Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
011521 Friday Staff Report
City Manager’s Office 215 E. McKinney St., Denton, TX 76201 (940) 349-8307 OUR CORE VALUES Integrity Fiscal Responsibility Transparency Outstanding Customer Service MEMORANDUM DATE: January 15, 2021 TO: The Honorable Mayor Hudspeth and Council Members FROM: Todd Hileman, City Manager SUBJECT: Staff Report I. Council Schedule A. Meetings 1. MLK Holiday – Monday, January 18, 2021 2. No - City Council Meeting on Tuesday, January 19, 2021. 3. Civil Service Commission on Tuesday, January 19, 2021 at 3:30 p.m. via video/teleconference – City Council Work Session Room. 4. Cancelled - Mobility Committee Meeting on Wednesday, January 20, 2021 at 9:00 a.m. in the City Council Work Session Room. 5. Cancelled - Agenda Committee on Wednesday, January 20, 2021 at 2:30 p.m. in the City Manager’s Conference Room. 6. Work Session of the Planning and Zoning Commission on Wednesday, January 20, 2021 at 4:30 p.m. followed by a Regular Meeting at 6:30 p.m. via video/teleconference – City Council Work Session Room. 7. Committee on Persons with Disabilities on Thursday, January 21, 2021 at 3:00 p.m. via video/teleconference – City Council Work Session Room. II. General Information & Status Update A. Fire Station 8 Promotions and a first for the Denton Fire Department – The Denton Fire Department is excited to announce the following promotions for Fire Stat ion 8 located on Colorado Blvd at Brinker Rd. scheduled to open in February. Promoting to Fire Captain: Jeff Dye, Carey McAdoo, Clint Stephenson Promoting to Fire Driver: Shea Enos, Cole Hudson, Gerald Friend, Kenneth Sherwood, Jason Glaze, Paul Tuttle In the 147-year history of the Denton Fire Department, Captain Carey McAdoo will be the first ever sworn female officer. Congratulations to all those receiving promotions! Staff contact: Kenneth Hedges, Fire DFD Captain Promotions DFD Driver Promotions B. COVID-19 Testing in Wastewater – This week, Elected Officials received an e-mail from a citizen regarding COVID-19 testing in wastewater. As previously reported in May 2020, staff collaborated with Baylor University on a limited study for monitoring SARS CoV-2 ribonucleic acid (RNA) in wastewater during the early months of the 2 COVID-19 pandemic. Baylor University is currently working with the Texas Department of State Health Service s (TDSHS) to expand the scope in the initial project. The City of Denton has been included as a participant o f the 18-month research. No preliminary results of the study have been shared with the City at this time. Staff contact: Deborah Viera, Environmental Services C. Lighthouse Dog Barking – On January 11, Animal Services received information regarding several after-hours calls placed by a resident on Lighthouse Dr. concerning a barking dog. Animal Services On-Call Officers are scheduled to respond to animal emergency related calls such as animal bites, injured animals or vicious animals. Animal Services did reach out to the complainant to gather further information to begin the process of trying to resolve the issue. Staff Contact: Randi Weinberg, Animal Services D. MLK Jr. Day Annual Celebration on January 18 – Denton Parks and Recreation will co-host the annual MLK Jr. Day event in cooperation with Pastor Cedric Chambers, the President of Denton & Vicinity Ministerial Alliance. The community is invited to a march, starting at 3 p.m., that will begin at Fred Moore Park. Participants will assemble in front of the American Legion Hall Senior Center (629 Lakey St.) and conclude at the MLK Jr. Rec Center (1300 Wilson St.). Groups are asked to socially distance themselves and wear masks. When the march concludes at the rec center, City staff will hand out 250 free mea ls on a first -come, first -serve basis. The catered meals are individually wrapped. Starting at 4:30 p.m., the Ministerial Alliance will host a virtual program from Mt. Calvary Baptist Church. The program will be broadcast live on their Facebook page, https://www.facebook.com/mcbcdenton. Mayor Hudspeth and Councilwoman Birdia Johnson will provide the greeting. Elder Michael McWilliams of Dominion Word COGIC will offer the prayer, and Pastor Henry Thomason of Hamilton Chapel will give the keynote address. Staff contact: Cheylon Brown, Parks and Recreation E. DHA Awarded Additional Vouchers and Opening Wait List – The Denton Housing Authority (DHA) was awarded seventy-five (75) additional Mainstream Program vouchers from the Department of Housing and Urban Develo pment (HUD). This brings their new total to 192 Mainstream Program vouchers. The Mainstream Program provides vouchers for non-elderly disabled persons with disabilities who are transitioning out of institutional or other segregated settings, at serious ris k of institutionalization, experiencing homelessness, or at risk of becoming homeless. The person with the disability may be the head of household or a member of the household. Mainstream Program vouchers are different from DHA’s primary voucher program, the Housing Choice Voucher program (also referred to as Section 8). DHA currently administers 1,641 Housing Choice Vouchers to low-income households. DHA will open their Waiting List for applicants from January 17 at 12:00 a.m. to January 31 at 11:59 p.m. Applicants who are a resident of the City of Denton, experiencing homelessness, elderly, handicapped or living with a disability, veteran, or victim of domestic violence will receive preference over other applicants. Final eligibility will be determined later. Only online applications will be accepted. Eligible 3 applicants must visit the DHA website (www.dentonhousingauthority.com) and click the “Apply for Housing” button at the top of the page. DHA staff will be available by phone for applicants who cannot access a computer at (940) 383-1504 starting January 17. The public notice flyer is attached. Collaborative members of the Denton County Homelessness Leadership Team Housing Workgroup reviewed the current Denton County Housing Priority List to identify people experiencing homelessness who fit the priority categories for the Mainstream Vouchers. Members developed plans to assist people on the list in DHA’s application process in the coming weeks. Staff contact: Courtney Cross, Community Services F. Denton Fire Department Assists Denton County Public Health – Members of the Fire Department have been assisting the County Health Department weekly at COVID-19 vaccination shot clinics since December 28, by providing a staffed ambulance with paramedics monitoring for any adverse reactions to the vaccine. This week, along with providing an ambulance, additional personnel assisted in the administration of the vaccine to nearly 3,000 recipients on Thursday. The Fire Department is committed to support and assist Denton County Public Health during future COVID-19 vaccination clinics. Staff contact: Kenneth Hedges G. Denton Police Department Mental Health Division News – Positive progress continues for Denton PD’s Mental Health Division as the team works toward being fully operational. Recent successes are highlighted in the attached newsletter. The latest edition also introduces new Crisis Intervention Manager Sara Gawor who describes recent Crisis Interventio n Response Team (CIRT) activity and provides a look at what lies ahead for the Mental Health Division. Staff contact: Frank Dixon, Police H. Denton County Day – At the January 5 City Council meeting, the Council inquired on the status of the 2021 Denton County Days event, particularly if it would occur during the COVID-19 pandemic. Traditionally, Denton County Days is a multi-day event in Austin, TX where local leaders throughout Denton County can engage with the state legislative process and legislators to advocate for their shared priorities. The 2021 Denton County Day will be a single-day virtual event to be held on Thursday, February 25, primarily during the midday hours. Details are still being finalized, but 4 the event will include a State of the County address and moderated discussion with state representatives. The Denton Chamber of Commerce will send out notices in the coming weeks with more information and registration instructions. The Council will be notified when registration is available. Staff Contact: Ryan Adams, Customer Service and Public Affairs I. State Legislative Session Update – The 87th Session of the Texas Legislature convened on Tuesday, January 12. Both chambers spent the week electing leadership, with Representative Dade Phelan (R-Beaumont) being elected Speaker of the House, and adopting rules for the session. Of the rules being adopted, many pertained to the operation of each chamber during the session. The Texas House of Representatives will not be requiring COVID-19 testing prior to entering the House chamber or a committee meeting, while the Senate will. Additionally, all committee meetings will be livestreamed and, while the House will allow fo r virtual participation in committee meetings by members, that privilege does not extend to those giving non-invited testimony. All committee testimony, including potential testimony by City of Denton staff and elected officials, must be given in-person for both chambers unless that entity or person’s testimony is expressly invited. Committee Changes (Senate): • Removed the Committee on Agriculture; and renamed the Committee on Water and Rural Affairs to Water, Agriculture, and Rural Affairs. • Renamed the Committee on Intergovernmental Relations to Local Government. • Removed the Committee on Property Tax. • Reinstated the Committee on Jurisprudence (this was a standing committee until the 84th Session in 2015). Committee Changes (House): • None, though House committee announcements are expected on or around January 29. Both houses stand adjourned until Tuesday, January 26. Staff contact: Ryan Adams, Customer Service and Public Affairs J. Upcoming Updates to B&C Handbook Set for February 2021 – Every year, the City Secretary’s Office undertakes the annual review of the Boards & Commissions Handbook to determine if changes are needed. This year, there have been name changes to two City Council Committees and the creation of two new boards. Those proposed changes will be reflected in this year’s updates and presented for consideration in late February to early March. Most recently, the Parks, Recreation and Beautification Board adopted the attached memorandum asking City Council to review its att endance policy for boards/commissions. The B&C Handbook lays out a process by which any board member whose absence does not meet the excused absence criteria can submit an appeal to the City Secretary who shall then submit a request for an exception from the City Council. The attached “B&C Member Attendance Report Guidelines” were created and provided to every member whose absence is determined to not meet the excused absence criteria. To date, there were five (5) unexcused absence with every member provid ed the 5 Guidelines and offered the opportunity to seek an exception from City Council. No member requested any exception. Because the attendance policy is incorporated within the Handbook, Council discussion on the attendance policy and any desired changes can take place when the B&C Handbook item is scheduled for consideration in late February to early March. Staff contact: Rosa Rios, City Secretary’s Office K. New Construction Specifications and Standard Details – The Capital Projects/Engineering and Utilities Departments are pleased to announce that after a two-year collaborative effort, the City now has Denton-specific construction specifications and standard details. Construction specifications are the foundation of constructing public infrastructure. These specifications describe in detail the work to be performed, accepted construction methods, how the quality of construction is determined, how the work will be measured, and how the City’s contractors will be paid. Clearly defined specifications minimize change orders which, by extension, reduce potential risks incurred by the City with respect to increases in scope, schedule, and budget. Standard details are detailed drawings that visually represent the technical requirements of the construction specifications. The new construction specifications and standard details have an effective date of January 15, 2021 and will be used on all future solicitations for City of Denton construction projects. Staff training is occurring over the next two weeks to ensure staff are familiar with the new requirements. The trainings are also being recorded for staff who are unable to attend. An overview is scheduled with Design Consultants at 1:00 p.m. on Thursday, February 18, members of the private development community will also be invited to that training and the training will be recorded and available upon request. Staff will also discuss the new construction specifications and standard details and solicit feedback at future Developer Town Hall meetings. The new construction specifications and standard details are available on the City of Denton’s Land Development Webpage (www.cityofdenton.com/landdevelopment ) under “Helpful Documents.” The Land Development Webpage also includes a link to a feedback form where residents, developers, contractors, and other interested parties can submit feedback on the new document. A direct link to the feedback form is available here. The attached flyer includes additional details about the City’s construction specifications and standard details. The construction specifications and standard deta ils will be updated on an annual basis. Staff will collect feedback from the public through summer 2021, make revisions in fall 2021, and the next draft will have an effective date in January 2022. Staff contact: Rebecca Diviney, Capital Projects L. New Economic Development Quarterly Report – Throughout 2020, the City and Chamber worked together to craft a new economic development partnership agreement, increasing cooperation and transparency. A requirement of the new agreement was the creation of a new joint quarterly report that included activities of both the City and Chamber. The intent of the joint report was to demonstrate that the efforts of many individuals and groups combine to contribute to the economic development efforts in Denton. Staff worked over the past few months to design a new report to share with the Economic Development Partnership Board, City Council, 6 Economic Development Investors, and Chamber of Commerce. A copy of the FY 2020-21 1st quarter report is attached. The new report includes key stats and activities as well as introduces new economic development -related programs and plans. With this being the first issue of the new report, the economic development team invites feedback and comments to ensure relevant information is presented in a meaningful format. Staff contact: Jessica Rogers, Economic Development M. Post Oak and Blackjack Oak Transplant Experiment – Weather permitting, on January 16, Denton Parks and Recreation Department will host a small group workday to harvest Post Oak trees and Blackjack Oaks trees from the Eagle Creek development located southwest of Denia Park. In addition to this workday with volunteers from Connections Wellness Group's Champions of Radical Change committee, PARD is recruiting volunteers for three additional workdays. Due to COVID-19 restrictions, groups are limited to 10 for these workdays. PARD hopes to harvest 40 to 60 trees depending on the number of volunteers and digging conditions. The trees will be potted and planted in other parks in Denton in the near future. Many of the saplings are in forested areas with a high concentration of rocks, making it challenging to dig by hand. Therefore, PARD will target saplings growing on the fringe of the forested areas in the pasture that do not have high rock concentrations. Staff contact: Haywood Morgan, Parks and Recreation N. Utility Assistance Funding Update - Until December 1, 2020, Interfaith only worked with need-based clients who have not been impacted by COVID-related income loss and had the opportunity to aid 57 households. December showed a steep increase in the number of families seeking assistance. Greater than $25,000 was distributed in assistance and the clients served in December is greater than 50% of the clients served this fiscal year. Recent month and year qualification statistics are provided below: In the December 17, 2020 meeting, City Council approved an additional $125,000 in fiscal year funding for distribution through Interfaith Ministries. With the increase in funding, Interfaith Ministries’ available funds and remaining budget account for 82% of their allocated funds for use. Currently, 75% of the fiscal year remains. 