 2F Fo sBR tX27 Cot X s APPROXIMATE LIMITS OF 100 YEAR FLOODPLAIN PER FEMA MAP TWO LAi s IMPROVEMENTS - 10tUll 0 1002 300 Feet SY LP , SCALE-1-100'TO BE DEDICATED FOR FUTURE TRAILS 15' Nshgp q/ S PROPOSED DRAINAGE FLOOD PLAIN EASEMENT AND V OWND IDEVEELOPER ZE 21 LAND WALL STREET LP 218 WEST WALL STREET GRAPEVINE, TEAS NOTE* 1. Discharge from any detention pond outfall or storm drain outfall may require an offsite drainage easement to accommodate the flow. If an offsite drainage easement is required, a study shall be made of the off-site property to determine the size of the drainage easement to accommodate the flow. 2. Acceptance of the drainage features identified on the Planned Development Exhibits and Plans are subject to change during the platting process and do not constitute subsequent approval of same. The City reserves the right to require additional data or studies to ensure compliance with City of Denton Subdivision and Land Regulations, Drainage Criteria and Comprehensive Master Drainage Plan. 3. Deviations from the City of Denton's Transportation Criteria Manual for standard street and sidewalk sections are proposed within this plan. Street and sidewalk sections identified within this planned development (PD) are subject to approval at platting. 4. The Sagebrook development shall dedicate the right-of-way for the Brush Creek extension with each phase of development as described in the approved PD, and as such, the right-of-way dedication shown hereon shall only apply to the Sagebrook property and shall not be interpreted or otherwise implied as right-of-way dedication of any part of the adjacent properties. EXHIBIT D Concept Plan SAGEBROOK Denton, Texas NAJUNE2020 J McADAMS Lot Requirements Unit ofTotal Acres of Total Quantity Units Area Min. Lot Min. Lot Building Setbacks Area Width Pads (F/S/R) A 39 8.0% 6,000 50 3,200 20/5/10 B 6,000 50 3,200 20/5/10 22 4.5% C 6,000 50 3,200 20/5/10 26 5.3% D 6,000 50 3,200 20/5/10 25 5.1% E 6,000 50 3,200 20/5/10 24 4.9% F 6,000 50 3,200 20/5/10 21 4.3% G 6,000 50 3,200 20/5/10 18 3.7% H 6,000 50 3,200 20/5/10 22 4.5% 1 6,000 50 3,200 20/5/10 27 5.5% 102.47 71.6% 1 6,000 50 3,200 20/5/10 91 18.6% K 6,000 50 3,200 20/5/10 18 3.7% L 6,000 50 3,200 20/5/10 37 7.6% M 6,000 50 3,200 20/5/10 31 6.3% N 6,000 50 3,200 20/5/10 25 5.1% O 6,000 50 3,200 20/5/10 21 4.3% P 6,000 50 3,200 20/5/10 17 3.5% O 6,000 50 3,200 20/5/10 26 5.3% TOTAL: 490 Phase 151 Phase 11 135 Phase 111 100 Phase IV 104 Open Space Dedicated N/A N/A N/A N/A 2.51 1.8% Open Space in HOA N/A N/A N/A N/A 12.96 9.1% Floodplain N/A N/A N/A N/A 12.79 8.9% Perimeter ROW N/A N/A N/A N/A 12.45 8.7% 490 143 EXHIBIT D Concept Plan SAGEBROOK Denton, Texas NAJUNE2020 J McADAMS 700 701 f. 4 t-'f 0. R 4CTREES TO 8E PRESERVED NOTE* Tree Preservation and Replacement Plan will be provided at the platting and civil engineering design phase to comply with DDC Sec. 7.7.4. EXHIBIT F Preliminary Tree Preservation Plan SAGEBROOK Denton, Texas NJUNE2020 MMS 702 OpAr C_ M Le y EXHIBIT G Entry & Amenity Center Enlargement zPI A EBRSG 00K Denton, Texas m NAJUNE2020 111W I McADAMS 703 0% Y{ r"NCHO* SIE I y• 4 tiL T TTT _ r 7 •e~ - Lie.- OV' Al" J 0011 ll•l• 704 Opp P? Mir ELPC Wid-Fl. A ...... P— nab---- j A Job S, I I V dMI MM". 1194F4b.WW I _ d ML PkF ii. OR 14LL NiljLIPl? O' Llp W_ FbdRi. P 41. i mL EXHIBIT I Amenity Center Perspectives SAG E B ROC 705 F ' — ii —• a - i M1 11: k""•_ L _ M1•L4 L+ F., rel Ltmt-J y, Decomposed Granite yr F + 1 x.• y 5 1 ti Corten Steel Monument Lettering iit r. k Timbered pavillion a Bark Mulch 06=w - Cedar Fence Stays Standing Seam Roof Wrought Iron Fence Dry Creek Bed f 5' - -• L i - C a •L k y L y , Lueders Limestone Corten Steal Walking Trail L'w7; M Chesney Brick 1 ' Stamped Stained Concrete i IK.AINu.11rNINE! i Hardscape Materials Palette of SAGEBROOK Denton, Texas w JUNE 2020 i- NA McADAMS 706 Canopy & Street Trees Live Oak Quercus virginia Ornamental Trees Desert Willow Chilopsis linearis Shrubs Texas Sage Leucophullum frutescens Lacebark Elm Ulmus parvifolia or I., Texas Red Bud Cercis canadensis var. texensis Rosemary Rosmarinus officinalis Cedar Elm Ulmus crassifolia Chaste Tree Vitex agnus-cactus Dwarf Wax Myrtle Myrica cerifera Bald Cypress Taxodium distichum Possumhaw Holly Ilex decidua Dwarf Palmetto Sabel minor Red Oak Quercus buckleyi Roughleaf Dogwood Cornus drummondii EXHIBIT K Plant Materials Palette SAGEBROOK Denton, Texas NAJUNE2020111W I McADAMS 707 Shrubs Fr ti 4+ 7t . ~ 1 f 9 ' Ntir • x lfl 1 r+7 •1 ' % '1 Red Yucca Hesperaloe parviflora Grasses II Mexican Feather Nasella tenuissima Perennials Blackfoot Daisy Melampodium leucanthum ter r r_. Coral Berry Symphoricarpos orbiculatus V Y 77= k Silver Bluestem Bothriochloa laguroides Lindheimer's Guara Guara lindheimeri M1 '• i I AL _ .• y Harvard Agave Chisos Agave Blue Grama Bouteloua gracilis Coreopsis Coreopsis lanceolate IT Twist -Leaf Yucca Yucca rupicola Little Bluestem Schizachyrium scopariu r• i 3. to Smooth Prickly Pear Opuntia ellisiana Gulf Muhly Muhlenbergia capillaris EXHIBIT L Plant Materials Palette SAGEBROOK Denton, Texas m NAJUNE2020 111W MMS Flame Acanthus Anisacanthus quadrifidus v. wrightii 708 m onmm mn nm i Aga 1 m 1 1 7 Ot r ed— — L f - F r AY mLd AALML it } i i tit }, . •'. f T , Sri -ti• , r -L• 1 I ' I 4 — 709 Exhibit N Parkway Tree List The following trees shall be allowed as Street Trees per the regulations of the PD: Common Name Botanical Name Live Oak Quercus viginiana Texas Red Oak Quercus shumardi 'Texana' Shumard Oak Quercus shumardi Chinquapin Oak Quercus muehienbergii Cedar Elm Ulmus crassifolia Lacebark Elm Ulmus parvifolia Caddo Maple Acer barbatum 'Caddo" Bald Cypress Taxodium distichum 710 NOTE: 1.A full tree preservation plan will be provided during the platting and civil engineer- ing design phase to comply with DDC Sec 7.7.4. 2. Deviations from the City of Denton's Transportation Criteria Manual for stan- dard street and sidewalk sections are proposed within this plan. Street and sidewalk sections identified within this planned development (PD) are subject to approval at platting. EXHIBIT O Sage Trail Street Section SAGEBROOK Denton, Texas NAJUNE2020qNW I McADAMS 711 IM, I TO f A) Intersection of North Sage Trail and Bluestem Boulevard o MAL r.4 FAQFWMA 5FmPC1){ grALK P.NSCD H4TEMNCCj" B) Intersection of North Sage Trail and Post Oak Trail i!! VATIINbaFj Intersection Close Up SAGEBROOK Denton, Texas NAJUNE2020 111W I McADAMS 712 215 E. MCKINNEY ■ DENTON, TEXAS ■ 76201 ■ 940.349.8451 DEVELOPMENT SERVICES DEPARTMENT “Dedicated to Quality Service” www.cityofdenton.com April 22, 2021 Chase Finch Corwin Engineering, Inc. 200 W. Belmont, Suite E Allen, TX 75013 SUBJECT: FP20-0028, Sagebrook Addition, Phase 1 Mr. Finch, The City of Denton’s Planning and Zoning Commission approved the Final Plat of Phase 1 of the Sagebrook Addition on April 20, 2021. Prior to the issuance of any site/building permits or construction of any public improvements, the plat must be filed with Denton County. City staff will file the plat for you. One black line copy of the signed plat, filing fee, and current year tax certificates for all pre-existing lots or tracts within the plat must be mailed by the applicant to Development Services staff. Approved Final Plat: Please mail the signed plat to 215 E. McKinney Street, Denton, Texas 76201. Deliveries will not be accepted in-person because staff is currently working remotely in response to the recent regional increase in COVID-19 cases. If you have questions regarding delivery options, please email planningtechnicians@cityofdenton.com. Filing Fee: Plat filing fees are $50.25 per plat sheet. The plat filing fee may be mailed, paid through E-TRAKiT, or paid over the phone with Development Services by calling (940)349-8360. If you are paying with check, please make the check out to City