7 Any customer who contacts Customer Service indicating need for assistance is submitted to Interfaith Ministries as a referral and is granted an agreement to ensure service continuation while they are working through the application process. Staff contact: Christa Foster, Customer Service and Public Affairs O. Bonnie Brae Bridge Scheduled to Open to Traffic Next Week – Weather permitting, the Capital Projects Department is excited to announce that on Tuesday, Jan. 19, crews will begin switching the northbound traffic lanes of Bonnie Brae Street from Vintage Boulevard to Roselawn Drive onto the new bridge as part of the Bonnie Brae Phase 1 project! The traffic switch is expected to be complete by 5 p.m. the same day. The Bonnie Brae Phase 1 project limits include Bonnie Brae Street from Roselawn Drive to north of Vintage Boulevard. The southbound traffic lanes are scheduled to remain on the existing roadway for another 4 to 5 weeks, weather permitting, until the Bonnie Brae Street at Vintage Boulevard intersection construction is complete. After the intersection construction is completed, the southbound traffic will be placed on the new bridge as well. Until the switch is complete, and over the new few weeks, intermittent lane closures may be in place as crews safely complete the remaining construction activities. The Bonnie Brae Phase 1 project rema ins on schedule to be open by March 2021. Images of the new bridge are provided below. Staff contact: Seth Garcia, Capital Projects P. Downtown Parking Concern – Economic Development and the Police Department were made aware of a parking concern on t he face of the downtown square regarding extended parking of business vehicles over the weekends when parking time limits are not enforced. Staff is in contact with downtown business owners and reached out 8 through the Texas Main Street network to discuss what other communities have done regarding this or similar issues. In addition, staff is working with the Denton Main Street Association to discuss concerns. Once data and input have been gathered, staff will provide updates and options regarding this issue. Staff contact: Jessica Rogers, Economic Development Q. Water Complaints – Staff is aware of several resident complaints that have been posted on social media regarding the current taste of tap water. Staff is not aware of any system malfunctions in the wat er production system, although the Lake Lewisville plant has been offline for the last several days due to construction of plant improvements. The Ray Roberts plant has been producing all the water needs of the City during that time. Routine water testing has not shown any quality issues and we do not believe these observations pose any risk to c itizens. Our water production and water quality professionals believe the taste issue is due to the water in Lake Lewisville and Lake Ray Roberts “turning over”. This is a seasonal phenomenon that is described below. Necessary water line flushing last week may have contributed somewhat to these observations, but that maintenance activity was completed this week. Staff will continue to investigate and sample the water distribution system to determine if there any other contributors to these noticed changes and will communicate any finding we have to the public. Staff contact: Terry Naulty, Water Utilities R. New City-Related Bills Filed – During the current session of the Texas Legislature, the Texas Municipal League provides its member cities with summaries of all city- related bills that have been filed. The attached bill list represents bill summaries of city-related bills filed in the last week. Staff is actively reviewing these proposed bills 9 to evaluate their potential impact and develop strategies to engage in outreach with the legislature and our local delegation prior to and during the upcoming session. Questions regarding any piece of legislation or to receive the full text of legislation, please contact Ryan Adams or Rachel Balthrop Mendoza. Staff contact: Ryan Adams, Customer Service and Public Affairs S. Georgetown Drive Utility Work – On January 7, Mayor Pro Tem Davis requested information on the timeline for street repairs following recent utility work on Georgetown Drive. The intersection of Georgetown Dr. and Amherst Dr. was recently disturbed as a part of the utility replacement on Amhurst Dr. in preparation for its reconstruction. Amherst Dr., from Georgetown Dr. to Hinkle Dr., is currently scheduled for reconstruction from October 2021 to February 2022. The wastewater line replacement, from Georgetown Dr. to Hinkle Dr., was recently completed on December 23. The water line is scheduled for replacement in March 2021. To address the interim condition, the City’s concrete and asphalt contractor has been scheduled to complete a permanent asphalt patch on January 18. Staff contacts: Pritam Deshmukh, Water Utilities and Daniel Kre mer, Public Works T. Windsor Drive Future Extension – On January 5, a resident reached out to Capital Projects staff requesting information on when the dead end of Windsor would be fully extended to Loop 288. The portion of Windsor between Dominion St. and Loop 288, shown below, will be constructed when the vacant property adjacent to the Loop develops. This is the normal process by which the City grows its infrastructure. Just as the new subdivision (2016-2017) constructed its portion of Windsor east of Old North, the property between Dominion and Loop 288 will be responsible for constructing the portion of Windsor that traverses or is adjacent to it. However, the connection to Loop 288 will be at TxDOT’s discretion, which may elect to not allow the connection until frontage roads are in place. A list of TxDOT’s current and planned construction projects can be found here: https://www.txdot.gov/inside- txdot/district/dallas/maps.html. Staff contact: Brian Jahn, Capital Projects 10 U. Inclement Weather Overview - On January 11, Council Member Armintor requested information regarding the fact that the inclement weather shelter did not open on Sunday, January 10. City staff is prepared to implement the Inclement Weather Policy approved by Council, which allows for the use of select City Facilities to be utilized by nonprofit agencies as warming stations after regular business hours. The MLK Jr. Recreation Center will open as a warming statio n when the low temperature is expected to fall below 32 degrees, or the City has declared an emergency for weather conditions. Neither of these conditions were met during the 8 a.m.-5 p.m. operational hours for the recreation center. Staff will continue to monitor the forecast and open the MLK Jr. Recreation Center as needed based on the inclement weather policy. At this time, recreation staff has not received any requests for the facilities after hours but would limit facility usage based on the current open facilities. When nonprofit agencies decide to extend hours, or services because of inclement weather, Community Development staff help to facilitate communication and sends out an email to all stakeholders, including nonprofits, cities, county, public safety agencies, DCTA, library, active volunteers, and others, to inform them of the confirmed inclement weather openings. These emails help spread the word to clients, especially those at City facilities or Our Daily Bread during the day. In addition, the City and nonprofit agencies share the information on social media channels. The Use of City Facilities Agreement and the Inclement Weather Flyer are attached. Staff contact: Caroline Seward, Parks and Recreation III. Upcoming Community Events and Meetings A. Public Meetings 1. None IV. Attachments A. DHA Public Notice ........................................................................................... 13 B. Mental Health Division News ........................................................................... 14 C. Parks Board Memorandum ............................................................................... 21 D. Denton Construction Standards ......................................................................... 23 E. Economic Development Quarterly Report......................................................... 24 F. TML New Bill Listing – Posted January 15 ...................................................... 32 G. Use of City Facilities During Inclement Weather Policy ................................... 41 H. Inclement Weather Flyer .................................................................................. 47 11 V. Informal Staff Report A. 2021-004 Gibbons Creek Follow Up................................................................. 48 B. 2021-005 S&P Global Rating ........................................................................... 50 C. 2021-006 Business Retention and Expansion Program ...................................... 64 D. 2021-007 Economic Development Strategic Plan.............................................. 78 E. 2021-008 Q1 Sponsorships and Donations ...................................................... 161 F. 2021-009 Q4 Quarterly Financial Report ........................................................ 163 VI. Council Information A. Council Requests for Information .................................................................. 211 B. Council Calendar ........................................................................................... 213 C. Draft Agenda for January 26 ........................................................................... 216 D. Future Work Session Items ............................................................................ 222 E. Street Construction Report ............................................................................. 223 12 Mainstream-DHA-01-04-21-SM PUBLIC NOTICE: DENTON HOUSING AUTHORITY DENTON, TEXAS OPENING WAITING LIST & NEW FUNDING DHA will be opening the Waiting List for applicants on January 17th, 2021 at 12:00 am - January 31st, 2021 at 11:59 pm. Applicants who may be a resident of the City of Denton, homeless, elderly, handicapped, or disabled, veteran, or victim of domestic violence will receive preference over any other applicants. Final eligibility will be determined later. DHA has also received additional funding from the Department of Housing and Urban Development for the Special Purpose - Mainstream Program, which provides vouchers for non-elderly disabled persons with disabilities who are transitioning out of institutional or other segregated settings, at serious risk of institutionalization, homeless, or at risk of becoming homeless. The disabled person may be the head of household or a member of the household. There are limited vouchers available for this program. Pre-Applications will be accepted ELECTRONICALLY (ON-LINE ONLY) at www.dentonhousingauthority.com Eligible applicants must visit the DHA website and click the “Apply for Housing” button at the top of the page. NO PAPER APPLICATIONS WILL BE ACCEPTED! Applicants are encouraged to use their own computers or handheld devises or a computer of other public sources. Due to COVID-19 restrictions, we will only be available by phone for applicants who cannot access a computer by any other means at 940-383-1504, beginning January 17th, 2021. Special assistance will be provided for the elderly, handicapped, and disabled as needed upon request. Applicants with any other special need or reasonable accommodation may also contact us at our office for assistance. Pre-Applications WILL NOT be mailed, faxed, or accepted in person. Pre-Applications will be placed on the Waiting List in accordance with the DHA Administrative Plan. Applicants may log onto the DHA website under the Applicant Portal to check their status or update their application. DHA will issue vouchers as your name moves to the top of the list and funding is available. DHA complies with all applicable Fair Housing Laws. 13 2020December 14 SaraGawor 15 iffi Pic tuiri ie df(Lifo uRiPffi iiiiRgRh) uf:R de::) ac wR:ifyye, sifiL Eeh Cei lffi Pic, . PKwFdnK.pO fiP:KIeTicKmRfvKieKiLiKbkMKfCKHeTiImiP, nLihKLRTiKPififTicKiPRfCfC(KfCKbiCiRyKkiRyiLKEfP:iKDfc) iPR IR)KPi:fyfiCfh)KRCcKyiRciP:Lfl,KDyyKwFdnKIiImiP: RCcKRcN Cfi:KgfyyKRiiiCcKiLiKnw.uaKbiCiRyKkiRyiLKiiRfi .pO fiPKfe P:iKiLiKAjP:iKgiivKerKJRC RPh,KEeyyegfC(KiLi fe P:i)KgiKgfyyKIiiiKgfiLKJ c(iKJRLCKRCcKiLiKbiCiRy kiRyiLKwe PiKrePKfC:iP fifeCKeCKiLiKfe Pi’:KlPefi::i: RCcKlPeliPKaM.KrePIRi,KwFdnK.pO fiP:KLRTiKRy:eKmiiC feCc fifC(Kreyyeg- l:KeCKIiCiRyKLiRyiLKfCrePIRifeC PilePi:K:iiIIfC(KrPeIKfRyy:KiLRiKlRiPeyKPi:leCcicKie, WiKRPiKy