of Denton. Tax Certificate: The original tax certificate must be mailed along with your plat The certificate must show a zero balance. In the event taxes are owed on the property, they must be paid in full by the applicant prior to proceeding. Property Tax payments can be made online by visiting https://taxweb.dentoncounty.gov/WebPay/ Also, the property owner listed on the Tax Certificate must be listed on the plat. If the property has changed ownership, the previous year’s taxes must be already paid. 713 2 The omission of any execution package items listed above will result in staff rejecting the execution package. Once accepted, staff will file the plat with Denton County. You will be notified by email once the plat has been filed, including the document file number and a copy of the filed plat with recording sticker attached Please note, a plat must be recorded within two (2) years of its approval or it is considered null and void, unless the Planning and Zoning Commission grants an extension for good cause. If you have any questions, you may contact me at 940-349-7785 or Hayley.Zagurski@cityofdenton.com. Sincerely, Hayley Zagurski, AICP Planning Administrator 714 S88^46’24"W 2911.16’ S 2 7 ^3 0 ’1 2 "W 9 5 8 .1 7 ’ N00^00’00"E 281.07’ N00^00’00"E 120.00’ S 6 1 ^2 2 ’ 5 2 " E 226 . 4 1’ N89^59’21"E 113.35’ S08^06’29"E 142.30’ S00^00’40"E 104.80’ N00^00’39"W 50.00’ S59^14’55"E 50.00’ N72^49’53"E 14.22’ N90^00’00"W 99.08’ = 29^05’30" R= 1060.00’ L= 538.21’ C= 532.45’ B= S75^27’15"E = 31^12’20" R= 500.00’ L= 272.32’ C= 268.97’ B= S77^39’25"E = 08^38’01" R= 2435.00’ L= 366.92’ C= 366.57’ B= S88^56’29"E = 05^23’11" R= 1565.00’ L= 147.12’ C= 147.04’ B= S87^19’04"E = 08^05’49" R= 740.00’ L= 104.75’ C= 104.49’ B= S04^03’34"E = 13^16’34" R= 440.00’ L= 101.95’ C= 101.72’ B= N07^00’03"W = 21^23’00" R= 770.00’ L= 287.37’ C= 285.71’ B= N02^56’49"W = 07^53’05" R= 1137.50’ L= 156.53’ C= 156.41’ B= N03^48’08"E = 15^36’29" R= 920.00’ L= 250.62’ C= 249.84’ B= N07^39’51"E = 15^28’05" R= 630.00’ L= 170.08’ C= 169.56’ B= N04^44’03"E = 08^05’49" R= 455.00’ L= 64.30’ C= 64.25’ B= S04^03’34"E J J J Q Q P P O O E I M K 10’ P.U.E. 10’ P.U.E. 10 ’ P.U.E. 1 0’ P.U .E . 10 ’ P .U .E. 10’ P.U .E. 1 0’ P.U .E . 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 1 0’ P.U.E . 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E.1 0’ P.U.E.10’ P.U.E. 1 0’ P.U.E.10’ P.U.E. 10’ P.U.E. 10’ P.U.E.10’ P.U.E. 10’ P.U.E. 10’ P.U.E. S90^00’00"E 368.11’ 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5 ’ S.E. 2.5’ S.E. 2 .5 ’ S .E . 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2 .5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2 .5 ’ S .E .2.5 ’ S .E . 2.5’ S.E.2.5’ S.E. 88.16’ 93.36’ N89^59’21"E 137.56’ N89^59’21"E 313.53’ N12^41’41"E 202.31’ 79.49’ S90^00’00"E 186.81’ 79.10’ N00^00’00"E 236.00’ N00^00’00"E 132.85’ S88^46’25"W 524.15’ 556.99’ 6 8 .4 0 ’ 6 8 .3 4 ’ N 60^57’36"E 338.09’ S 2 7 ^3 0 ’1 2 "W 3 0 4 .5 7 ’ N 2 7 ^30 ’1 2 "E 3 1 1.1 6 ’ N6 2 ^ 29 ’48 " W 1 9 3 .2 3 ’ S 62^2 9 ’ 4 8 "E 2 9 0 .0 0 ’ 1 4 .8 4 ’ 25.19’ N 60^57’ 36"E 350.63’ 85.20’S29^02’24"E 120.00’ S26^35’04"E 120.00’ S15^50’29"E " S05^05’55"E " S05^38’40"W " S16^23’15"W " S 2 7^3 0’12 "W 12 0.0 0 ’ N 6 2 ^29 ’4 8 "W 1 2 0 .00 ’ N 6 2^ 2 9 ’48 "W 1 20 .0 0 ’ S 2 7 ^3 0’1 2"W 1 2 0 .0 0 ’ 11 0 .0 0 ’48 .2 3 ’ 1 .7 7 ’ 70.40’ 69.75’ 69.75’ 69.75’ 69 .7 5 ’ 38.35’15.94’ 47.25’ 47.12’ 47.25’ 47.25’ 47.25’ 6 5 .0 0 ’ 5 0 .00 ’ 5 0 .0 0 ’ 5 5 .00 ’ 5 0 .0 0 ’ 1 .77 ’ 5 0 .00’ 5 0 .0 0 ’ S 6 2 ^29 ’4 8 "E 12 0 .00 ’ 5 0 .0 0 ’ 5 0 .0 0 ’ S 6 2 ^2 9 ’4 8 "E " 1 04 .0 0’ 1 04 .0 0 ’ 5 5 .0 0’ 5 4 .00 ’ S 2 7 ^3 0 ’1 2"W 1 14 .00 ’ S 2 7^3 0’12 "W 1 1 4.0 0’ 6 5 .1 3 ’ 6 2 .3 9’54 .0 0 ’ 4 0 .0 2 ’ 2 3.5 1 ’ 43.02’ 64.56’ 64.28’ 65.84’ 37.43’ 62.63’ 50.00’ 50.00’ 51.50’ 10.91’ 35.75’ 63.40’ S86^10’31"E 120.00’ S80^21’11"E " S81^11’35"E " N82^26’12"E 120.00’ 110.08’ 50.00’ 50.01’ 43.40’ 67.42’ 69.79’ 5 8 .64’ 5 .8 4 ’ 5 2 .0 0 ’ 1 2 2 .7 9’ 1 .8 1’4 8.1 8 ’ 5 0 .0 0 ’5 4.0 0 ’ 61.46’ 60.00’ 50.16’57.60’ 88.32’ 44.29’ 13.48’ 41.23’ 78.57’ 23.92’ 32.55’ 45.73’ 4.35’ 55.00’ 69.10’ 57.92’ 4.35’ S29^02’24"E 120.00’ S29^02’24"E 120.00’ S00^23’49"E 119.66’ 4.47’ 62.52’ 50.00’ 50.00’ 45.60’ 4.90’ 50.00’ 50.00’ N60^57’36"E 38.35’10.80’ N29^02’24"W 115.00’ N29^02’24"W 115.00’ " " 107.89’ 90.63’ 53.00’ 53.00’ 53.00’ 57.80’ 63.86’ 53.00’ 53.00’ 53.00’ 65 .00’ 81.36’ 24.29’ N60^57’36"E 179.64’ 134.99’ N86^10’31"W 127.70’ S77^18’19"E 130.00’ S77^18’19"E 130.00’ S77^18’19"E 130.21’ N88^51’46"W 141.72’ N86^10’31"W 134.23’ N86^10’31"W 133.42’ N88^40’52"E 130.00’ 34.80’ 42.31’ 46.19’16.87’ 33.14’50.00’50.00’50.00’39.29’ 50.61’57.33’50.61’17.69’ 54.33’ 72.18’ 43.93’ 61.65’ 19.17’ 25.95’ 50.00’50.00’50.00’33.14’ 16.87’ 74.12’ 98.62’ 48.53’ 50.07’ 21.71’ 28.79’ 40.79’ 9.28’ 50.00’ N03^38’41"E123.80’N00^00’39"W 120.07’ " 120.01’ "120.00’ " 120.04’ " 120.13’ " 120.27’ " 120.46’ " 120.30’ " 120.08’ N00^00’39"W 120.00’ 42.51’ 68.04’ 63.35’ 54.97’ 51.07’ 41.05’ 10.27’ 51.16’ 51.09’ 51.04’ 51.01’ 51.00’ 51.02’ 50.49’ 7.95’ 62.57’ 62.90’ 63.10’ 75.80’ 1 25.7 2 ’ 4 4 .39 ’ 50.00’ 50.51’ 50.00’ 50.00’ 51.02’ 51.00’ 51.01’ 51.03’ 51.08’ 51.15’ 26.07’ 25.12’ 51.08’ 54.97’ 55.52’ 117.23’ 124.50’ 43.42’ 50.00’ 50.00’ 50.00’16.84’ 39.87’ 63.24’53.00’38.81’53.00’ 53.00’53.00’ 18.23 ’65.50’ 65.50’ 56.78’56.18’ 18.70’ 37.17’ 13.15’ N77^18’19"W 120.00’ N77^18’19"W " N77^18’19"W " N79^13’56"W " S73^04’13"W 122.41’ S79^59’41"W 120.00’ S86^55’08"W " N86^09’24"W " S66^08’45"W 132.77’ N87^11’21"E 136.76’ N83^41’05"E 129.65’ N80^10’50"E 126.14’ N83^09’33"E 126.88’ S81^39’47"E 123.51’ S89^15’07"E 126.28’ 48.71’ 46.77’ 46.46’ 48.73’ 56.55’58.57’66.51’ 88.83’ 142.11’ 63.27’67.18’51.18’14.47’ 65.50’ 40.11’ 50.00’ 50.00’ 19.25’ 36.07’ 63.24’11.65’38.20’24.29’ 51.00’ 51.00’ 38.81’ 14.19’ 45.60’ 141.04’ 105.00’ 105.68’ 55.00’ 47.30’ 50.00’ 32.96’ 9.30’ 64.11’ 5.24’ 153.31’ 46.61’ S76^59’47"W 165.31’ N89^59’21"E 151.82’ " 140.41’ " 132.82’ " 127.66’ " 123.12’ " 122.97’ " 125.60’ " 131.13’ N89^59’21"E 138.60’ 125.23’ 5.20’ 54.80’ 30.10’ 14.96’ 51.05’ 48.32’ 3.00’ 51.51’51.51’36.27’ 15.21’49.09’ 2.01’ 51.00’ 51.00’ 62.00’ 47.24’ 22.74’ 29.53’51.58’ 51.08’ 51.08’ 22.14’ 29.37’0.25’51.95’ 51.97’ 22.63’ 29.30’ 88.62’ N89^59’21"E 137.49’ N89^59’21"E 157.73’ 105.00’ 60.21’ 41.74’ 10.31’ 51.95’ 51.40’ 51.09’ 51.01’ 51.16’ 20.45’ 30.93’51.19’ 62.05’ S89^59’21"W 120.27’ " 120.79’ " 120.62’ " 120.09’ " 120.03’ " 121.29’ " 120.42’ S89^59’21"W 121.71’ " 122.66’ 45.40’ 13.00’ 39.22’ 51.71’ 51.30’ 51.07’ 51.09’ 51.12’ 36.74’ 14.63’ 51.24’ 47.06’ S86^16’27"E 131.75’ S83^27’31"E 124.28’ S80^38’35"E 119.63’ S77^49’39"E 119.02’ 70.02’ L4 L5N00^00’39"W 66.81’ N00^00’39"W 57.65’ 54.96’ 22.30’ N00^00’39"W 72.96’ 15.20’ N00^00’39"W 67.52’ 45.24’ 51.65’ L6 L7 19.62’ 21.61’ L 6 L7 L 8 L9 49.61’ 67.40’ 345.97’ N12^23’15"W 74.59’ 74.59’ 78.74’ 107.97’ 190.87’ 79.35’ L 10 L11 L12L13 19.15’ L14 L15 L16 L17 L18 L19 19.17’ 201.83’ 156.61’ 32.96’ 294.18’ 218.11’ 97.80’ 152.14’ 11.65’ L20 L21 L20 L21 L20 L20 L21 116.01’ 92.85’ 24.53’L22 L23 L24 9.53’ L25 L26 L27 L28 S11^32’8"E L31 L30 L29 S90^00’00"W L32 L33 L32 L36 L38 L37 N03^49’29"E 94.19’ L41 L 40 L39 L42 L43 57.50’14.75’ C6C7 C8 C9 C10 C11 C12 C13 C14 C15 C16 C17C18 C19 C20 C21 C22 C23 C24 C25 C26 C27 C28 C29 C30 C31 C32 C33 C 3 7 C 3 8 C39 C40 C41 C42 C43 C44 1 .0 5 ’ C45 C46 C47 12.91’ L44 L 45 L 46 33.02’ 47.60’46.99’ 26.81’ 53.76’50.12’ 17.65’ 359.14’ 5 0 .0 0 ’ 5 0 .0 0’ S 6 2 ^2 9 ’4 8 "E 1 2 0 .00 ’ 26’ P.U.E. 406.57’ 343.30’ 50.91’ N 63^ 5 2 ’3 0 "W 2 01 .0 8 ’ C48 5 0 .0 0 ’ 5 0 .0 0’ 5 0 .00’ 5 0.0 0 ’ 50 .0 0 ’ 50 .0 0 ’ 5 0 .0 0 ’ 5 0 .0 0’ 50 .0 0 ’ 5 0 .0 0’ S 62 ^ 2 9 ’4 8" E 1 20 .0 0 ’ S 6 2 ^ 29 ’4 8 " E 12 0 .0 0’ S62 ^ 2 9 ’4 8 "E 1 2 0.0 0 ’ S 6 2 ^2 9 ’4 8 "E 1 2 0 .00 ’ S 6 2 ^ 2 9’ 4 8" E 1 20 .0 0’ S 27 ^30 ’1 2"W 1 14 .00 ’ S 2 7 ^3 0 ’1 2"W 1 14 .00 ’ S 27 ^30 ’1 2 "W 1 14.0 0’ S77^18’19"E 130.00’ S77^18’19"E 130.00’ 50.00’50.00’50.00’ 50 .00’S29^02’24"E 120.00’ L34 116.00’ L48 119.65’ 5 3 .0 0 ’ 5 3 .0 0 ’ 50.09’ 14.71’ S3^49’29"W 73.45’ 51.00’ 51.00’ 51.00’ S 6 2 ^2 9 ’4 8 "E 1 2 0 .0 0 ’ 6 2 .0 0 ’ 5 3 .0 0 ’ 5 3 .0 0 ’ 50.00’ 50.00’ 50.00’ 50.00’ 50.00’ 45.0 0’ 5.2 3 ’ 5 4 .00 ’ N12^32’58"W 132.22’ N05^45’39"W 121.72’ N01^01’40"E 119.06’ N07^48’59"E 124.05’ N14^36’18"E 125.82’ N2 1^23 ’37"E 115 .0 2’ S 27 ^30 ’1 2"W 1 12 .00 ’ S 2 7^3 0’12 "W 1 1 2 .0 0 ’ S 2 7 ^3 0 ’1 2"W 1 12 .00 ’ 5 3 .0 0 ’5 3 .00 ’ 5 3 .0 0 ’ 5 3 .0 0 ’ S3^22’20"W 137.32’ S11^58’18"W 130.61’ S20 ^16’43"W 1 16.27’ S00^00’00"E 136.18’ S00^00’00"E 137.14’ S29^02’24"E 120.00’ S29^02’24"E 120.00’ S29^02’24"E 120.00’ 50.00’ 50.00’ 50.00’ 50 .00’S27^49’08"E 119.98’ S22^21’43"E 119.92’ S16^54’19"E 119.85’ S11^26’55"E 119.78’ S05^59’31"E 119.72’ 50.00’ 50.00’ 50.00’ 38.81’ 11.19’ 61.40’ 61.41’ 61.42’ 61.42’ 14.47’ 38.09’ 63.88’ 59.89’ 12.48’ 37.57’50.00’ 50.00’ 50.00’ 50.01’ 10.67’ 51.26’ 62.26’ 56.56’ 6.00’ 63.28’ 65.18’ 50.00’ 22.36’ 29.78’ 50.00’ 50.00’ S75^43’38"W 151.70’ S81^12’36"W 138.65’ S86^41’34"W 131.98’ N87^49’28"W 128.82’ N82^20’29"W 125.50’ N76^51’31"W 122.17’ N76^51’31"W 122.07’ N88^54’22"W 124.38’ N81^19’15"W 126.22’ N4^23’25"E 59.82’ 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10 ’ P .U .E . 10’ P.U.E. 1 0’ P .U .E . 10’ P .U .E . 10’ P.U.E. N09^12’27"E 129.46’ N14^46’13"E 133.37’ N20 ^19’59 "E 135.47’ N00^00’39"W 121.00’N00^00’39"W 121.00’N00^00’39"W 121.00’ N89^59’21"E 4.99’ N89^59’21"E 358.62’ N89^59’21"E 20.23’ S00^00’39"E 156.00’N00^00’39"W 156.00’ 141.05’ 147.55’ 50.00’ 50.00’ 50.00’ 50.00’ 50.00’ 50.00’ 121.00’121.00’ 32.32’ 56.56’ 17.65’ L1 L3 L2 51.00’ S89^59’21"W 120.00’ 9.52’ 42.51’107.57’ S59^2 9 ’52"E 1 20.00 ’ S62^29’48"E 110.00’ 5 1 .8 8’ 5 9.90 ’ 1 1 0.0 0 ’64 .8 7 ’ 4 9 .6 2 ’ S6 0^3 4 ’2 1 "E 12 0 .0 0 ’ N90^00’00"W 48.73’ N00^00’00"E 151.00’ S00^00’00"E 131.00’ 131.00’ 50.00’ 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 1 0 ’ P.U .E. 1 0’ P.U .E . = 02^28’49" R= 2645.00’ L= 114.50’ C= 114.49’ B= S29^15’44"W F A J 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 10’ P.U.E. 2 .5’ S.E. N L49 L47 L 48 L6 L19 = 00^14’26" R= 2765.00’ L= 12.01’ C= 12.01’ B= S30^37’36"W 5 0 .0 0 ’ S 62 ^ 2 9 ’4 8" E " C5 50.00’ 50.00’ 121.00’131.00’ 50.00’ 50.00’ 50.00’ L50 L51 L51 1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 6 7 8 9 10 11 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 6 7 8 9 10 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 1 2 3 4 5 6 7 9 10 11 12 13 14 15 16 17 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 11 12 1 2 2 3 2 85 3 84 13 15 16 17 18 19 20 21 22 23 24 25 37 5 0.00 ’ 5 0 .0 0 ’ 5 0.0 0 ’ S62 ^ 2 9 ’4 8" E 1 20 .0 0 ’ 5 0 .00’ 5 0 .00’ 5 0 .0 0’ 50.00’ 50.00’ 83.86’ S29^02’24"E 120.00’ N17%%d29’48"W 69.11’ N17%%d29’48"W 98.93’’ S 22%%d24’53"W 1 25 .7 7’ N 27%%d49’1 4"E 1 0 3 .5 9’ 36.88’34.41’ P.U.E. 1 0’ P.U.E. N 6 2 ^2 9 ’4 8" W 1 2 0 .0 0 ’ N 6 2 ^2 9 ’4 8" W 1 2 0.0 0 ’ 5 2.0 8 ’ N89%%d50’28"W 4 7 .3 3 ’ S28%%d59’56"E 77.25’ N6 2% % d 29’2 7"W 6 7 .3 7 ’ 6 6 .8 9 ’ 38.90’ 2 3 3 .6 4 ’ N14%%d51’34"W 49.52’ S63%%d45’33"E 17.83’ S17%%d20’17"E 5.74’ 1 4 7.0 8 ’ C34 C 35 C36 C49 L35 L52 L 5 3 N00^00’00"E 8 L54 L55 L56 CORWIN ENGINEERING, INC. PREPARED BY 200 W. BELMONT, SUITE E ALLEN, TEXAS 75013 972-396-1200 OUT OF THE IN THE DENTON COUNTY, TEXAS CITY OF DENTON 0 50 100 200 SCALE: 1" = 100’ PROJECT LOCATION LOCATION MAP N.T.S. OWNER FP20-0028 NOTES CORWIN JOB NO. 20045 CURVE TABLE CURVE NO. DELTA RADIUS LENGTH BEARING CHORD 1. 09^06’39" 332.50’ 52.87’ 52.82’ N04^32’41"E 2. 08^59’11" 265.99’ 41.72’ 41.68’ N04^36’25"E 3. 09^52’40" 274.50’ 47.32’ 47.27’ S05^02’33"E 4. 09^58’14" 325.00’ 56.56’ 56.48’ S04^59’46"E 5. 00^22’04" 2525.00’ 16.21’ 16.21’ N 28^27’28"E 6. 09^06’39" 284.49’ 45.24’ 45.19’ S04^32’41"W 7. 09^06’39" 314.00’ 49.93’ 49.88’ S04^32’41"W 8. 09^58’14" 293.00’ 50.99’ 50.92’ N 04^59’46"W 9. 09^58’14" 306.50’ 53.34’ 53.27’ N 04^59’46"W 10. 12^22’36" 293.50’ 63.40’ 63.28’ N 06^11’57"W 11. 13^37’40" 301.50’ 71.71’ 71.54’ N 06^49’29"W 12. 21^23’00" 908.50’ 339.06’ 337.10’ N02^56’49"W 13. 04^22’41" 1049.00’ 80.16’ 80.14’ N10^11’55"W 14. 22^31’31" 504.00’ 198.14’ 196.87’ N 03^15’11"E 15. 14^31’33" 301.00’ 76.31’ 76.11’ N 07^15’08"E 16. 07^45’20" 999.00’ 135.22’ 135.12’ N 03^52’01"E 17. 17^16’20" 501.00’ 151.03’ 150.46’ N 08^37’31"E 18. 13^07’54" 999.00’ 228.96’ 228.46’ N 06^33’18"E 19. 24^17’22" 496.00’ 210.27’ 208.70’ N 00^58’34"E 20. 34^48’01" 504.00’ 306.12’ 301.43’ N00^08’19"W 21. 17^32’20" 301.00’ 92.14’ 91.78’ N 08^46’10"W 22. 11^10’07" 799.00’ 155.75’ 155.50’ N05^35’03"W 23. 04^23’25" 599.00’ 45.90’ 45.89’ N 02^11’43"E 24. 29^02’24" 500.00’ 253.42’ 250.72’ N 75^28’48"E 25. 24^13’49" 542.00’ 229.21’ 227.51’ N 00^34’47"E 26. 41^44’06" 397.00’ 289.18’ 282.83’ N08^10’22"W 27. 22^15’07" 242.00’ 93.99’ 93.40’ N 01^34’08"E 28. 42^49’54" 300.00’ 224.27’ 219.08’ N07^37’27"W 29. 09^58’01" 425.00’ 73.93’ 73.84’ N 08^48’30"E 30. 42^38’54" 155.00’ 115.38’ 112.73’ N07^31’57"W LINE NO. BEARING DISTANCE 1. S 00^00’39" E 53.01’ 2. N 89^59’21" E 120.00’ 3. N 00^00’39" W 7.00’ 4. S 00^00’39" E 19.42’ 5. S 00^00’39" E 19.56’ 6. S 44^59’21" W 21.21’ 7. S 45^00’39" E 21.21’ 8. N 43^56’44" E 20.84’ 9. S 45^54’41" E 21.55’ 10. S 45^28’25" W 21.39’ 11. S 44^30’12" E 21.03’ 12. S 44^59’50" W 21.22’ 13. S 45^00’06" E 21.21’ 14. N 00^00’39" W 38.36’ 15. N 00^00’39" W 17.06’ 16. N 45^25’18" E 21.38’ 17. N 44^33’29" W 21.05’ 18. N 44^59’21" E 21.21’ 19. S 45^00’39" E 21.21’ 20. S 45^00’00" W 21.21’ 21. S 45^00’00" E 21.21’ 22. N 44^30’50" W 14.23’ 23. N 48^00’53" E 14.15’ 24. S 40^38’32" E 29.25’ 25. N 90^00’00" E 61.34’ 26. S 16^15’05" W 14.07’ 27. N 74^02’24" W 14.14’ 28. N 29^02’24" W 59.29’ 29. S 16^48’37" W 14.36’ 30. N 29^02’24" W 20.25’ 31. S 73^00’34" E 13.89’ 32. N 17^29’48" W 14.14’ 33. N 72^30’12" E 14.14’ 35. S 87^29’50" W 12.66’ 36. N 71^58’00" E 14.43’ 37. N 48^27’10" E 14.23’ 38. S 40^53’18" E 14.21’ 39. N 42^51’27" W 13.64’ 40. N 49^53’09" E 15.52’ 41. S 39^35’48" E 12.98’ 42. N 02^20’19" E 43.38’ 43. N 00^00’39" W 54.13’ 44. S 90^00’00" E 38.00’ 45. N 31^23’17" E 47.72’ 46. N 62^29’48" W 48.23’ 31. 56^32’37" 397.00’ 391.79’ 376.08’ N 89^13’54"E 32. 29^02’24" 645.00’ 326.92’ 323.43’ N 75^28’48"E 33. 56^32’37" 252.00’ 248.69’ 238.72’ N 89^13’54"E 34. 119^08’43" 20.52’ 42.68’ 35.40’ N 69^22’21"W 35. 37^43’50" 33.12’ 22.44’ 22.02’ S32^44’04"W 36. 99^44’29" 60.00’ 272.54’ 91.75’ N 75^09’34"E 37. 01^06’56" 2500.00’ 48.67’ 48.67’ N 28^03’40"E 38. 03^16’10" 2790.00’ 159.21’ 159.19’ N29^06’59"E 39. 29^28’41" 490.00’ 252.10’ 249.33’ S77^14’06"E 40. 05^42’48" 2580.00’ 257.27’ 257.16’ S89^07’05"E 41. 01^44’18" 2580.00’ 78.27’ 78.27’ S85^23’32"E 42. 05^11’55" 1420.00’ 128.84’ 128.80’ S87^24’41"E 43. 05^18’41" 602.00’ 55.81’ 55.79’ N 10^02’21"E 44. 07^23’40" 602.00’ 77.69’ 77.64’ N 03^41’10"E 45. 27^48’25" 800.00’ 388.26’ 384.46’ N77^19’23"W 46. 22^04’09" 800.00’ 308.14’ 306.24’ N74^27’14"W 47. 04^30’41" 800.00’ 62.99’ 62.98’ N 87^44’39"W 2 0’ A D V A N C E M ID ST R E A M , L.P . D O C . N O . 2 0 05-90 4 9 8 30 ’ B A R N ETT G A TH E R IN G C O M P A N Y , L L C . D O C . N O . 2 00 4 -143 4 01 2 0 ’ A C C ESS E S M T . D O C . N O . 2 01 7 -1 39 8 85 120’ R.O.W. DEDICATION T E X A S A N D P A C I F I C R A I L R O A D U .S .3 7 7 CEDAR ELM TRAIL A G A R I T A A V E N UE S A N T O L I N A D R IV E BIRCH LANE BL UESTEM B OULEVARD P O P L A R D R I V E S U M A C D R IV E S O U T H O A K L E A F T R A IL N O R T H O A K L E A F TRAIL ALLRED ROAD (1 0 0 ’ R .O .W .) B.B.B. & C.R.R. CO. SURVEY ABSTRACT NO. 160 HENERY H. HAGGOOD SURVEY ABSTRACT NO. 517 (50’ R.O.W .) (5 0 ’ R .O .W .) (5 0 ’ R . O . W . ) ( 5 0 ’ R . O . W . ) ( 50’R. O .W .) (50’ R.O.W.) 37’ 37’ 20’ POINT OF BEGINNING ALLRED BONNIE BRAE U S 3 7 7 3 5 W BRUSH CREEK JOHNSON JOHN PAINE LINE TABLE FENCE CORNER POST FND. (C.M.) 93.95 ACRE TRACT DOC. NO. 2004-11388 B.B.B. & C.R.R. CO. SURVEY, ABSTRACT NO. 160 SAGEBROOK DENTON, LP. 218 WEST WALL STREET GRAPEVINE, TEXAS 76051 SAGEBROOK DENTON, LP. 146.135 ACRE TRACT DOC. NO. 2020-155418 SAGEBROOK DENTON, LP. 146.135 ACRE TRACT DOC. NO. 2020-155418 ROW CL 20’ 47. N 44^07’36" W 20.89’ MATCHLINE APPROX. FLOODPLAIN FEMA MAP NO. 48121C0370G DATED APRIL 18, 2011 OF FINAL PLAT SAGEBROOK PHASE I 48. 