fvhKieKLRTiKiLi:iKiCiL :fR:iffKRCcKcPfTiCKepO fiP: eCKiLiKiiRI,KnLiKbkMKf:KyeevfC(KrePgRPcKieKiLiKRIRzfC( iLfC(:KiLihKgfyyKRffeIlyf:L, wPf:f: FCiiPTiCifeC di:leC:i niRI 16 17 18 19 WhatLiesAhead Though 2020 has been a difficult and trying year, it is not without good. Good people, good moments, and hope persist on. This next year will see the sprouts of the planted seeds of good things. As the MHD continues on this journey, we will see the addition of new faces and new training. CIRT will become operational and steadfastness. will and we begin fine-tuning our response to those in the community in need of mental health services. We look forward to serving our community with compassion 20 City Manager’s Office 601 E. Hickory St., Suite A, Denton, TX 76205 (940) 349-8307 OUR CORE VALUES Integrity Fiscal Responsibility Transparency Outstanding Customer Service MEMORANDUM DATE: November 9, 2020 TO: Mayor and City Council Members FROM: Frances Punch, Chair, Parks and Recreation Board SUBJECT: Request to amend Ordinance 19-2866 First, and foremost, I would like to thank the Mayor and Council members for allowing me to serve as the Chair of the Parks, Recreation and Beautification Board over the course of the last two years. During the last eight months, the pandemic has caused great challenges for the community. The BOARD and I, appreciate your diligence in leading the community through these uncertain times. Background: On January 28, 2020, City Council adopted Ordinance 19 -2866 updating absence provisions for boards, commissions, and committees and establishing how an absence will be determined to be excused or unexcused. Excused Absence: An excused absence shall include the following: • personal or family illness, • death of a family member, • jury duty, • service in the armed forces, • testifying before the legislature, • attending a seminar involving municipal matters of importance to the member's duties, and • absence necessary for the member's business or employment. On March 2, 2020, the Parks and Recreation Department (PARD) presented the updated policy amendments to the Parks, Recreation and Beautification Board (BOARD) to review Ordinance 19-2866 and clarify any questions regarding the absenteeism process. There was no direction provided as the discussion was for informational purposes. On August 10, 2020, I received a request for an excused absence for the August 17, 2020 BOARD meeting from a Board member. Notification was received in a timely manner with detailed information regarding the need for the absence. “I have to pick up my minor child from the airport. It has to be the parent". The request for the excused absence was denied stating the purpose of the absence does not meet the excused absence criteria. Additionally, in light of COVID 19, the BOARD has experienced more absenteeism, especially since the meetings have been moved from the traditional 6:00 PM to during the work day. 21 2 At the September 14, 2020 BOARD meeting, I requested a future agenda item regarding Ordinance 19-2866. The discussion was intended to help clarify excused and unexcused absences as well as provide the opportunity to identify and recommend to the City Council possible recommended changes to Ordinance 19-2866 should the BOARD decide such is necessary. I believe the additions of “Family Responsibilities” and “Pandemic/World Events/Emergency Situations” to the excused absence criteria will broaden the available options and facilitate Board members time management. Recommendation: Chair, representing the BOARD, recommends consideration for adding “Family Responsibilities” and “Pandemic/World Events/Emergency Situations” to the Boards, Commissions, and Committees excused absence criteria of Ordinance 19-2866. 22 DENTON CONSTRUCTION STANDARDS These specifications describe key details for how work should be performed for City infrastructure and are intended to clarify roles and responsibilities of City staff and contractors as projects are being designed and constructed. Our new standards include detailed drawings that visually represent the technical requirements of the construction specifications. This means you can plan more efficiently from the start to the end of your construction project! The new construction specifications and standard details can be found on the City of Denton website, here: https://bit.ly/3bBeJOt. Once you review the standards, we'd love to get your feedback! These standards will grow and evolve, so we value all input as we work to keep our standards at the cutting edge. Fill out the feedback survey here: https://bit.ly/2XEoxik. The City of Denton is pleased to announce that the new Denton-specific construction specifications and standard details go into effect on Friday, January 15 , 2021 ! Training for City design consultants and members of the development and construction community is currently scheduled for February 18, 2021. Emails will be sent to the City’s existing listservs for contractors and design firms with additional details on how to register for this training. For those unable to attend, a recording of the training will be available upon request. WHY THIS IS GREAT NEWS! FIND THE STANDARDS AND PROVIDE FEEDBACK TRAINING DATES 23 DENTON ECONOMIC DEVELOPMENT PARTNERSHIP FY 2020-2021 1st Quarter Report Oct -Nov -Dec 24 EconStat 20-21: Q1 Page 2 We’re Here For All Businesses! The Denton Economic Development Partnership can assist your business with: Site search & selection Expansion or relocation Workforce and training programs Labor market analyses Demographic research Incentive applications City processes or operations Business networking Investment opportunities Denton’s Top 5 Industries by Jobs 1. Government 2. Health Care & Social Assistance 3. Manufacturing 4. Accommodation & Food Service 5. Retail Trade Denton’s Fastest Growing Industries 1. Transportation & Warehousing 2. Arts, Entertainment & Recreation 3. Government 4. Management of Companies & Enterprises 5. Information Demographics Population: 141,522 Median Age: 29.5 Median Household Income: $66,644 Bachelor’s Degree or Higher: 42.7% Denton EDP City of Denton Econ. Dev. 0.00% 2.00% 4.00% 6.00% 8.00% 10.00% 12.00% 14.00% 16.00% Dec '19 Jan '20 Feb '20 Mar '20 Apr '20 May '20 June '20 July '20 Aug '20 Sep '20 Oct '20 Nov '20 Unemployment Rate Denton Texas USA $0 $500,000 $1,000,000 $1,500,000 $2,000,000 $2,500,000 $3,000,000 $3,500,000 $4,000,000 $4,500,000 Sales Tax Collections 2019 2020 Source: Data.Census.Gov Source: Emsi Source: Emsi 0 20,000,000 40,000,000 60,000,000 80,000,000 100,000,000 120,000,000 0 50 100 150 200 Oct Nov Dec New Residential Permits & Value Total Permits Value 0 20,000,000 40,000,000 60,000,000 80,000,000 100,000,000 120,000,000 0 1 2 3 4 5 6 7 Oct Nov Dec New Commercial Permits & Value Total Permits Value 25 Business Attraction 20-21: Q1 Page 3 Site Visits Hosted RFIs Submitted 1 16 Q1 PROSPECTS IN PROGRESS Project Industry Investment Jobs Status Source Hydrogen Chemical Manufacturing $500+ million 100 to 200 RFI In Progress G Auf Wiedersen Advanced Manufacturing $750 million 3,500 Submitted G Make Mydata Data Center N/A 100 Submitted Vidar Biomaterials $25 million 159 Submitted D Jupiter Manufacturing $25 million 300 Submitted F Elsa Storm Food Processing N/A 190 Submitted G UHT-BM Manufacturing $50 million 40 Submitted G, D Ranchland Foods Food Processing/HQ $5 million 140 Incentive Negotiation DI Urban 35 Spec. Building N/A N/A Prospect Due Diligence DI Blue Nose Manufacturing $5 million 100 Submitted G, D Free Flow Medical Manufacturing $12 million 355 Short List; Site Visit; Not Selected G, D Mockingbird Flight Manufacturing $2 million 100 Submitted G, D Loonie Bin Manufacturing $3.8 million 200 Submitted G Potential Manufacturing/HQ $11.5 million 75 Submitted D Andes Aviation $45 million 120 DNMQ G Chosen One Food Manufacturing/HQ N/A N/A Submitted D KBC Spec. Building N/A N/A Prospect Due Diligence DI Pathway Injection Molding $2.5 million 21 Submitted F Brie Merry Food Manufacturing $5 million 51 Submitted D Cold Storage WH Cold Storage N/A N/A Prospect Due Diligence DI CTDI Spec. Building N/A N/A Submitted DI Rodeo Manufacturing N/A 100 Submitted DI Mana Med N/A N/A N/A Submitted DI 4 Requests for Incentive Review In the News Home improvement giant Lowe’s plots shipping hub in Denton (Dallas Morning News)648k square feet; 100 new jobsG=Governor’s Office, D=Dallas Regional Chamber, F=Fort Worth Chamber, DI=Direct, O=Other 26 We review all the data we’ve collected and consider any strategic or tactical changes to our programs. Evaluation Period Business Retention & Expansion 20-21: Q1 Page 4 Retention Visits Q10 0 YTD VisitsNEW YEAR NEW PLAN 2020 brought lots of changes, including the development of a new BRE Plan. The team spent Q1 drafting, reviewing, and planning. Learn about the BRE program below and track our progress here in 2021! Request a Visit Virtual Visits Due to the ongoing COVID-19 pandemic, future BRE visits will be virtual visits held via Zoom or Microsoft Teams. We’ll provide the link. You provide the best background! We’ve Gone Digital New System Around 75 business are selected for visits each year based on various factors; however, any business can request a BRE visit by contacting our office at economic.development@cityofdenton.com. We’re implementing a new CRM system. This will allow us to provide businesses a digital pre-survey, where they can give us valuable information to make sure we get the right people in the room. 2021 Visit Goals THE BRE PROCESS ---------------------- Introductory Contact Digital Pre-Survey Visit & Data Collection Business Selection Follow Up & Resolution The team reviews key economic criteria and selects businesses in each targeted area or business category. We reach out to businesses, introduce ourselves, educate them on our programs and services, then schedule a visit. We send each business an online survey. This allows us to prepare for each visit and ensure other stakeholders are engaged as needed. We get to know more about each business, ask key questions, seek to understand issues, and record data for future analysis. We work to resolve any immediate issues and thank the business for their time and commitment to Denton. ▪10-15 Startups (1-4 employees) ▪10-15 Small Biz (5-10 employees) ▪10-15 Medium Biz (11-50 employees) ▪10 Large Biz (50+ employees) ▪Additional visits to focus on sectors significantly impacted by COVID-19 27 0 20000 Merchandising Selling Techniques Restaurant Operation Auditing Warehousing Accounting Nursing Customer Experience Agile Methodology Customer Satisfaction Denton County: Skills In-Demand National Average Denton County Workforce, Education & Training 20-21: Q1 Page 5 Denton Business Allies Current Representatives: TWU Center for Women Entrepreneurs UNT Denton ISD Denton Chamber of Commerce Denton Black Chamber of Commerce SBDC United Way of Denton County Workforce Solutions of North Central Texas Stoke Denton The Denton Business Allies are a group of stakeholders, representing business support organizations, that are working to assist businesses, entrepreneurs and our local workforce develop, grow, and thrive in Denton. The DBA can offer resources, training, support, and technical assistance to employers and employees. Need support for your business or seeking career training? Contact the DBA at (940) 349-7771 FY 2020-2021 Goals Identify negative impacts and challenges to local small/large businesses, employees, and job seekers due to COVID-19. Connect employees and employers with local, state, and federal resources. Work with local partners to promote training and education opportunities. Use digital resources to assist job seekers and employers connect. Check out our new Small Business Resource Page! Learn how to start and grow your small business, connect with support organizations, and find resources for disadvantaged, minority, woman, and veteran-owned businesses. It Takes…Everyone! Developing a workforce ready to meet the demands of a growing city can be difficult. The Denton Economic Development Team actively works to identify skill gaps, coordinate and promote training programs, connect job seekers to opportunities, and communicates with and supports educational institutions and workforce developers in connecting training to employer needs. In Q1, two new initiatives, Denton Business Allies and creation of a new small business resource webpage, helped us kick-off our efforts. Job postings help us track what employers need so we can align training and education opportunities. Source: Emsi28 0 50 100 150 200 250 Q2 Q3 Q4 Q1 Resolved Requests Key Activities 20-21: Q1 Page 6 Business Assistance 40Requests Boards & Committees Board YTD Items Presented City Council 6 EDPB 13 DEDC 0 TIRZ No. 1 4 TIRZ No. 2 0 Total 23 3 Community Presentations 6 Media Requests 2 Trainings Attended 1 Networking Event Downtown TIRZ Study Update The Downtown TIRZ study and recommendations will be presented to City Council at the Feb. 9, 2021 meeting. Strategic Plan Update The Strategic Plan is substantially complete. Staff will schedule a City Council presentation in early 2021 to complete the Strategic Plan. Staff have built out the implementation management system for tracking & reporting. Our new CRM system includes a ticketing module that helps us track, monitor, and resolve issues! We’re Moving! The Denton Economic Development Team is relocating to the Development Services Center. 401 N. Elm Denton, TX 76201 29 Strategic Plan Implementation 20-21: Q1 Page 7 Accelerate Recovery Foster Growth Strengthen Community Inclusion ▪Created internal dashboard and recovery indicators report for tracking key recovery metrics. ▪Drafted 2021 BRE program to include focus on sectors/businesses significantly impacted by COVID-19. ▪Expanded business data collection efforts to include COVID-19 impact data points. ▪Prepared for 2021 virtual business visits. ▪Conducted regular outreach with regional organizations to learn about and promote recovery efforts and opportunities. ▪Served as concierge to assist businesses in connecting with and participating in federal and state programs. ▪Participated in DCWSLT with United Way. ▪Updated training resource inventory. ▪Coordinated with representatives from underserved and minority communities to encourage inclusive recovery. ▪Developed new BRE plan with renewed focus on increasing touchpoints, business visitation and data collection and evaluation. ▪Implemented new CRM system to: ▪Improve tracking and evaluation of attraction, retention, and expansion functions. ▪Build a robust database of businesses, developers, and key stakeholders. ▪Improved quality of RFIs and tracking performance. ▪Celebrated successes of key wins and highlighting Denton as attractive to key industries. ▪Reviewed future development areas. ▪Connected with UNT regarding how to better promote and use logistics/supply chain program. ▪Connected with regional broker/developer communities and engaged in conversations about Denton’s future. ▪Convened Denton Business Allies and developed work groups to focus on key areas, including workforce. ▪Held regular meetings with Denton Black Chamber of Commerce. ▪Initiated development of a minority and women owned- business support plan, including working with key stakeholders. ▪Participated in City’s affordable housing study and engaged in discussion regarding connection between housing and workforce. ▪Connected with Denton ISD and NCTC regarding training programs to focus on growing local talent and meeting needs of employers. Looking Ahead The goals over the next quarter include: ▪Completing implementation management tracker. ▪Presenting Strategic Plan for City Council approval. ▪Presenting Strategic Plan at EDP Investors Reception. ▪Starting implementation of BRE plan. ▪Continuing to track COVID-19 recovery efforts. ▪Starting regular implementation meetings with stakeholders. Implementation Tracking The Economic Development Team has developed a robust implementation and tracking matrix, with tasks broken down by strategic growth area. Each task has been assigned a project manager. The project managers are working through each task to identify stakeholders, develop work plans, and create timelines and checkpoints. 30 Team Denton 20-21: Q1 Page 8 Jessica Rogers Director of Economic Development | City of Denton Office: (940) 349-7531 Email: Jessica.Rogers@cityofdenton.com Cory Lacy VP of Economic Development| Denton EDP Office: (940) 382-7151 Email: Cory@dentonedp.com Kay Brown-Patrick Business Development Administrator| City of Denton Office: (940) 349-7771 Email: Kay.Patrick@cityofdenton.com Erica Sullivan Economic Development Analyst| City of Denton Office: (940) 349-7776 Email: Erica.Sullivan@cityofdenton.com Dan Rosenfield Economic Development Analyst| City of Denton Office: (940) 349-7732 Email: Daniel.Rosenfield@cityofdenton.com Christina Davis Economic Development Specialist| City of Denton Office: (940) 349-7730 Email: Christina.Davis@cityofdenton.com Additional Contacts Christine Gossett Executive Director | Denton Main Street Association (940) 349-8529 or christine@dentonmainstreet.org Heather Gregory Executive Director | Stoke Denton (940) 349-268-5374 or Heather@stokedenton.com Denton Chamber of Commerce (940) 382-9693 Denton Black Chamber of Commerce info@dentonblackchamberonline.org North Texas SBDC (940) 498-6470 Workforce Solutions of North Central Texas (940) 382-6712 31 CITY-RELATED BILLS FILED (Editor’s Note: You will find all of this session’s city-related bill summaries online at https://www.tml.org/319/Legislative-Information.) PROPERTY TAX H.B. 299 (Vasut) – Appraisal Cap: would reduce the property tax appraisal cap on homesteads from ten to 3.5 percent, and apply the new appraisal cap to all real property. (See H.J.R. 64, below.) H.B. 984 (White) – Property Tax Appraisal: would: (1) for real property omitted from the tax roll in any one of the five preceding tax years, provide that the chief appraiser may, or shall if otherwise required by law, appraise the property as of January 1 of each tax year that it was omitted and enter the property and its appraised value in the appraisal records; and (2) provide that if the chief appraiser enters the property in the appraisal records under (1), above, the entry must show that the appraisal is for the property that was omitted from an appraisal roll in a prior year and must indicate the year and the appraised value for each year. (Companion bill is H.B. 494 by White.) H.B. 986 (Shine) – Appraisal Review Boards: would, among other things: (1) authorize the board of directors of an appraisal district established in a county with a population of less than 120,000 to elect to allow the local administrative district judge to appoint the members of the appraisal review board under certain circumstances; and (2) authorize the board of directors of an appraisal district established in a county with a population of 120,000 or more to appoint appraisal review board members if: (a) each member of the appraisal district board other than the county assessor-collector serves as a member of the governing body of a taxing unit that participates in the appraisal district on the date the members of the board are appointed; and (b) the appraisal district board by resolution elects to appoint the members of the board. H.B. 987 (Shine) – Property Tax Exemption: would provide that: (1) a person is entitled to a property tax exemption for tangible personal property the person owns that is held or used for the production of income if the property is listed in a single account maintained by the appraisal district and the total table value of all property listed in the account is less than $5,000; (2) a person is entitled to a property tax exemption of a portion of the value of the tangible personal property the person owns that is held or used for the production of income if the property is listed in a single account maintained by the appraisal district and the total value of all property in the account is $5,000 or more and less than $500,000; (3) the amount of the exemption in (2), above, is equal to 20 percent of the total taxable value of all property listed in the account; and (4) a person may receive more than one exemption under (1) and (2), above. (See H.J.R. 53, below.) H.B. 988 (Shine) – Property Tax Appraisal: would, among other things, authorize a property owner to bring suit to compel an appraisal district, chief appraiser, or appraisal review board to comply with a procedural requirement applicable to a property tax protest. H.B. 989 (Shine) – Property Tax Appraisal: would authorize a property owner to file a motion with the appraisal review board to change the appraisal roll to correct an error regarding the unequal appraisal or excessive market value of a property at any time prior to the date the taxes become delinquent. 32 H.B. 990 (Shine) – Delinquent Property Taxes: would repeal the penalty on delinquent property taxes for a residence homestead. H.B. 991 (Shine) – Property Tax Discounts: would, among other things: (1) provide that a person is entitled to a discount for the early payment of property taxes on the amount of tax due on real property that is the person’s residence homestead as follows: (a) if a taxing unit mails its property tax bills on or before September 30, the following discounts apply: (i) three percent if the tax is paid in October or earlier; (ii) two percent if the tax is paid in November; and (iii) one percent if the tax is paid in December; and (b) if a taxing unit mails its tax bills after September 30, the following discounts apply: (i) three percent if the tax is paid before or during the next full calendar month following the date on which the tax bills were mailed; (ii) two percent if the tax is paid during the second full calendar month following the date on which the tax bills were mailed; and (iii) one percent if the tax is paid during the third full calendar month following the date on which the tax bills were mailed; (2) authorize the governing body of a taxing unit to adopt discounts for the early payment of property taxes on properties other than residence homesteads; and (3) require a mortgage servicer who pays property tax on behalf of a borrower to, on the written request of the borrower, pay the property tax on a property occupied by the borrower as the borrower’s residence homestead early enough for the borrower to qualify for the three percent discount provided in (1), above, as applicable. H.B. 992 (Shine) – Property Tax Installment Payments: would authorize an individual to pay a taxing unit’s property taxes imposed on the individual’s residence homestead in four equal installments. H.B. 993 (Shine) – Property Tax Freeze: would establish a mandatory property tax freeze for city, county, and junior college district property taxes on the residence homesteads of individuals who are disabled or over 65 and their surviving spouses. (See H.J.R. 54, below.) H.B. 994 (Shine) – Property Tax Exemption: would: (1) provide that an individual is entitled to an exemption from property taxation by a taxing unit other than a school district of a portion of the appraised value of the individual’s residence homestead in an amount equal to five percent, or a greater percentage not to exceed 25 percent specified by the governing body of the taxing unit before July 1, of the average appraised value in the current tax year of all residence homesteads that are located in the same county as the individual’s homestead and that qualify for an exemption; and (2) require the chief appraiser to determine the average appraised value of the residence homesteads referenced in (1), above, according to the appraisal records as of August 1. (See H.J.R. 55, below.) H.B. 1022 (Murphy) – Property Tax Exemption: would exempt from property taxation the portion of real property owned by a person that is leased to an open-enrollment charter school if: (1) the portion of the real property that is leased to the school is: (a) used exclusively by the school for the operation or administration of the school or the performance of other educational functions; and (b) reasonably necessary for the operation of the school; and (2) the owner of the portion of real property that is leased to the school certifies by affidavit to the school that: (a) if the lease agreement requires the school to pay the taxes imposed on the real property as a portion of the total consideration paid to the property owner under the agreement, the owner will reduce the consideration required to be paid by the school under the lease agreement by an amount equal to the amount by which the taxes on the real property are reduced as a result of the exemption by providing a monthly or annual credit against the total consideration due under 33 the agreement; or (b) if the lease agreement requires the school to pay the taxes imposed on the real property directly to the collector for the applicable taxing unit or to the owner or the property manager separately from the payment of rent to the property owner under the agreement, the school is no longer required to pay the taxes to the collector, owner, or property manager, as applicable, and the rent charged to the school under the agreement is not affected unless a term of the agreement specifically provides for a change in the amount of the rent (See H.J.R. 57, below.) H.B. 1053 (C. Bell) – Appraisal Cap: would reduce the property tax appraisal cap on homesteads from ten to five percent, and apply the new appraisal cap to all real property. (See H.J.R. 61, below.) H.B. 1061 (Bucy) – Property Tax Freeze: would expand the existing law authorizing cities to adopt a property tax freeze on the residence homestead of individuals who are elderly or disabled and their surviving spouses to all taxing units other than school districts. (See H.J.R. 62, below.) H.J.R. 53 (Shine) – Property Tax Exemption: would amend the Texas Constitution to authorize the legislature to exempt from property taxes 20 percent of the taxable value of a person’s tangible personal property that is held or used for the production of income if the property is listed in a single account maintained by the appraisal district and the total taxable value of all property listed in the account is $5,000 or more and less than $500,000. (See H.B. 987, above). H.J.R. 54 (Shine) – Property Tax Freeze: would amend the Texas Constitution to establish a mandatory property tax freeze for city, county, and junior college district property taxes on the residence homesteads of individuals who are disabled or over 65 and their surviving spouses. (See H.B. 993, above.) H.J.R. 55 (Shine) – Property Tax Exemption: would amend the Texas constitution to authorize the legislature to provide that an individual is entitled to an exemption from property taxation by a taxing unit other than a school district of a portion of the appraised value of the individual’s residence homestead in an amount equal to five percent, or a greater percentage not to exceed 25 percent specified by the governing body of the taxing unit before July 1, of the average appraised value in the current tax year of all residence homesteads that are located in the same county as the individual’s homestead and that qualify for an exemption. (See H.B. 994, below.) H.J.R. 57 (Murphy) – Property Tax Exemption: would amend the Texas Constitution to authorize the legislature to exempt from property taxation any real property that is leased for use as an open-enrollment charter school. (See H.B. 1022, above.) H.J.R. 61 (C. Bell) – Appraisal Cap: would amend the Texas Constitution to reduce the property tax appraisal cap on homesteads from ten to five percent and apply the new appraisal cap to all real property. (See H.B. 1053, above.) H.J.R. 62 (Bucy) – Property Tax Freeze: would amend the Texas Constitution to authorize a political subdivision other than a school district to adopt a property tax freeze on the residence homestead of individuals who are elderly or disabled and their surviving spouses. (Note: Cities 34 already have this authority. H.J.R. 62 would expand the authority to additional political subdivisions that levy property taxes.) (See H.B. 1061, above.) H.J.R. 64 (Vasut) – Appraisal Cap: would amend the Texas Constitution to reduce the property tax appraisal cap on homesteads from ten to 3.5 percent and apply the new appraisal cap to all real property. (See H.B. 299, above.) S.B. 300 (Hinojosa) – Property Tax Exemption: would: (1) for purposes of the property tax exemption on the residence homestead of the surviving spouse of a first responder, expand the definition of “first responder” to include: (a) a special agent of United States Immigration and Customs Enforcement; (b) a customs and border protection officer or border patrol agents of United States Customs and Border Protection; and (c) an immigration enforcement agent or deportation officer of the United States Department of Homeland Security; and (2) in the case of the surviving spouse of a first responder described by (1), above, provide that the surviving spouse is entitled to an exemption if the surviving spouse has not remarried since the death of the first responder and was a resident of this state at the time of the first responder’s