12^46’40" 871.00’ 194.24’ 193.84’ S77^01’24"E 25’25’ 25’ 2 5 ’ 2 5 ’ 2 5’25’25’ 25’25’ 25’ 25’ 25’ 18.5’ 18.5’ 18.5’ 18.5’ 18.5’ 18.5’ 18.5’18.5’60’60’ MILLARD SMITH WELL SITE R.O.W. LOT 1 BLK U OPEN SPACE 0.150 AC. LOT 1 BLK T OPEN SPACE 0.751 AC. LOT 1 BLK S OPEN SPACE 0.656 AC. LOT 1 BLK R OPEN SPACE 0.143 AC. 12’ P.S.E.34. S 45^00’00" E 21.21’ 48. N 44^00’00" E 28.28’ M (37’ R.O.W.) (37’ R.O.W.) (37’ R.O.W.) (37’ R.O.W.) 18.5’ 18.5’ 18.5’ 18.5’ 5.5’ S.E. 13’ P.U.E. 19’ P.U.E. SURFACE SITE EASEMENT DOC. NO. 2004-143401 (PARTIAL RELEASE OF EASEMENT IN PROCESS) 30 ’ BA R N E T T G A T H E R IN G COM PA NY , LL C . D O C . N O . 2 0 0 4-1 4 3 40 1 16’X16’ P.U.E. 10’ P.U.E. 5.5’ S.E. LOT 28 BLOCK F OPEN SPACE-0.107 AC. LOT 1 BLOCK A OPEN SPACE-0.083 AC. LOT 86 BLOCK J OPEN SPACE-0.102 AC. 49. S 47^22’15" W 14.77’ 60.00’ 60.00’ 16’ LOT 1 BLOCK X TO BE DEDICATED TO THE CITY OF DENTON FOR PUBLIC PARK PURPOSES 15.258 AC. 12’ P.S.E.12’ P.S.E. 25’25’ 50’X50’ P.U.E. DOC. NO. 50’X50’ P.U.E. 50’X50’ P.U.E. 20’X50’ P.U.E. DOC. NO. 30’X50’ P.U.E. DOC. NO. 50’X50’ P.U.E. DOC. NO. 50’X50’ P.U.E. DOC. NO. ( 5 0 ’R .O .W . ) 50. S 88^12’05" E 21.49’ 51. S 90^00’00" E 12.49’ 10’ P.U.E. CENTERLINE CREEK 1 10 ’ R.O .W . 5 5 ’55 ’ PROPOSED 60’ R.O.W. MIN. FF= 631.9 M IN. F F = 6 3 1.9 LOT 14 BLOCK J OPEN SPACE DRAINAGE AND DETENTION EASEMENT 9.398 AC. LOT 1-3, BLOCK A LOTS 1-10, BLOCK E LOTS 1-11, BLOCK I LOTS 1-37, 84-86, BLOCK J LOTS 1-12, BLOCK K LOTS 1-15, BLOCK M LOTS 1-2, BLOCK N LOTS 1-21, BLOCK O LOTS 1-17, BLOCK P LOTS 1-26, BLOCK Q LOT 1, BLOCK R LOT 1, BLOCK S LOT 1, BLOCK T LOT 1, BLOCK U LOT 1, BLOCK X TOTAL LOTS 165 TOTAL RESIDENTIAL LOTS 155 TOTAL OPEN SPACE 10 TOTAL ACRES 64.335 (2,802,448.56 SQ.FT) LOT 26 BLOCK J AMENITY CENTER 0.506 AC. 49. 82^28’23" 20.50’ 29.51’ 27.03’ S13^43’59"E 52. S 15^09’06" W 20.29’ 53. N 62^29’48" W 34.96’ (40’ R.O.W.) 20’ R.O.W. DEDICATION (PER THIS PLAT) MARCH 2021 SCALE: 1"=100’ 54. S 89^33’16" W 16.00’ 55. N 00^00’00" W 16.00’ 56. S 89^33’16" W 15.87’ 1 0 ’ P .M .A .E . 1 0 ’ P .U .E. 1 0 ’ P .M .A .E . & P .U .E . 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. B R U S H C R E E K R O A D M IN . F F = 6 2 4.3 M IN . F F = 6 2 4.3 M IN . F F = 62 4 .3 M IN . F F = 62 4 .3 M IN . FF = 6 24 .3 M IN . F F = 62 4 .3 M IN . F F = 6 24 .3 M IN . F F= 6 2 4.3MIN . F F = 6 2 4.3 M IN . F F = 62 4 .3 Bearings are referenced to a 147.58 acre tract, as recorded in Doc. No. 2009-95582, in the Deed Records of Denton County, Texas. All lot lines are radial or perpendicular to the street unless otherwise noted by bearing. 1/2 " iron rods with "CORWIN ENGR. INC." caps set at all boundary corners, block corners, points of curvature, points of tangency, and angle points in public right-of-way unless otherwise noted. LEGEND IRF - Iron Rod Found C.M. - Controlling Monument P.M.A.E. - Pond Maintenance Access Easement - P.U.E. - Public Utility Easement - S.E. - Sidewalk Easement - P.S.E. - Public Sidewalk Easement - - Boundary line - Centerline - Floodplain - Block letter Open Space Lot 1 Blk A, Lot 28 Blk F, Lots 14, 26 & 86 Blk J, Blocks R,S,T, & U are to be dedicated to and maintained by the HOA and that Lot 1 Blk X is dedicated to the City of Denton as a Park per PD Ordinance PD20-0001F. The City of Denton has adopted the National Electrical Safety Code (The "CODE"). The code generally prohibits structures within 17.5 feet on either side of the center line of overhead distribution lines and within 37.5 feet on either side of the centerline of overhead transmission lines. In some instances the code requires greater clearances. Building permits will not be issued for structures within these clearance areas. Contact the building official with specific questions. Bearings are based on the Texas State Plane Coordinate System, North Central Zone, North American Datum of 1983. Lots 27 and 28 Block J will not be issued building permits until such time the LOM R is approved. A total of 89.5" dbh of Heritage trees, 6.5" dbh of Quality trees, and 814.5" dbh of Secondary trees are located within Lot 14 Block J and Lot 1 Block X. These trees are to be preserved as indicated on the tree survey. Any future grading, construction, demolition or disturbance that may impact trees shown as preserved in such a way as to cause damage is strictly prohibited. The city reserves the right to specify a new or revised minimum finished floor elevation at the time of issuance of a building permit if new or more accurate information, as determined by the Floodplain Administrator, warrants the change. This minimum finish floor elevation shall apply to the building foundation, including basements, and electrical and mechanical equipment. Minimum lot and habitable space for lots within the 100-year base flood, abutting the 100-year base flood, or within 200 feet of the 100-year base flood shall be established as follows: i. For lots adjacent to a stream without Base Flood Elevations (BFE’s) identified on the official FEMA Flood Insurance Rate Maps, any habitable structure shall have a finished floor elevation at least 18 inches above the 100-year base flood elevation based on fully developed conditions. This shall apply to all rivers or streams regardless of whether the 100-year floodplain is shown on the FEMA map. ii. For lots adjacent to a stream with Base Flood Elevations (BFE’s) identified on the official FEMA Flood Insurance Rate Maps any habitable structure shall have a finished floor elevation at least 18 inches above the 100-year base flood elevation based on fully developed conditions, or at least 30 inches above the FEMA Base Flood Elevation. All buildings that require a minimum finished floor elevation due to vicinity of a FEM A floodplain requires a FEM A Elevation Certificate to be submitted to the City for review and approval prior to issuance of Certificate of Occupancy. Sheet 31 of CEP20-0074 shows the following depiction of the fully developed conditions of the 100-year W SE. Lots 2 & 3 Block F are subject to minimum foundation requirements due to the regulatory floodplain. 13. Per DCC Section 8.2.4E, approval of this final plat shall not be deemed an acceptance of the proposed dedications and shall not impose any duty upon the city concerning the maintenance or improvement of any such dedicated parts until the proper authorities of the city have both given their written acceptance of the improvements and have actually appropriated the same by entry, use, or improvements. Should proposed dedications and roadways not be built, a secondary means of access must be dedicated by separate instrument prior to the issuance of building permits for these lots. Planning Approved 04/22/21 Hayley Zagurski FP20-0028 P&Z Approved 04/22/21 FP20-0028 P&Z Approved 04/22/21 Hayley Zagurski 715 S88^46’24"W 2911.16’ N00^00’00"E 281.07’ N00^00’00"E 120.00’ N90^00’00"W 99.08’ = 29^05’30" R= 1060.00’ L= 538.21’ C= 532.45’ B= S75^27’15"E = 14^38’22" R= 1062.00’ L= 271.35’ C= 270.61’ B= S53^35’19"E J O S90^00’00"E 368.11’ S60^54’3 0"E 1 6 4.83 ’ S 8 9 ^ 3 8 ’ 3 0 "E 3 9 0 .7 0 ’ N00^11’09"W 597.59’79.49’ S90^00’00"E 186.81’ 79.10’ N00^00’00"E 236.00’ N00^00’00"E 132.85’ 25.19’ S00^23’49"E 119.66’ 4.47’ 62.52’ 45.60’ 4.90’ 50.00’ 50.00’ 98.62’ S73^04’13"W 122.41’ S79^59’41"W 120.00’ S66^08’45"W 132.77’ N87^11’21"E 136.76’ N83^41’05"E 129.65’ N80^10’50"E 126.14’ N83^09’33"E 126.88’ 48.73’ 56.55’58.57’66.51’ 88.83’ 142.11’ 