death. S.B. 329 (Paxton) – Property Tax Credit: would: (1) provide that a person who owns property that is reasonably necessary for and used by the person to operate a qualifying small business is entitled to a property tax credit from each taxing unit that taxes the property for the number of days the qualifying small business on the property was closed due to a qualifying official order during a disaster; (2) for purposes of the credit in (1), above, a “qualifying official order” is an order, proclamation, or other instrument issued by the governor, another official of the state, or the governing body or an official of a political subdivision of the state in response to a disaster; and (3) for purposes of the tax credit in (1), above, a “qualifying small business” means a business that: (a) has fewer than 100 employees: (b) is required to close by a qualifying official order; and (c) if not for the qualifying official order, would be capable of engaging in normal business activity during the period the business is required to be closed. (See S.J.R. 23, below.) S.J.R. 23 (Paxton) – Property Tax Exemption: would amend the Texas Constitution to authorize the legislature to provide a credit against the property taxes imposed on property necessary for and used to operate a business that is required to close by an order, proclamation, or other instrument issued by the governor, another official of the state, or the governing body or an official of a political subdivision of the state in response to a disaster. (See S.B. 329, above.) PUBLIC SAFETY H.B. 983 (Holland) – Alcohol To-Go: would allow for the pickup and delivery of alcoholic beverages for off-premises consumption under certain circumstances. H.B. 1024 (Geren) – Alcohol To-Go: would allow for the pickup and delivery of alcoholic beverages for off-premises consumption under certain circumstances. (Companion Bill is S.B. 298 by Hancock.) H.B. 1035 (Dutton) – Use of Force: would amend current law to provide that the standard for: (1) the justified use of force against a person by a peace officer, a person acting in a peace officer’s presence and at the officer’s direction or a person other than a peace officer is an 35 objectively reasonable standard; (2) the justified use of deadly force against a person by a peace officer or a person acting in a peace officer’s presence and at the officer’s direction is an objectively reasonable standard; and (3) the justified use of any force, including deadly force, by a guard employed by a correctional facility or a peace officer to prevent the escape of a person from a correctional facility is an objectively reasonable standard. H.B. 1039 (Goodwin) – Handgun License: would provide that: (1) a peace officer may seize a license holder’s suspended, revoked, or expired license and return it to the Department of Public Safety; and (2) if a handgun license holder is convicted of or charged with an offense or becomes the subject of a protective order and that conviction, charge, or order disqualifies the person from possessing a firearm or continuing to hold a license, an officer of the court shall accept voluntary surrender of the license or otherwise seize the license. H.B. 1050 (Romero) – Mental Health Response Study: would, among other things: (1) require that the Health and Human Services Commission conduct a study to evaluate the availability, outcomes, and efficacy of using mental health response teams and mental health professionals to assist in reducing the number of incarcerations of individuals with mental illnesses, substance abuse disorders, or intellectual or developmental disabilities; (2) provide that in conducting such study, the commission shall: (a) include an assessment of whether the information suggests that municipalities would benefit from mental health response teams assisting traditional law enforcement officers in efforts to: (i) reduce the incarceration rates of persons with mental illness, substance abuse disorder, and intellectual or developmental disorders; (ii) increase the number of referrals to community resources and treatment for persons described in (2)(a)(i), above; (iii) reduce the use of force when responding to emergency calls that involve persons described in (2)(a)(i), above; and (iv) gain an understanding about persons described by (2)(a)(i), above; (b) evaluate the fiscal and staffing implications to a law enforcement agency for agency use of a mental health response team to respond remotely to emergency calls; and (c) evaluate the impact of certain funding sources on establishing mental health response teams across the state, especially the impact to the establishment, staffing, and maintenance of those teams; and (3) require the commission to gather information from the study from each city with a population greater than 100,000. H.B. 1051 (Geren) – Court Program: would expand the definition of a public safety employee, for the purpose of participating in a public safety employee treatment court program, to include an emergency service dispatcher. H.B. 1069 (Harris) – First Responders Carrying Handguns: would: (1) require the public safety director of the Department of Public Safety to establish a handgun training course for first responders who hold a license to carry a handgun; (2) prohibit a governmental entity from adopting a rule or regulation that prohibits a first responder who holds a license to carry a handgun and has completed the course described in (1) from: (a) carrying a concealed or holstered handgun while on duty; or (b) storing a handgun on the premises of or in a vehicle owned or operated by the governmental entity if the gun is properly secured; (3) provide that a first responder may discharge a handgun while on duty only in self-defense; (4) provide that a governmental entity that employs or supervises a first responder is not liable in civil action arising from the discharge of a handgun by a first responder who is licensed to carry a handgun; (5) provide that the discharge of a handgun by a first responder who is licensed to carry a handgun is outside the course and scope of the first responder’s duties; and (6) provide that the new law authorizing the discharge of a firearm by a first responder may not be construed to 36 waive, under any law, immunity from suit or liability of a governmental entity that employs or supervises first responders. S.B. 298 (Hancock) – Alcohol To-Go: would allow for the pickup and delivery of alcoholic beverages for off-premises consumption under certain circumstances. (Companion Bill is H.B. 1024 by Geren.) S.B. 301 (Hinojosa) – Covert Law Enforcement Activity: would provide that a defendant may not be convicted for an offense under the Texas Controlled Substances Act on the testimony of a person who is acting covertly on behalf of a law enforcement agency, regardless of whether that person is a licensed peace officer or special investigator, unless the testimony is corroborated by other evidence. (Companion bill is H.B. 834 by Thompson). S.B. 311 (Eckhardt) – Public Demonstrations: would provide that: (1) a person commits the offense of disorderly conduct if the person intentionally or knowingly displays a firearm while attending or within 500 feet of a public demonstration; and (2) it is a defense to prosecution for an offense described in (1) if the person displays the firearm in discharging the person’s official duties as a peace officer, a member of the armed forces, or a security officer. (Companion bill is H.B. 791 by Goodwin.) SALES TAX S.B. 313 (Huffman) – Sales Tax Exemption: would exempt firearm safety equipment from sales taxes. (Companion bill is H.B. 524 by Rosenthal.) COMMUNITY AND ECONOMIC DEVELOPMENT H.B. 1048 (Anchia) – City Parks Funding: would authorize local hotel occupancy taxes and short-term motor vehicle rental tax associated with a venue project to be used to finance a venue project expenditure relating to a city parks and recreation system. S.B. 291 (Schwertner) – Commercial Construction: would require a developer, as soon as practicable after beginning construction of a commercial building project, to visibly post the following information at the entrance to the construction site: (1) the name and contact information of the developer; and (2) a brief description of the project. ELECTIONS H.B. 1056 (Fierro) – Temporary Branch Polling Places: would provide that early voting by personal appearance at certain temporary branch polling places may be conducted on any one or more days and during any hours of the period for early voting by personal appearance, as determined by the authority establishing the branch. S.B. 303 (Eckhardt) – Early Voting by Mail: would, among many other things, authorize early voting by mail for any qualified voter and provide for implementing procedures. EMERGENCY MANAGEMENT S.B. 328 (Lucio) - Disaster Identification System: would, among other things, provide that: (1) the Texas Division of Emergency Management may include in its state emergency plan 37 provisions for the use of a disaster identification system; (2) in an area subject to a state of disaster declaration, a person may elect to participate in a disaster identification system activated for that area; (3) such system shall authorize the use of a device that is capable of displaying a flashing light and continuous light in either the color white or the colors blue, green, red, and yellow (an “illuminated display”) to communicate with disaster relief personnel; and (4) an executive order or proclamation declaring a state of disaster activates for the area subject to the declaration the disaster identification system described above. (Companion bill is H.B. 671 by Martinez.) MUNICIPAL COURTS H.B. 1071 (Harris) –Animals in Court: would allow a qualified facility dog or qualified therapy animal in certain court proceedings. OPEN GOVERNMENT No Open Government bills were filed this week. OTHER FINANCE AND ADMINISTRATION H.B. 173 (Rosenthal) – False Report Liability: would provide that: (1) a person who submits a false report to a law enforcement agency or emergency service provider, with the intent that the law enforcement agency or emergency service provider take action against a falsely accused person, is liable to the falsely accused person for an amount not to exceed $250 if the report was submitted due to bias or prejudice against the falsely accused person’s race, color, disability, religion, national origin or ancestry, age, gender, sexual orientation or gender identity; and (2) a falsely accused person who prevails in an action described in (1), above, may recover attorney’s fees and costs incurred in bringing the action. H.B. 997 (Fierro) – Motor Vehicle Inspection: would increase the identification number inspection fee for a motor vehicle from $40 to $65. H.B. 1004 (Gates) – Municipal Management Districts: would provide for the election of directors of a municipal management district created by the Texas Commission on Environmental Quality. H.B. 1030 (Shaheen) – Newspaper Notice: would: (1) allow a political subdivision to satisfy any law that requires notice to be published in a newspaper by publishing the notice in the following locations: (a) social media, free newspapers, school newspapers, a homeowners’ association newsletter or magazine, utility bills, direct mailings, or any other form of media authorized by the comptroller; and (b) the internet websites maintained by the political subdivision and the comptroller; (2) provide that before providing notice under (1), a political subdivision must hold a public meeting about the alternative notice under (1)(a) and demonstrate that the circulation will be greater than the circulation of the newspaper with the greatest circulation in the political subdivision; (3) authorize the comptroller to grant a city’s request for a waiver from (1)(b) if the city provides sufficient proof that Internet access is limited in the city, and if the comptroller grants the waiver, the city must provide additional notice on a public agenda board within the city; (4) require a city using alternative media described in (1)(a) to submit notice to the comptroller describing the alternative notice method in (1)(a) and certain other information; (5) authorize the comptroller to require a political subdivision to provide notice in a newspaper if the comptroller determines that the means under (1)(a) do not have greater 38 circulation than a newspaper with the greatest circulation in the political subdivision; and (6) require the comptroller to prepare a report identifying and comparing the effectiveness of different methods of notice publication used by political subdivisions and provide the report to the governor, lieutenant governor, and the speaker of the house. H.B. 1034 (Goodwin) – County Fire Code and Building Permits: would: (1) authorize any county to adopt a fire code and/or a wildland-urban interface code, and allow a county and a city in the county to contract with one another for the administration and enforcement of the codes; and (2) provide that a code adopted in (1) applies only to an unincorporated area of the county. S.B. 315 (Huffman) – Sexually Oriented Businesses: would, among other things: (1) provide that an individual younger than 18 years of age may not be on the premises covered by permit or license issued by the Texas Alcoholic Beverage Commission if a sexually oriented business operates on the premise; (2) provide that the holder of a license or permit covering a premises described in (1), above, may not knowingly or recklessly allow an individual younger than 18 years to be on the premises; (3) provide that if a permit or license holder is found to violate (1), above, the commission shall suspend the permit or license for the first and second violation, and cancel the permit or license for the third violation; (4) prohibit a sexually oriented business from allowing an individual younger than 18 years of age to enter the premises of the business; (5) provide that a sexually oriented business commits an offense if it violates (4), above; (6) amend current law to provide that it is a common nuisance to: (i) employ or enter into a contract for the performance of work or the provision of services with an individual younger than 21 years of age for work or services performed at a sexually oriented business; or (ii) permit an individual younger than 18 years of age to enter the premises of a sexually oriented business; (7) amend current law to provide that a sexually oriented business may not hire or enter into a contract with an individual younger than 21 years of age for the performance of work or the provision of services other than a contract to perform repairs, maintenance or construction services at the business; and (8) amend current law to provide that a child is a person younger than 21 years of age for purposes of the criminal offense of employing, authorizing, or inducing a child to work in a sexually oriented commercial activity or in any place of business permitting, requesting or requiring a child to work nude or topless. S.J.R. 22 (Huffman) - Local Retirement Systems: would amend the Texas Constitution to provide that the state is not liable and may not appropriate money to pay for any debts or other obligations of a local retirement system. PERSONNEL No Personnel bills were filed this week. PURCHASING No Purchasing bills were filed this week. TRANSPORTATION H.B. 1054 (Bell) –High Speed Rail: would, before a private entity begins operation of high- speed rail, require the entity to file with the Texas Department of Transportation a bond to be sufficient to restore real property used for the service to its original condition if the service ceases operation. 39 UTILITIES AND ENVIRONMENT H.B. 1021 (Murphy) – Electric Utility Rates: would: (1) define “employee compensation and benefits” to include base salaries, wages, incentive compensation, and benefits, but not pension, other postemployment benefits, or incentive compensation; and (2) provide that, when establishing an electric utility’s rates, the regulatory authority (including a city) shall presume that employee compensation and benefits expenses are reasonable and necessary, if the expenses are consistent with recent market compensation studies not earlier than three years before the initiation of the proceedings to establish the rates. H.B. 1043 (Anchia) – Safety and Pollution Penalty: would amend current law to increase the administrative penalty that may be assessed by the Railroad Commission to an amount that does not exceed $25,000 a day for each non-pipeline safety violation of a provision of: (1) state law that pertains to the safety or the prevention or control of pollution; or (b) a rule, order, license, permit, or certificate that pertains to safety or prevention or control of pollution issued by the commission. S.B. 304 (Eckhardt) – Zero-Carbon Electric Generation: would: (1) define “zero-carbon energy technology” as a technology that relies exclusively on an energy source that does not emit a greenhouse gas in the production of electricity; (2) provide that it is the intent of the legislature that the amount of electric power generated in Texas from zero-carbon energy technology for delivery by a retail electric provider, municipally owned utility, or electric cooperative each year will increase to meet the following percentages on or before the specified dates: (a) by January 1, 2025, not less than 65 percent of the annual total; (b) by January 1, 2030, not less than 85 percent of the annual total; and (c) by January 1, 2035, 100 percent of the annual total; (3) require the Public Utility Commission (PUC) to promulgate rules that: (a) establish the minimum annual zero-carbon energy technology generation requirement for each retail electric provider, municipally owned utility, and electric cooperative operating in this state in a manner designed to produce, on a statewide basis, compliance with the requirement prescribed by (2), above; and (b) specify reasonable standards that zero-carbon energy generation must meet to count toward compliance with the requirement in (2), above; (c) establish a zero-carbon energy generation credits trading program; (d) establish a means for a retail electric provider, municipally owned utility, or electric cooperative to satisfy the requirements of (2), above, by generating electricity using biomass fuel instead of directly owning or purchasing energy generated using zero-carbon energy technologies; and (e) establish a carbon offset alternative payment program; and (4) provide that the PUC may cap the price of zero-carbon energy credits and may suspend the goal established by (2), above, as necessary to protect the reliability and operation of the grid. S.B. 307 (Eckhardt) – Transmission of Water for Wholesale Service: would provide that a person may transmit potable water by pipeline of more than 24 inches in diameter across two or more county lines for the purpose of providing wholesale water service only if the person is a local government corporation created to aid and act on behalf of the counties through which the pipeline travels. 40 Page 1 of 6 12/5/2019 CITY OF DENTON POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE SECTION: GENERAL POLICIES/PROCEDURES/DIRECTIVES REFERENCE NUMBER: 500.07 SUBJECT: USE OF CITY FACILITIES FOR INCLEMENT WEATHER INITIAL EFFECTIVE DATE: TITLE: USE OF CITY FACILITIES FOR INCLEMENT WEATHER LAST REVISION DATE: POLICY STATEMENT Certain City of Denton (City) facilities are made available for public use when measures of extreme temperatures are reached or when other severe weather conditions take place. The purpose of this policy is to outline the circumstances under which certain City facilities will be made available and general guidelines. Furthermore, it is the intent of this policy to outline restrictions and priorities at each of the facilities listed herein based on the individual facility’s purpose. DEFINITIONS Inclement Weather – Inclement Weather can generally be defined as abnormal weather conditions with extreme temperatures or extreme weather conditions. For the purposes of this policy, Inclement Weather will be defined as any day when one or more of the following conditions is met: 1) the temperature low is expected to fall below 32 degrees, 2) when the temperature high is expected to exceed 100 degrees, or 3) the City has declared an emergency for weather conditions such as snow/ice, hail, severe flooding, etc. Inclement Weather Stations - Various City facilities are designated as inclement weather stations and are heated and/or air-conditioned with public access to restrooms, water fountains, and sitting area. The City facilities designated for inclement weather stations are guided by the conditions set forth in the sections of this policy and include: • American Legion Hall (629 Lakey St.) • Denton Civic Center (321 E. McKinney St.) • Denton Senior Center (509 N. Bell Ave.) • Denia Recreation Center (1001 Parvin St.) • MLK Jr. Recreation Center (1300 Wilson St.) • North Lakes Recreation Center (2001 W. Windsor Dr.) • Emily Fowler Central Library (502 Oakland St.) • North Branch Library (3020 N. Locust St.) • South Branch Library (3228 Teasley Ln.) • Central Fire Station (332 E. Hickory St.) • Fire Station #2 (110 Mockingbird Ln.) • Fire Station #4 (2110 E. Sherman Dr.) 41 Page 2 of 6 POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE (Continued) TITLE: USE OF CITY FACILITIES AND MEETING ROOMS REFERENCE NUMBER: 500.07 07/16/19 • Fire Station #5 (2230 W. Windsor Dr.) • Fire Station #6 (3232 Teasley Ln.) • Fire Station #7 (4201 Vintage Pkwy.) Non-profit – An organization with a 501(c)(3) tax status specifically formed for purposes other than operating a profit-seeking business. GUIDELINES 1. General Guidelines for Inclement Weather Stations: 1.1. Designation of Inclement Weather 1. When weather conditions fall within the Inclement Weather definition, designated City facilities can be opened as warming/cooling stations. The designated City facilities are heated and/or air-conditioned with public access to restrooms, water fountains, and sitting areas during normal operations. 1.2. Public Outreach and Notification 1. When the conditions for Inclement Weather are met, City staff will communicate to residents, public, and social service agencies that the designated facilities are available as Inclement Weather Stations through its various communications channels such as website, social media, or media alerts. 2. City staff will create posters and flyers to help inform the community of services available during inclement weather. 3. City staff will help to communicate other non-City facilities and services available for those in need during inclement weather, such as emergency overnight shelter available from non-profit agencies, transportation, or other non-City facilities that are open for public use during inclement weather. 4. City staff will help to communicate ways in which interested community members can volunteer or donate to non-profits that provide facilities and services during inclement weather. 1.3. General Rules of Conduct 1. All persons utilizing City facilities during inclement weather must follow specific facility/program posted policies and procedures. 2. In addition to specific facility/program posted policies and procedures, any person in a City facility should adhere to the following rules or the person may be asked to leave the premises: a. Commits or attempts to commit any activity that would constitute a violation of any federal, state, or local criminal statute or ordinance. b. Is under the influence of any controlled substance or intoxicating liquor. c. Possesses, sells, distributes or consumes any alcoholic beverage, except as allowed at an approved event where the person is legally authorized to sell, distribute, or consume alcoholic beverages. 42 Page 3 of 6 POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE (Continued) TITLE: USE OF CITY FACILITIES AND MEETING ROOMS REFERENCE NUMBER: 500.07 07/16/19 d. Engages in conduct that disrupts or interferes with the normal operation of the facility/program or that disturbs City staff or individuals. Such conduct includes, but is not limited to, disregard of staff directives, abusive or threatening language or gestures, unreasonably loud or boisterous physical behavior or noise. e. Intentionally destroys, damages, or defaces any City or other individual’s property. f. Brings in articles that create a hazard for other individuals by their size, condition or substance. g. Interferes with the free passage of City staff or other individuals into or out of any part of the facility. h. Brings animals inside of the facility other than those assisting persons with disabilities. i. Fails to wear shoes or shirts at all times inside of the facility. 2. Parks Facilities 2.1. Overview: Park and Recreational buildings and facilities are designated locations for emergency sheltering and inclement weather stations. The activation and use of park buildings and facilities for this purpose will follow the implemented policies and guidelines established for each. 2.2. Priorities and Conflicts: Park staff is responsible for providing a safe, clean, and comfortable environment for all park users. To that end, staff will evaluate activities and programs in progress for conflicts with the activation of an emergency shelter and inclement weather use. 1. Conflicts can include, but are not limited to, incompatible use with special events or separation between minors in recreational care with adult users. It may be necessary to designate a staging area for emergency shelter and inclement weather users that does not interfere with or pose a safety issue to ongoing programs or activities. Temporary relocation of shelter and inclement weather activities will also be considered until conflicts are resolved and a safe environment can be established for all users. 2. Additionally, staff will review any scheduled programs, events, or activities that may conflict with the activation of a shelter or inclement weather use. Program and event organizers and/or renters will be notified as soon as possible of any potential conflicts in use. Similar actions will be evaluated such as establishing designated areas or temporary relocation to resolve any potential issues. 2.3. Rules of Conduct: All park users are subject to the Rules of Conduct for park buildings, facilities, and open spaces. 2.4. Inclement Weather Station Locations and Hours: The following Parks Facilities are designated as warming and cooling stations and will be made available to the public during regular operating hours during Inclement Weather: • Denton Civic Center (321 E. McKinney St.) • Denia Recreation Center (1001 Parvin St.) • MLK Jr. Recreation Center (1300 Wilson St.) 43 Page 4 of 6 POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE (Continued) TITLE: USE OF CITY FACILITIES AND MEETING ROOMS REFERENCE NUMBER: 500.07 07/16/19 • North Lakes Recreation Center (2001 W. Windsor Dr.) The following Parks Facilities are designated as warming and cooling stations and will be made available to individuals age 50 and above in accordance with the facility’s use and membership requirement. • American Legion Hall (629 Lakey St.) • Denton Senior Center (509 N. Bell) 2.5. Emergency Shelter and Mass Care Under the City’s Emergency Management Plan: Emergencies are unforeseen circumstances that call for immediate action to save lives and to protect property and public health and safety. Emergency shelters will be set-up and operated in accordance with Annex C Shelter and Mass Care of the City’s Emergency Management Plan. 2.6. Other Requests: Inclement weather may also result in a need for the use of indoor facilities after operational hours. The use of Parks and Recreation Department (PARD) facilities for overnight sheltering is only permitted under conditions set by Annex C Shelter and Mass Care of the City’s Emergency Management Plan. Other requests for use of PARD facilities related to inclement weather are subject to the following: 1. Per this policy, all after-hour use of PARD facilities are subject to rental fees and requirements. 2. Requester must a local certified non-profit organization offering or delivering a service that is a recognized need or adopted program by the City. 3. A minimum of 48-hour notice is required to request the use of a PARD facility after hours due to inclement weather. In most cases, weather forecasting will provide advanced warning of impending weather conditions. Unforeseen weather conditions will be reviewed on a case-by-case basis. 4. In cases of unforeseen weather conditions, the City Manager or his/her designee can authorize the use of a PARD facility. 5. Availability for inclement weather-related use will be considered under the following conditions: a. Temperatures, actual or wind chill, fall below 32 degrees. b. Daytime heat index expected to meet or exceed 105 degrees or daytime air temperature exceeds 103 degrees (National Weather Service Heat Advisory) c. Storm conditions that include hail d. Any amount of freezing rain, or when 2 to 4 inches of snow (alone or in combination with sleet and freezing rain) is present (National Weather Service Winter Weather Advisory) 6. A review of programs, activities, and special events will be performed by PARD staff to identify and evaluate potential conflicts of the requested use with on-going and/or scheduled events. Staff will provide direction and recommendations with the primary goal of ensuring a safe environment for all users. 