63.27’67.18’51.18’14.47’ 65.50’ 40.11’ 50.00’ 50.00’ 19.25’ 36.07’ 11.65’ 38.20’ 24.29’ 51.00’ 45.60’ 64.11’ 5.24’ 153.31’ 46.61’ S76^59’47"W 165.31’ 45.24’ 51.65’ 97.80’ 152.14’ 11.65’ L20 L21 L20 L21 L20 L20 L21 116.01’ 92.85’ 24.53’ L22 L23 L24 9.53’ L25 L26 S11^32’8"E C21 C22 C23 C24 C26 C32 C46 C47 12.91’ L44 343.30’ 50.91’ N 6 3 ^ 52 ’30 " W 2 0 1 .08’ C48 L34 116.00’ L48 119.65’ 51.00’ 51.00’ S22^21’43"E 119.92’ S16^54’19"E 119.85’ S11^26’55"E 119.78’ S05^59’31"E 119.72’ 50.00’ 50.00’ 50.00’ 61.40’ 61.41’ 61.42’ 6.00’ 63.28’ 65.18’ 50.00’ 22.36’ 29.78’ 50.00’ 50.00’ S75^43’38"W 151.70’ S81^12’36"W 138.65’ S86^41’34"W 131.98’ N4^23’25"E 59.82’ N90^00’00"W 48.73’ N00^00’00"E 151.00’ S00^00’00"E 131.00’ 131.00’ 50.00’ F 131.00’ 50.00’ 50.00’ 50.00’ L50 L51 L51 N78^20’46"W 106.08’ S51^05’07"W 172.86’ N67^56’56"W 135.32’ N 2 1^59’2 8"E 52.2 7’ N58^10’21"E 79.54’ N10^58’20"E 69.79’ N69^13’40"W 173.47’ N38^03’35"W 215.46’ 1 8 9.94 N 6 5^5 9’06 "W 189 .94 ’ N33^41’24"W 112.78’ S76^49’39"W 122.15’ S50^54’22"W 144.12’ S49^19’00"W 98.02’ 541.43’ 482.65’428.09’169.50’8 9 10 11 1 2 3 4 5 8 9 10 11 12 13 14 15 2 3 N00^00’00"E L54 L55 L56 CORWIN JOB NO. 20045 0 50 100 200 SCALE: 1" = 100’ CORWIN ENGINEERING, INC. PREPARED BY 200 W. BELMONT, SUITE E ALLEN, TEXAS 75013 972-396-1200 OUT OF THE IN THE DENTON COUNTY, TEXAS CITY OF DENTON OWNER FP20-0028 B.B.B. & C.R.R. CO. SURVEY, ABSTRACT NO. 160 SAGEBROOK DENTON, LP. 218 WEST WALL STREET GRAPEVINE, TEXAS 76051 MATCHLINE SAGEBROOK DENTON, LP. 146.135 ACRE TRACT DOC. NO. 2020-155418 B.B.B. & C.R.R. CO. SURVEY ABSTRACT NO. 160 HENERY H. HAGGOOD SURVEY ABSTRACT NO. 517 D E N T E X L A N D , C A T T L E A N D E N E R G Y , L P . 9 2 .3 8 2 A C . D O C . N O . 2 0 0 5 -4 9 2 3 1 AN G LEA D OM IN G UEZ & M ICH A EL JO H N B A RBER 34 .937 A C . V O L . 4357, P G . 240 B.B.B. & C.R.R. CO. SURVEY ABSTRACT NO. 160 B.B.B. & C.R.R. SURVEY ABSTRACT NO. 159 ANGLEA DOMINGUEZ & MICHAEL JOHN BARBER 13.64 AC. INST. NO. 2003-208519 B.B.B. & C.R.R. CO. SURVEY ABSTRACT NO. 160 HENERY H. HAGGOOD SURVEY ABSTRACT NO. 517 ANGLEA DOMINGUEZ & MICHAEL JOHN BARBER 93.95 AC. INST. NO. 2004-11388 APPROX. FLOODPLAIN FEMA MAP NO. 48121C0370G DATED APRIL 18, 2011 SOUTH OAKLEAF TRAIL NORTH OAKLEAF TRAIL ANGLEA DOMINGUEZ & MICHAEL JOHN BARBER 3.007 AC. DOC. NO. 2020-155538 LOT 1 BLOCK X TO BE DEDICATED TO THE CITY OF DENTON FOR PUBLIC PARK PURPOSES 15.258 AC. APPROX. FLOODPLAIN FEMA MAP NO. 48121C0370G DATED APRIL 18, 2011 CENTERLINE CREEK CENTERLINE CREEK MARCH 2021 SCALE: 1"=100’ OF SAGEBROOK PHASE I LOT 1-3, BLOCK A LOTS 1-10, BLOCK E LOTS 1-11, BLOCK I LOTS 1-37, 84-86, BLOCK J LOTS 1-12, BLOCK K LOTS 1-15, BLOCK M LOTS 1-2, BLOCK N LOTS 1-21, BLOCK O LOTS 1-17, BLOCK P LOTS 1-26, BLOCK Q LOT 1, BLOCK R LOT 1, BLOCK S LOT 1, BLOCK T LOT 1, BLOCK U LOT 1, BLOCK X TOTAL LOTS 165 TOTAL RESIDENTIAL LOTS 155 TOTAL OPEN SPACE 10 TOTAL ACRES 64.335 (2,802,448.56 SQ.FT) FINAL PLAT EASEMENT DETAIL SCALE 1"=50’ N90^00’00"W 9.63’ N00^00’00"E 7.89’ = 11^39’06" R= 724.76’ L= 147.39’ C= 147.13’ B= N06^05’06"W = 08^39’06" R= 101.00’ L= 15.25’ C= 15.24’ B= N11^56’04"E = 20^12’46" R= 529.41’ L= 186.77’ C= 185.80’ B= N02^29’52"W = 16^08’23" R= 501.50’ L= 141.27’ C= 140.80’ B= N08^11’26"E = 06^36’00" R= 624.98’ L= 71.99’ C= 71.95’ B= N04^01’58"E = 08^27’05" R= 99.00’ L= 14.60’ C= 14.59’ B= N03^06’26"E N01^07’07"W 18.67’ S89^59’21"W 1.80’ S89^59’21"W 10.33’ S01^06’16"E 13.58’ = 08^42’09" R= 101.00’ L= 15.34’ C= 15.33’ B= S03^14’28"W = 07^07’53" R= 570.72’ L= 71.04’ C= 70.99’ B= S04^01’36"W = 16^04’23" R= 513.50’ L= 144.05’ C= 143.58’ B= S08^09’28"W = 08^38’04" R= 99.00’ L= 14.92’ C= 14.91’ B= S11^52’38"W = 19^02’49" R= 511.50’ L= 170.04’ C= 169.26’ B= S01^57’49"E = 12^03’07" R= 833.35’ L= 175.29’ C= 174.97’ B= S05^57’02"E 10.61’ 18.86’ 11.65’ 16.00’ L56 L54 L55 17.68’ 17 .47’ 17.69’ 17.45’ N89^59’21"E 9.58’ N89^59’21"E 2.46’ = 07^47’24" R= 607.89’ L= 82.65’ C= 82.59’ B= N12^09’02"E = 25^26’03" R= 513.32’ L= 227.87’ C= 226.00’ B= N00^04’28"W = 01^21’01" R= 5690.00’ L= 134.09’ C= 134.09’ B= N12^06’59"W = 14^52’51" R= 337.35’ L= 87.62’ C= 87.37’ B= N04^00’03"W = 15^37’57" R= 305.25’ L= 83.28’ C= 83.06’ B= S03^45’40"E = 01^23’12" R= 5475.89’ L= 132.52’ C= 132.52’ B= S12^18’32"E = 28^01’12" R= 525.32’ L= 256.90’ C= 254.35’ B= S01^00’28"W = 06^45’33" R= 505.00’ L= 59.62’ C= 59.59’ B= S11^38’07"W N89^59’21"E 5.42’ S89^59’21"W 9.09’ 17.36’ 14.85’ = 09^46’53" R= 302.00’ L= 51.56’ C= 51.49’ B= S05^05’11"E = 11^58’28" R= 286.39’ L= 59.85’ C= 59.75’ B= S04^06’44"E = 09^46’53" R= 314.00’ L= 53.61’ C= 53.54’ B= N05^05’10"W = 07^05’52" R= 286.00’ L= 35.43’ C= 35.41’ B= N06^25’42"W N00^11’43"W 22.65’ S00^11’43"E 22.62’ N89^59’21"E 12.07’ S89^59’21"W 10.88’ N89^59’21"E 1.85’ 17.68’ 17.68’ 10’ P.U.E. 10’ P.U.E. 12’ P.S.E. 12’ P.S.E. 12’ P.S.E. 12’ P.S.E. 12’ P.S.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 10’ P.U.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 2.5’ S.E. 16’X16’ P.U.E. NORTH OAKLEAF TRAIL SOUTH OAKLEAF TRAIL CEDAR ELM DRIVE BIRCH LANE BLUESTEM BOULEVARD BRUSH CREE K ROAD Planning Approved 04/22/21 Hayley Zagurski FP20-0028 P&Z Approved 04/22/21 FP20-0028 P&Z Approved 04/22/21 Hayley Zagurski 716 STATE OF TEXAS COUNTY OF DENTON BEFORE M E, the undersigned Notary Public in and for said County and State on this day personally appeared acknowledged to me that they executed the same for the purpose and consideration therein expressed, and in the capacity therein stated; GIVEN UNDER MY HAND AND SEAL OF OFFICE THIS DAY OF , 2021. N otary Public in the State of Texas M y C om m ission Expires S S SURVEYOR’S CERTIFICATE KNOW ALL MEN BY THESE PRESENTS that I, WARREN L. CORWIN, do hereby certify that I prepared this Plat and the field notes made a part thereof from an actual and accurate survey of the land and that the corner monuments shown thereon were properly placed under my personal supervision, in accordance with the Subdivison regulations of the City of Denton, Texas. W A R R EN L. CO R W IN R .P.L .S. N o. 4621 THE STATE OF TEXAS COUNTY OF COLLIN Before me, the undersigned, a Notary Public in and for the State of Texas, on this day personally appeared W ARREN L. CORW IN, known to me to be the person and officer whose name is subscribed to the foregoing instrument, and acknowledged to me that he executed same for the purpose and consideration therein expressed and in the capacity therein stated. Given under my hand and seal of office, this day of , 2021. N OTA RY PU BLIC, STA TE O F TEX AS COMMISSION OF THE CITY OF DENTON, TEXAS APPROVED THIS DAY OF A.D. 2021 BY THE PLANNING AND ZONING PLANNING & ZONING COMMISSION CHAIRMAN CITY SECRETARY FP20-0028 ALLEN, TEXAS 75013 972-396-1200 CORWIN ENGINEERING, INC. PREPARED BY 200 W. BELMONT, SUITE E DENTON COUNTY, TEXAS CITY OF DENTON OUT OF THE IN THE B.B.B. & C.R.R. CO. SURVEY, ABSTRACT NO. 160 OWNER SAGEBROOK DENTON, LP. 218 WEST WALL STREET GRAPEVINE, TEXAS 76051 SAGEBROOK DENTON, LP. BY: SBD General LLC., its general partner BY: Robert Betancur, Vice President ROBERT BETANCUR, known to me to be the person whose name is subscribed to the foregoing instrument, and NOW, THEREFORE, KNOW ALL MEN BY THESE PRESENTS: THAT SAGEBROOK DENTON, LP., does hereby adopt this plat designating the herein described property as SAGE BROOK PHASE I, in the City of Denton County, Texas, and do hereby dedicate to the public use forever the street rights of way and public easements shown hereon. The utility easements as shown are reserved for garbage collections and all public utilities desiring to use the same. No. buildings, fences, trees, shrubs, or other improvements or growths shall be constructed or placed upon, over or across the utility easement as shown. Said utility easements being here reserved for the mutual use and accommodation of all public utilizes desiring to use or using the same, all and any public utilities shall have the right to remove and keep removed all or parts of any building, fences, trees, shrubs, or other improvements or growths which may in any way endanger or interfere with the construction, maintenance, or efficiency of its respective system on the utility easements and all public utilities shall at all times have the full right to ingress and egress to or from and upon the said utilities easements for the purpose of constructing, reconstructing, inspecting, patrolling, maintaining, and adding to or removing all or parts of its respective system without the necessity at any time of procuring the permission of anyone. LEGAL DESCRIPTION W HEREAS, SAGEBROOK DENTON LP, is the owner of a tract of land situated in the B.B.B. & C.R.R. Survey, Abstract No. 160, being part of a 143.133 acre tract, as described in Doc. No. 2020-155418 in the Deed Records of Denton County, Texas, being more particularly described as follows: BEGINNING at a fence corner post found at the southeast corner of said 143.133 acre tract and being in the west line of Texas & Pacific Railroad (100’ R.O.W.); THENCE, South 88^46’24" W est, along the south line of said 143.133 acre tract, for a distance of 2911.16 feet, to a 1/2 inch iron rod found at the southwest corner of said 143.133 acre tract; THENCE, North 00^11’09" W est, along the west line of said 143.133 acre tract, for a distance of 597.59 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 89^38’30" East, departing said west line, for a distance of 390.70 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", on a curve to the left, having a radius of 1062.00 feet, a central angle of 14^30’22"; THENCE, along said curve to the left for an arc distance of 271.35 feet (Chord Bearing South 53^35’19" East 270.61 feet), to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", at the point of tangency; THENCE, South 60^54’30" East, for a distance of 168.83 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", at the point of curvature of a curve to left, having a radius of 1060.00 feet, a central angle of 29^05’30"; THENCE, along said curve to the left for an arc distance of 538.21 feet (Chord Bearing South 75^27’15" East 532.45 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", at the point of tangency; THENCE, South 90^00’00" East, for a distance of 368.11 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 00^00’00" East, for a distance of 120.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 90^00’00" East, for a distance of 99.08 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 00^00’00" East, for a distance of 151.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 90^00’00" W est, for a distance of 153.31 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 00^00’00" East, for a distance of 281.07 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of curvature of a curve to the right, having a radius of 630.00 feet, a central angle of 15^28’05"; THENCE, along said curve to the right for an arc distance of 170.08 feet (Chord Bearing North 04^44’03" East 169.56 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to left, having a radius of 920.00 feet, a central angle of 15^36’29"; THENCE, along said curve to the left for an arc distance of 250.62 feet (Chord Bearing North 07^39’51" East 249.84 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to the right, having a radius of 1137.50 feet, a central angle of 07^53’05"; THENCE, along said curve to the right for an arc distance of 156.53 feet (Chord Bearing North 03^48’08" East 156.41 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to the left, having a radius of 770.00 feet, a central angle of 21^23’00"; THENCE, along said curve to the left for an arc distance of 287.37 (Chord Bearing North 02^56’49" W est 285.71 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to the right, having a radius of 440.00, a central angle of 13^16’34"; THENCE, along said curve to the left for an arc distance of 101.95 feet (Chord Bearing North 07^00’03" W est 101.72 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of tangency; THENCE, North 00^00’39" W est, for a distance of 50.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 89^59’21" East, for a distance of 4.99 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 00^00’39" W est, for a distance of 156.00 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", in the north line of said 143.33 acre tract and being in Allred Road (Variable R.O.W .); THENCE, North 89^29’21" East, along the north line of said 137.02 acre tract and with said Allred Road, for a distance of 358.62 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 00^00’39" East, departing said lines, for a distance of 156.00 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 89^59’21" East, for a distance of 20.23 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 00^00’40" East, for a distance of 104.80 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of curvature of a curve to the left, having a radius of 740.00 feet, a central angle of 08^05’49"; THENCE, along said curve to the left for an arc distance of 104.75 feet (Chord Bearing South 04^03’34" East 104.49 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of tangency; THENCE, South 08^06’29" East, for a distance of 142.30 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of curvature of a curve to the right, having a radius of 455.00 feet, a central angle of 08^05’49"; THENCE, along said curve to the right for an arc distance of 64.30 feet (Chord Bearing South 04^03’34" East 64.25 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of tangency; THENCE, South 00^00’39" East, for a distance of 53.01 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 89^59’21" East, for a distance of 120.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 00^00’39" W est, for a distance of 7.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 89^59’21" East, for a distance of 113.35 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of curvature of a curve to the right, having a radius of 1565.00, a central angle 05^23’11"; THENCE, along said curve to the right for an arc distance of 147.12 feet (Chord Bearing South 87^19’04" East 147.04 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to the left, having a radius of 2435.00 feet, a central angle of 08^38’01"; THENCE, along said curve to the left for an arc distance of 366.92 feet (Chord Bearing South 88^56’29" East 366.57 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", at the point of reverse curvature of a curve to the right, having a radius of 500.00 feet, a central angle of 31^12’20"; THENCE, along said curve to the right for an arc distance of 272.32 feet (Chord Bearing South 77^39’25" East 268.97 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 59^14’55" East, for a distance of 50.