7. City Policy 500.06 Use of City Facilities and Meeting Rooms Section 6.2 Priority will be used as a guide in recommending and providing accommodations. a. Parks Department programs and staff; 44 Page 5 of 6 POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE (Continued) TITLE: USE OF CITY FACILITIES AND MEETING ROOMS REFERENCE NUMBER: 500.07 07/16/19 b. Community building rentals; c. City sponsored or co-sponsored activities; d. City Boards and Commission meetings; e. Meetings of City staff; f. Uses requested by agencies or officials of local, county, state, or federal governments; g. Not-for-profit and civic organizations; and h. Other users with valid reservations. 8. Security and minimum staffing will be required. The level of security and staffing will be determined by the nature of the event and/or activity. 9. All proposed activities are subject to applicable policies and legal requirements such as but not limited to insurance and permits. 10. Request for fee reimbursement related to the use of PARD facilities under this policy will be reviewed and approved by City Council. Approval will be based on an approved budget and administrative guidelines. PARD staff will initiate the refund process within 7 business days of approval. 11. City Council will receive notification of all uses under this policy. Staff will provide Council with a quarterly report on the requests and budget status related to usage under this policy. 3. Library Facilities 3.1. Overview: Denton Public Library facilities are designated locations for inclement weather stations. 3.2. Priorities and Conflicts: Library staff is responsible for providing a safe, clean, and comfortable environment for all library users. To that end, staff will evaluate activities and programs in progress for conflicts with the activation of inclement weather use. 1. Conflicts can include, but are not limited to, incompatible use with special events or separation between minors in library programs with adult users. It may be necessary to designate a staging area for inclement weather users that does not interfere with or pose a safety issue to ongoing programs or activities. Temporary relocation of inclement weather activities will also be considered until conflicts are resolved and a safe environment can be established for all users. 2. Additionally, staff will review any scheduled programs, events, or activities that may conflict with the activation of inclement weather use. Program and event organizers will be notified as soon as possible of any potential conflicts in use. Similar actions will be evaluated such as establishing designated areas or temporary relocation to resolve any potential issues. 3.3. Rules of Conduct: All library users are subject to the Rules of Conduct for library facilities. 3.4. Inclement Weather Station Locations and Hours: The following Library facilities are designated inclement weather stations and will be made available to the public during normal operating hours. • Emily Fowler Central Library (502 Oakland St.), normal operating hours 45 Page 6 of 6 POLICY/ADMINISTRATIVE PROCEDURE/ADMINISTRATIVE DIRECTIVE (Continued) TITLE: USE OF CITY FACILITIES AND MEETING ROOMS REFERENCE NUMBER: 500.07 07/16/19 • North Branch Library (3020 N. Locust St.), normal operating hours • South Branch Library (3228 Teasley Ln.), normal operating hours 4. Fire Stations 4.1. Overview: The public access areas of Fire Station facilities are designated locations for inclement weather stations. 4.2. Priorities and Conflicts: The Fire Department is responsible for providing a safe, clean environment for Fire personnel at each station. In the event that the activation of a Fire Department facility for inclement weather use conflicts with the normal operation of the Fire Department, it may be necessary to relocate the inclement weather activities until conflicts are resolved and a safe environment can be established for all. For example, some Fire stations have limited public access space available and if necessary, individuals may need to be relocated if the space is full, if there are conflicts, or violations of rules of conduct. 4.3. Rules of Conduct: All visitors are subject to the Rules of Conduct for Fire Station visitors. 4.4. Inclement Weather Station Locations and Hours: The following Fire Station facilities are designated inclement weather stations and will be made available to the public in the designated days and times set forth below in only the public access area of each facility. • Central Fire Station (332 E. Hickory St.), Monday-Friday, 8 a.m. to 5 p.m. • Fire Station #2 (110 Mockingbird Ln.), Monday-Sunday, 8 a.m. to 9 p.m. • Fire Station #4 (2110 E. Sherman Dr.), Monday-Sunday, 8 a.m. to 9 p.m. • Fire Station #5 (2230 W. Windsor Dr.), Monday-Sunday, 8 a.m. to 9 p.m. • Fire Station #6 (3232 Teasley Ln.), Monday-Sunday, 8 a.m. to 9 p.m. • Fire Station #7 (4201 Vintage Pkwy.), Monday-Sunday, 8 a.m. to 9 p.m. 46 Temporary Inclement Weather Plan www.cityofdenton.com Inclement weather is when the temperature is expected to fall below 32 degrees or above 100 degrees fahrenheit, or when the City declares an emergency for weather conditions such as ice, severe flooding, etc. This list will continue to be updated based on facility openings. Extreme Weather Centers Fire stations will allow the public to access restrooms, sinks, handwashing stations, and water. There are no sitting areas. Masks are required. Station 2 | 110 Mockingbird Ln. | Monday-Sunday, 8 a.m.-9 p.m. Station 4 | 2110 E. Sherman Dr. | Monday-Sunday, 8 a.m.-9 p.m. Station 5 | 2230 W. Windsor Dr. | Monday-Sunday, 8 a.m.-9 p.m. Station 6 | 3232 Teasley Ln. | Monday-Sunday, 8 a.m.-9 p.m. Station 7 | 4201 Vintage Pkwy. | Monday-Sunday, 8 a.m.-9 p.m. City Fire Stations MLK Jr. Rec Center will open with extended hours during inclement weather with access to a sitting area, water, and restrooms. Masks are required for everyone who enters the building. Disposable masks and hand sanitizer are available at the door. The Civic Center, 321 E. McKinney St., will open for overflow seating as needed. MLK Jr. Rec Center | 1300 Wilson St. | (940) 349-8575 Monday-Friday, 8 a.m.-7 p.m. | Saturday-Sunday, 8 a.m.-5 p.m. City Parks and Rec Facilities Community Providers The Junction of Denton County Our Daily Bread 300 W. Oak St. Ste. 100 | (940) 566-1308 Monday-Friday | 9 a.m.‐1:30 p.m. Saturday | 9 a.m.-12:45 p.m. Bad Weather, Monday-Saturday |8 a.m.-4 p.m. Salvation Army Denton 1508 E. McKinney St. | (940) 566-3800 Dinner served at 6:30 p.m. Overnight stays from 5 p.m.-7 a.m. The Junction of Denton County - Monsignor King Outreach Center Monday-Friday | 6:30 p.m.-9 a.m. | (940) 268-2968 Bad Weather, Monday-Sunday | 5:30 p.m.-9 a.m. V. 3 | Dec. 3 47 Date: January 15, 2021 Report No. 2021-004 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: Gibbons Creek Steam Generation Station – Asset Purchase Agreement . Follow up to City Council Work Session BACKGROUND: On January 26, 2021, City Council will consider a Concurrent Ordinance to approve the proposed Asset Purchase Agreement (APA) authorizing the sale of the Gibbons Creek Steam Generating Station (Gibbons Creek) by the Texas Municipal Power Agency (TMPA) to the Gibbons Cr eek Environmental Redevelopment Group (GCERG), a Texas LLC that is a wholly owned subsidiary of Chara h Solutions, Inc. (https://charah.com/). A work session conducted by the City Council on on January 5, 2021 was held to provide background and details on the proposed transaction and to answer questions from the City Council. During the work session Council members requested specific information regarding anticipated land use by the Buyer. DISCUSSION: New Information – On January 11, 2021 the City Councils of Garland, Bryan and Greenville approved the Concurrent Ordinance that will be consider on January 26, 2021. Execution of the APA now awaits action by the Denton City Council. Question 1: Will the Buyer provide any details on planned land use of the redeveloped property? Response: TMPA staff contact the Buyer and requested the information. Charah’s response is shown below: Gibbons Creek Environmental Redevelopment Group (GCERG) plans on redeveloping the approximately 6,200 acres in an environmentally conscious manner that will expand economic activity and benefit the surrounding communities through job creation, promotion of industry, support of the tax base including the Grimes Country Schools, as well as restoring the property to a state that will enable it to be put to its best potential use. GCERG has been working with TMPA for many months on this purchase and has investigated many possibilities for the property’s future to maximize the value of the assets and improve the environment as well as contribute to the surrounding communities and the local economy. While these possibilities are still in negotiations and cannot be discussed in detail, we can assure you that the outcome to the communities will be very positive. The existing power plant will be demolished, and potential redevelopment uses for the property include; solar, battery, and energy storage options which utilize the existing transmission system, maximization of the reservoir’s potential, reuse of the vast rail system, and other industrial uses. It is planned that the Gibbons Creek Reservoir RV Park and campground will continue to operate. GCERG will also work with TCEQ to complete all environmental remediation required for the property and then will redevelop the remediated property within all zoning restrictions. By matching the right potential buyers to the right 48 Date: January 15, 2021 Report No. 2021-004 assets, GCERG plans to achieve the greatest possible outcome for the property and the surrounding communities. The redevelopment of the property is expected to be completed within 36 months. Question 2: What land use restrictions are in place for the site in Grimes County? Answer: While some counties have been delegated zoning authority by the legislature, Grimes County is not one of them. Grimes County, together with all other counties, has authority to regulate land use around certain lakes constructed after a certain date, but Gibbons Creek Reservoir was constructed prior to such date. Grimes County does have, as authorized by law, a standard subdivision regulation. If, in the future, Charah decides to subdivide the plant site into tracts of 5 acres in area or smaller for resid ential development, Charah will have to comply with the subdivision regulations, but they are not land use regulations in the same sense as a zoning regulations. In sum, it appears that Charah may put the plant site to any lawful land use. Whether land is put to residential, commercial, or industrial use is beyond the scope of Grimes County regulations. STAFF CONTACT: Terry Naulty Asst. General Manager DME and Interim Director of Water/Wastewater Terry.naulty@cityofdenton.com (940) 349-7565 49 Date: January 15, 2021 Report No. 2021-005 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: S&P Global Ratings for Utility System Revenue Extendable Commercial Paper Notes. BACKGROUND: The purpose of this report is to inform the City Council of S&P’s rating for the newly adopted utility system revenue extendable commercial paper program. On December 18, 2020, staff participated in a rating conference call with S&P regarding the City’s extendable commercial paper program. DISCUSSION: On January 12, 2021, the City received the rating of A-1+ from S&P on our utility system revenue extendable commercial paper (UECP) rating. The rating of A-1+ is the highest rating offered by this agency on short-term issuer credit ratings. The UECP rating is based on the long-term creditworthiness of the city’s combined utility system, based on S&P’s “Methodology For Linking Long-Term Ratings” (April 2017). S&P also affirmed the long-term ‘AA-‘ rating on the system’s revenue secured debt. The outlook on the long-term rating is stable. The rating also reflects S&P’s opinion of the combined utilities very strong enterprise risk profile, including its: Very strong operational management assessment, as evidence by the electric system’s recent transition to more renewable power supply and annual updates to its multiyear capital planning and financial forecasts; Adequate market position. The electric system’s average rate revenue remains greater than the state average, although we positively view the presence of an energy cost adjustment (ECA) that management reviews quarterly; and Very strong economic fundamentals, reflected by the combined utility’s residential customer base, lack of customer concentration, and Denton’s participation in the broad and deep Dallas- Fort Worth metropolitan statistical area. The rating also reflects the combined utility’s very strong financial risk profile including: Fixed-cost coverage (FCC) that averaged a very strong 1.5x annually over fiscal years 2017- 2019; and Extremely strong liquidity and reserves. For your review, staff has attached the Credit Opinion report from S&P. Only one rating was needed for the extendable commercial paper program, therefore, no other short-term ratings reports are expected. ATTACHMENT: S&P Credit Opinion Report S&P Ratings Chart 50 Date: January 15, 2021 Report No. 2021-005 STAFF CONTACT: Cassey Ogden, Director of Finance (940)-349-7195 Cassandra.Ogden@cityofdenton.com 51 11511 Luna Road Suite 500 Farmers Branch, TX 75234 tel (214) 871-1400 reference no.: 1647179 January 12, 2021 City of Denton 215 E. McKinney Denton, TX 76201 Attention: Mr. David Gaines, Assistant City Manager/CFO Re:US$100,000,000 Denton, Texas, Utility System Revenue Extendable Commercial Paper Notes Program, Series A, dated: Date of delivery, due: January 12, 2031 Dear Mr. Gaines: Pursuant to your request for an S&P Global Ratings rating on the above-referenced obligations, S&P Global Ratings has assigned a rating of "A-1+" . S&P Global Ratings views the outlook for this rating as not meaningful. A copy of the rationale supporting the rating is enclosed. This letter constitutes S&P Global Ratings' permission for you to disseminate the above-assigned ratings to interested parties in accordance with applicable laws and regulations. However, permission for such dissemination (other than to professional advisors bound by appropriate confidentiality arrangements or to allow