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", on a non-tangent curve to the left, having a radius of 2765.00 feet, a central angle of 00^14’26"; THENCE, along said curve to the left for an arc distance of 12.01 feet (Chord Bearing South 30^37’36" W est 12.01 feet), to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 59^29’52" East, for a distance of 120.00 feet, to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc.", on a non-tangent curve to the left, having a radius of 2645.00 feet, a central angle of 02^28’49"; THENCE, along said curve to the left for an distance of 114.50 feet (Chord Bearing South 29^15’44" W est 114.49 feet), to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 62^29’48" East, for a distance of 110.00 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc."; THENCE, North 72^49’53" East, for a distance of 14.22 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", on a non-tangent curve to the right, having a radius of 2525.00 feet, a central angle of 00^22’04"; THENCE, along said curve to the right for an arc distance of 16.21 feet (Chord Bearing North 28^27’28" East 16.21 feet), to a 1/2 inch iron rod set with a yellow cap stamped "Corwin Eng. Inc."; THENCE, South 61^22’52" East, for a distance of 226.41 feet, to a 1/2 inch iron rod found with a yellow cap stamped "Corwin Eng. Inc.", in the east line of said of 143.133 acre tract and said west line of Texas & Pacific Railroad; THENCE South 27^30’12" W est, along said east and west lines, for a distance of 958.17 feet, to the POINT OF BEGINNING and containing 64.335 acres of land. MARCH 2021 SCALE: 1"=100’ OF FINAL PLAT SAGEBROOK PHASE I LOT 1-3, BLOCK A LOTS 1-10, BLOCK E LOTS 1-11, BLOCK I LOTS 1-37, 84-86, BLOCK J LOTS 1-12, BLOCK K LOTS 1-15, BLOCK M LOTS 1-2, BLOCK N LOTS 1-21, BLOCK O LOTS 1-17, BLOCK P LOTS 1-26, BLOCK Q LOT 1, BLOCK R LOT 1, BLOCK S LOT 1, BLOCK T LOT 1, BLOCK U LOT 1, BLOCK X TOTAL LOTS 165 TOTAL RESIDENTIAL LOTS 155 TOTAL OPEN SPACE 10 TOTAL ACRES 64.335 (2,802,448.56 SQ.FT) THIS PLAT IS HEREBY ADOPTED BY THE OWNER AND APPROVED BY THE CITY OF DENTON (CALLED "CITY") SUBJECT TO THE FOLLOWING CONDITIONS THAT SHALL BE BINDING UPON THE OWNERS, THEIR HEIRS, GRANTEES, AND SUCCESSORS: THE PORTION OF BLOCK J, LOT 14, SHOWN ON THE PLAT, IS CALLED "DRAINAGE AND DETENTION EASEMENT." THE DRAINAGE AND DETENTION EASEMENT WITHIN THE LIMITS OF THIS ADDITION, SHALL REMAIN OPEN AT ALL TIMES AND WILL BE MAINTAINED IN A SAFE AND SANITARY CONDITION BY THE HOA AND OWNERS OF THE LOT OR LOTS THAT ARE TRAVERSED BY OR ADJACENT TO THE DRAINAGE AND DETENTION EASEMENT. THE CITY WILL NOT BE RESPONSIBLE FOR THE MAINTENANCE AND OPERATION OF SAID EASEMENT OR FOR ANY DAMAGE TO PRIVATE PROPERTY OR PERSON THAT RESULTS FROM CONDITIONS IN THE DRAINAGE EASEMENT, OR FOR THE CONTROL OF EROSION. NO OBSTRUCTION TO THE NATURAL STORM SEWER RUN-OFF SHALL BE PERMITTED BY CONSTRUCTION OF ANY TYPE OF BUILDING, FENCE OR ANY OTHER STRUCTURE WITHIN THE DRAINAGE AND DETENTION EASEMENT, AS HEREIN ABOVE DEFINED, UNLESS APPROVED BY THE CITY. THE OWNERS AND HOA SHALL KEEP THE DRAINAGE AND DETENTION EASEMENT CLEAR AND FREE OF DEBRIS, SILT AND ANY SUBSTANCE THAT WOULD RESULT IN UNSANITARY CONDITIONS OR OBSTRUCT THE FLOW OF WATER AND THE CITY SHALL HAVE THE RIGHT OF INGRESS AND EGRESS FOR THE PURPOSE OF INSPECTION AND SUPERVISION OF MAINTENANCE BY THE HOA AND OWNERS TO ALLEVIATE ANY UNDESIRABLE CONDITIONS THAT MAY OCCUR. FURTHERMORE, THE CITY SHALL HAVE THE RIGHT, BUT NOT THE OBLIGATION, TO ENTER UPON THE ABOVE-DESCRIBED DRAINAGE AND DETENTION EASEMENT TO REMOVE ANY OBSTRUCTIONS TO THE FLOW OF WATER, AFTER GIVING THE HOA AND OWNERS WRITTEN NOTICE OF SUCH OBSTRUCTION AND HOA AND OWNERS FAIL TO REMOVE SUCH OBSTRUCTION, THE CITY OF DENTON SHALL BE REIMBURSED BY THE HOA AND OWNERS REASONABLE COSTS FOR LABOR, MATERIALS, AND EQUIPMENT FOR EACH INSTANCE. THE NATURAL DRAINAGE THROUGH THE DRAINAGE AND DETENTION EASEMENT IS SUBJECT TO STORM WATER OVERFLOW AND NATURAL BANK EROSION TO AN EXTENT THAT CANNOT BE DEFINITELY DEFINED. THE CITY SHALL NOT BE HELD LIABLE FOR ANY DAMAGES OF NATURE RESULTING FROM THE OCCURRENCE OF THESE NATURAL PHENOMENA OR RESULTING FROM THE FAILURE OF ANY STRUCTURE OR STRUCTURES, WITHIN THE EASEMENT OR OTHERWISE. Planning Approved 04/22/21 Hayley Zagurski FP20-0028 P&Z Approved 04/22/21 FP20-0028 P&Z Approved 04/22/21 Hayley Zagurski 717 City of Denton Development Services “One-Stop-Shop” One Place Serving Denton’s Development Needs 215 W. Hickory St. Denton, TX 76201 (940) 349-8541 https://www.cityofdenton.com/en-us/ April 20, 2021 Chase Fincher, P.E. Corwin Engineering, Inc. 200 W. Belmont Drive Allen, Texas 75013 PROJECT: CEP20-0074 – Sagebrook, Phase 1 SUBJECT: Civil Engineering Plan (CEP) Approval Letter The Sagebrook, Phase 1 (CEP20-0074) civil engineering plans have been reviewed and approved by the City of Denton Department of Development Services. The approved plans will be stamped and uploaded to the Approved Plans folder in the CEP20-0074 ProjectDox folder. Your next milestone in the in the development review process is to gain approval of and file the approved Final Plat associated with this development project and enter into a Development Contract for public improvements. The Development Contract is comprised of the following elements: • An Exhibit “A” (example attached) that clearly indicates the estimated cost of public improvements and matches the quantities provided in the approved plan set; and • Three-way Development Contracts. A checklist guiding the assembly of Development Contract documents can be viewed on the City of Denton’s Land Development webpage. Once the Exhibit “A” component of the Development Contract has been reviewed and approved, we can schedule the pre-construction meeting with the city’s Public Works Inspection division, provide next steps and fees due to work towards a notice to proceed. I will be your Development Project Facilitator throughout this process and will serve as your liaison with the staff Development Assistance Team. Please feel free to contact me at 940.349.7274 or Erica.Marohnic@cityofdenton.com if you have any questions or concerns. Sincerely, Erica Marohnic, AICP Development Project Facilitator City of Denton Development Services 718 Sagebrook Roadway Development Agreement July 27, 2021 Rebecca Diviney , P.E. 21-791 719 Development Overview •Single family residential development with 490 residential lots was approved through PD20- 0001f on July 21, 2020 •Neighborhood will be developed in four sequential construction phases •Final Plat FP20-0028a was approved on April 21, 2021 for Phase 1 21-791 720 Roadway Development Considerations •The approved Planned Development includes several roadway development improvements including: Extension of Brush Creek Road from US 377 to ultimately connect to Allred Road Closure of the current Bonnie Brae Union Pacific Railroad (UPRR) crossing Opening of a new UPRR crossing at the Brush Creek extension •The City of Denton does not currently have funding identified for the design and construction of Brush Creek extension, including the associated railroad crossing The City was also unable to provide specific timing that UPRR would complete their review and approve the proposed closure of the crossing at Bonnie Brae and the new crossing at Brush Creek •To address imminent roadway improvement and access needs for the Sagebrook development, a cross-departmental team of City staff coordinated with the developer to draft a proposed Roadway Development Agreement 21-791 721 Proposed Roadway Development Agreement City Developer Dedicate necessary 120-foot of right of way for Brush Creek extension Design and construct Brush Creek extension to southern Sagebrook entrance including UPRR crossing review and permitting and removal of Bonnie Brae crossing Temporary access point off of Bonnie Brae prior to occupancy of 30th home Completion of a traffic impact analysis related to primary access of the development being from Allred Road due to unavailability of access from Brush Creek Road Construct access drive to future City of Denton Southwest Park Reconstruct 25-foot commercial collector segment of Allred including left turn lane into Sagebrook northern (primary) entrance 8' sidewalk on south side of Allred to western edge of development Construction of remaining 14-foot of commercial collector segment of Allred Road to Sagebrook northern (primary) entrance and reconstruction of full cross-section of Allred Road from neighborhood entrance to County limits line Right-of-Way acquisition for western adjacent property for new lanes of Brush Creek Road to connect to Allred west of Sagebrook development. $980,000 Roadway Impact Fee Assessment $417,600 Roadway Impact Fee Credit (Brush Creek ROW Dedication)* Overview of Proposed Roadway Development Agreement *City to provide credit to Developer 21-791 722 Sagebrook Roadway Improvements 21-791 723 Staff recommends approval of the Roadway Development Agreement with Sagebrook Denton, LP to ensure adequate right-of-way dedication and roadway improvements are made to accommodate the 490 homes and additional traffic generated by the proposed Sagebrook development. Staff Recommendation 21-791 724 Questions? 21-791 725 City of Denton Legislation Text City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com File #:ID 21-1514,Version:1 AGENDA CAPTION Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a Park Development Agreement between the City of Denton and Sagebrook Denton,LP,for the dedication of park land at the Sagebrook Addition; authorizing acceptance of land; and providing an effective date. City of Denton Printed on 7/23/2021Page 1 of 1 powered by Legistar™726 City of Denton _____________________________________________________________________________________ AGENDA INFORMATION SHEET DEPARTMENT: Parks and Recreation DCM: David Gaines, Interim Assistant City Manager DATE: July 27, 2021 SUBJECT Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a park development agreement between the City of Denton and Sagebrook Denton, LP for the dedication of park land at the Sagebrook Addition; authorizing acceptance of land; and providing an effective date. BACKGROUND Denton Sagebrook, LP is developing Sagebrook, a single-family residential development, on approximately 143 acres of land south of Allred Road. The development will consist of 490 residential lots including eight (8) homeowner association lots. In addition, Denton Sagebrook, LP is dedicating 15.258 acres of land to the City of Denton for a future park. The 15.258 acre park land dedication lot is Lot 1, Block X, of the Sagebrook Phase 1 Addition, according to the final plat as depicted on Exhibit 4. This lot is intended to be dedicated to the City to satisfy Park Dedication and Development Ordinance 98-039. The amount of park land dedication required for this development is 10.29 acres but Sagebrook is exceeding the required amount and dedicating 15.258 acres. The park development fees required by Section 22-39 of the City’s Code of Ordinances for the project total $142,590.00. In addition, the developer has agreed to build a 10’ wide trail within the median along Oakleaf and provide Parks and Recreation an easement for public access. This trail will allow for access to the parkland being dedicated as well as the future Southwest Park. As Parks and Recreation is working on the Parks, Recreation and Trails System Master Plan, a number of parks and trails are being proposed that connect neighborhoods throughout the city. These trails primarily reside along major roadways and creeks. This property, with portions in the flood plain, will be an open space parcel along the proposed Hickory Creek Road / Brush Creek Road Trail (Exhibit 3). Final design is not known at this time, however, concepts could include, among other amenities, open play space, prairie restoration, forest restoration and trails. RECOMMENDATION Staff recommends approval of the ordinance as this dedication aligns with the Parks, Recreation and Trails System Master Plan and will create open space for the community. ESTIMATED SCHEDULE OF PROJECT It is anticipated with the execution of this agreement and all required paperwork that the City of Denton could assume ownership of this parcel by the fall of 2021. OPERATIONAL IMPACT City Hall 215 E. McKinney Street Denton, Texas www.cityofdenton.com 727 Anticipated cost to maintain this parcel is estimated at $5,000.00 for regular and annual mowing and litter abatement. While this funding is not budgeted for FY2021-22, these projected maintenance costs will be included in a supplemental request for FY2022-23. FISCAL INFORMATION • Park Dedication: The total value of the proposed property of 15.258 acres per the Denton County Appraisal District is $153,380.28 (per acre: $10,052.45). • Park Development Fee: $142,590.00 ($291 per dwelling unit). PRIOR ACTION/REVIEW (Council, Boards, Commissions) Due to timing for the agreement to be presented to City Council, the Parks, Recreation and Beautification Board will be presented with an updated on this acquisition of park land on August 2, 2021. EXHIBITS Exhibit 1 – Agenda Information Sheet Exhibit 2 – Ordinance Exhibit 3 – Presentation Exhibit 4 – Final Plat Respectfully submitted: Gary Packan, Parks and Recreation Prepared by: Gary Packan, Parks and Recreation 728 ORDINANCE NO.__________ AN ORDINANCE OF THE CITY OF DENTON AUTHORIZING THE CITY MANAGER TO EXECUTE A PARK DEVELOPMENT AGREEMENT BETWEEN THE CITY OF DENTON AND SAGEBROOK DENTON, LP, FOR THE DEDICATION OF PARK LAND AT THE SAGEBROOK ADDITION; AUTHORIZING ACCEPTANCE OF LAND; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, Sagebrook Denton, LP (the “Developer”), owns and is currently developing a 143.133 acre parcel of property within the City of Denton, known as Sagebrook Addition, and requests to dedicate certain land in fulfillment of its Park Dedication requirement of Section 22- 37 of the City’s Code of Ordinances; and WHEREAS, the Interim City Manager recommends, and the City Council deems it in the public interest that the City enter into the Park Development Agreement attached hereto; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION 1. The findings and recitations contained in the preamble of this Ordinance are incorporated herein by reference. SECTION 2. The Interim City Manager is hereby authorized to execute on behalf of the City, the Park Development Agreement as attached hereto and incorporated by reference herein. SECTION 3. The Interim City Manager, or her designee, is hereby authorized to receive land and to undertake the obligations as set forth in the Park Development Agreement in accordance with the terms of the Park Development Agreement. SECTION 4. This Ordinance shall become effective immediately upon its passage and approval. The motion to approve this ordinance was made by __________________________ and seconded by _________________________________, the ordinance was passed and approved by the following vote [___ - ___]: Aye Nay Abstain Absent Gerard Hudspeth, Mayor: ______ ______ ______ ______ Vicki Byrd, District 1: ______ ______ ______ ______ Brian Beck, District 2: ______ ______ ______ ______ Jesse Davis, District 3: ______ ______ ______ ______ Alison Maguire, District 4: ______ ______ ______ ______ 729 Deb Armintor, At Large Place 5: ______ ______ ______ ______ Paul Meltzer, At Large Place 6: ______ ______ ______ ______ PASSED AND APPROVED this the _____ day of ___________________, 2021. __________________________________ GERARD HUDSPETH, MAYOR ATTEST: ROSA RIOS, CITY SECRETARY BY: __________________________________ APPROVED AS TO LEGAL FORM: CATHERINE CLIFTON, INTERIM CITY ATTORNEY BY: __________________________________ Digitally signed by Mack Reinwand Date: 2021.07.23 13:39:50 -05'00' 730        731        732        733        734        735                         Digitally signed by Mack Reinwand Date: 2021.07.23 13:40:18 -05'00' 736        737        738        739        740        741        742        743        744        745        746        747 Parkland Dedication & Development Sagebrook Property Gary Packan Parks and Recreation Director July 27, 2021 PAC 20-035; Sept. 4, 2020 1 Exhibit 3 ID 21-1514 748 7/27/21 ID 21-1514 Sagebrook Property •Developer Intends to Dedicate •15.258 acres of park land •$142,590.00 ($291 x 490) •Easement for median trail ID 21-1514 2 749 Proposed Connectivity to Future Parks 3 7/27/21 ID 21-1514 HICKORY CREEK ROAD TRAIL Sagebrook Development Future Park Proposed Hickory Creek Road Trail Proposed Trails in Master Plan 3750 Questions? PAC 20-035; Sept. 4, 2020 4 7/27/21 ID 21-1514 4 751        752