the Issuer to comply with its regulatory obligations) will become effective only after we have released the ratings on standardandpoors.com. Any dissemination on any Website by you or your agents shall include the full analysis for the rating, including any updates, where applicable. Any such dissemination shall not be done in a manner that would serve as a substitute for any products and services containing S&P Global Ratings' intellectual property for which a fee is charged. To maintain the rating, S&P Global Ratings must receive all relevant financial and other information, including notice of material changes to financial and other information provided to us and in relevant documents, as soon as such information is available. Relevant financial and other information includes, but is not limited to, information about direct bank loans and debt and debt-like instruments issued to, or entered into with, financial institutions, insurance companies and/or other entities, whether or not disclosure of such information would be required under S.E.C. Rule 15c2-12. You understand that S&P Global Ratings relies on you and your agents and advisors for the accuracy, timeliness and completeness of the information submitted in connection with the rating and the continued flow of material information as part of the surveillance process. Please send all information via electronic delivery to:pubfin_statelocalgovt@spglobal.com. If SEC rule 17g-5 is applicable, you may post such information on the appropriate website. For any information not available in electronic format or posted on the applicable website, Please send hard copies to: S&P Global Ratings Public Finance Department 55 Water Street New York, NY 10041-0003 The rating is subject to the Terms and Conditions, if any, attached to the Engagement Letter applicable to the rating. In the absence of such Engagement Letter and Terms and Conditions, the rating is subject to the attached Terms and Conditions. The applicable Terms and Conditions are incorporated herein by reference. S&P Global Ratings is pleased to have the opportunity to provide its rating opinion. For more information please visit our website at www.standardandpoors.com.If you have any questions, please contact us. Thank you for choosing S&P Global Ratings. Sincerely yours, S&P Global Ratings a division of Standard & Poor's Financial Services LLC bc PF Ratings U.S. (4/28/16)Page | 1 52 enclosures cc:Mr. Adam LanCarte Ms. Laura B. Alexander PF Ratings U.S. (4/28/16)Page | 2 53 S&P Global Ratings Terms and Conditions Applicable To Public Finance Credit Ratings General.The credit ratings and other views of S&P Global Ratings are statements of opinion and not statements of fact. Credit ratings and other views of S&P Global Ratings are not recommendations to purchase, hold, or sell any securities and do not comment on market price, marketability, investor preference or suitability of any security. While S&P Global Ratings bases its credit ratings and other views on information provided by issuers and their agents and advisors, and other information from sources it believes to be reliable, S&P Global Ratings does not perform an audit, and undertakes no duty of due diligence or independent verification, of any information it receives. Such information and S&P Global Ratings' opinions should not be relied upon in making any investment decision. S&P Global Ratings does not act as a "fiduciary" or an investment advisor. S&P Global Ratings neither recommends nor will recommend how an issuer can or should achieve a particular credit rating outcome nor provides or will provide consulting, advisory, financial or structuring advice. Unless otherwise indicated, the term "issuer" means both the issuer and the obligor if the obligor is not the issuer. All Credit Rating Actions in S&P Global Ratings' Sole Discretion.S&P Global Ratings may assign, raise, lower, suspend, place on CreditWatch, or withdraw a credit rating, and assign or revise an Outlook, at any time, in S&P Global Ratings' sole discretion. S&P Global Ratings may take any of the foregoing actions notwithstanding any request for a confidential or private credit rating or a withdrawal of a credit rating, or termination of a credit rating engagement. S&P Global Ratings will not convert a public credit rating to a confidential or private credit rating, or a private credit rating to a confidential credit rating. Publication.S&P Global Ratings reserves the right to use, publish, disseminate, or license others to use, publish or disseminate a credit rating and any related analytical reports, including the rationale for the credit rating, unless the issuer specifically requests in connection with the initial credit rating that the credit rating be assigned and maintained on a confidential or private basis. If, however, a confidential or private credit rating or the existence of a confidential or private credit rating subsequently becomes public through disclosure other than by an act of S&P Global Ratings or its affiliates, S&P Global Ratings reserves the right to treat the credit rating as a public credit rating, including, without limitation, publishing the credit rating and any related analytical reports. Any analytical reports published by S&P Global Ratings are not issued by or on behalf of the issuer or at the issuer's request. S&P Global Ratings reserves the right to use, publish, disseminate or license others to use, publish or disseminate analytical reports with respect to public credit ratings that have been withdrawn, regardless of the reason for such withdrawal. S&P Global Ratings may publish explanations of S&P Global Ratings' credit ratings criteria from time to time and S&P Global Ratings may modify or refine its credit ratings criteria at any time as S&P Global Ratings deems appropriate. Reliance on Information.S&P Global Ratings relies on issuers and their agents and advisors for the accuracy and completeness of the information submitted in connection with credit ratings and the surveillance of credit ratings including, without limitation, information on material changes to information previously provided by issuers, their agents or advisors. Credit ratings, and the maintenance of credit ratings, may be affected by S&P Global Ratings' opinion of the information received from issuers, their agents or advisors. Confidential Information.S&P Global Ratings has established policies and procedures to maintain the confidentiality of certain non-public information received from issuers, their agents or advisors. For these purposes, "Confidential Information" shall mean verbal or written information that the issuer or its agents or advisors have provided to S&P Global Ratings and, in a specific and particularized manner, have marked or otherwise indicated in writing (either prior to or promptly following such disclosure) that such information is "Confidential." S&P Global Ratings Not an Expert, Underwriter or Seller under Securities Laws.S&P Global Ratings has not consented to and will not consent to being named an "expert" or any similar designation under any applicable securities laws or other regulatory guidance, rules or recommendations, including without limitation, Section 7 of the U.S. Securities Act of 1933. S&P Global Ratings has not performed and will not perform the role or tasks associated with an "underwriter" or "seller" under the United States federal securities laws or other regulatory guidance, rules or recommendations in connection with a credit rating engagement. Disclaimer of Liability.S&P Global Ratings does not and cannot guarantee the accuracy, completeness, or timeliness of the information relied on in connection with a credit rating or the results obtained from the use of such information. S&P GLOBAL RATINGS GIVES NO EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, ANY WARRANTIES OF MERCHANTABILITY OR FITNESS PF Ratings U.S. (4/28/16)Page | 3 54 FOR A PARTICULAR PURPOSE OR USE. S&P Global Ratings, its affiliates or third party providers, or any of their officers, directors, shareholders, employees or agents shall not be liable to any person for any inaccuracies, errors, or omissions, in each case regardless of cause, actions, damages (consequential, special, indirect, incidental, punitive, compensatory, exemplary or otherwise), claims, liabilities, costs, expenses, legal fees or losses (including, without limitation, lost income or lost profits and opportunity costs) in any way arising out of or relating to a credit rating or the related analytic services even if advised of the possibility of such damages or other amounts. No Third Party Beneficiaries.Nothing in any credit rating engagement, or a credit rating when issued, is intended or should be construed as creating any rights on behalf of any third parties, including, without limitation, any recipient of a credit rating. No person is intended as a third party beneficiary of any credit rating engagement or of a credit rating when issued. PF Ratings U.S. (4/28/16)Page | 4 55 Summary: Denton, Texas; CP; Combined Utility Primary Credit Analyst: Theodore A Chapman, Farmers Branch + 1 (214) 871 1401; theodore.chapman@spglobal.com Secondary Contact: Timothy P Meernik, Centennial + 1 (303) 721 4786; timothy.meernik@spglobal.com Table Of Contents Rating Action Stable Outlook Credit Opinion Related Research WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 156 Summary: Denton, Texas; CP; Combined Utility Credit Profile US$100.0 mil util sys rev extendable cml pap nts prog ser A due 01/12/2031 Short Term Rating A-1+New Denton comb util Long Term Rating AA-/Stable Affirmed Rating Action S&P Global Ratings assigned its 'A-1+' rating to the city of Denton, Texas' series A utility system revenue extendable commercial paper (ECP) program. The authorizing resolution permits the city to issue both tax-exempt and taxable notes, so long as the total amount outstanding does not exceed the authorized size of the program, currently $100 million. The ECP rating is based on the long-term general creditworthiness of the city's combined utility, based on our "Methodology For Linking Long-Term And Short-Term Ratings" (April 7, 2017). S&P Global Ratings also affirmed its long-term 'AA-' rating on the system's revenue-secured debt. The outlook on the long-term rating is stable. The CP notes are secured by a subordinate-lien pledge on the net revenues of the city's combined electric, water, and wastewater system. In the event that the city needs to extend CP note maturities to 270 day from 90 days--for which the city already has codified policies that speak to timing and who among staff is responsible for each particular task--the notes would revert to the maximum interest rate of 10% if they are tax-exempt, or 12% for taxable notes. Because the series A program is not supported by a revolving credit agreement or even a letter of credit, we do not expect nor are we assuming for rating purposes that the city maintains sufficient cash on hand to retire outstanding notes in the event they cannot be rolled over. Instead, we understand that the city council will adopt a parameters resolution each year that delegates the staff the authority to issue revenue bonds to convert outstanding notes to long-term debt. With the six-month window afforded by the ability to extend note maturities plus the authorization to issue revenue bonds to retire the notes, it is our view that any risks outlined in our "Contingent Liquidity Risk" criteria (March 5, 2012) are sufficiently remote. A first-lien pledge of net revenues of Denton's combined electric, water, and wastewater systems secures the approximately $680 million in long-term debt outstanding as of fiscal year-end 2020. Most of the allocable debt--more than $450 million--are general obligation bonds and other tax-secured debt that was issued on behalf of the utility and is self-supported by surplus net revenues. In fiscal 2019, the electric system alone accounted for just over half of net revenues available for debt service, making it the focus of our analysis. Credit overview Denton's combined utility provides electric (about 54,500 accounts), water (37,000), and wastewater (35,000) service WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 257 to a primarily residential customer base 35 miles north of Dallas in Denton County. The electric system derives its power primarily from renewable purchased power agreements, which accounted for more than 60% of energy in fiscal 2019. The renewable portfolio is backed by market purchases and 12 city-owned quick-start combustion gas engines that provide 225 megawatts (MW) in peaking capacity. Our analysis incorporates the financial contribution of each utility system to the combined utility's capacity to meet its financial obligations. We applied our retail electric and gas utilities criteria in performing the analysis because the electric system's net revenue represents a preponderance of net revenue available to service the debt. In fiscal 2019, the electric system provided about 55% of net revenue, the water system 28%, and the wastewater system 17%. The rating reflects our opinion of the combined utility's very strong enterprise risk profile, including its: • Very strong operational management assessment, as evidenced by the electric system's recent transition to a more renewable power supply and annual updates to its multiyear capital planning and financial forecasts; • Adequate market position. The electric system's average rate revenue remains greater than the state average, although we positively view the presence of an energy cost adjustment (ECA) that management reviews quarterly; and • Very strong economic fundamentals, reflected by the combined utility's residential customer base, lack of customer concentration, and Denton's participation in the broad and deep Dallas-Fort Worth metropolitan statistical area. The rating also reflects our view of the combined utility's very strong financial risk profile, including its: • Fixed-cost coverage (FCC) that averaged a very strong 1.5x annually over fiscal years 2017-2019; • Extremely strong liquidity and reserves; and • A sizable capital plan that is likely to include substantial additional debt. The stable outlook reflects our view of the combined utility's mainly residential customer base, as well as the electric system's diverse power supply both as to supplier and fuel mix. The combined utility's unrestricted reserves provide financial flexibility to meet near-term challenges, including the economic effects of the pandemic on utility sales. A large, growth-driven capital plan that includes additional borrowing, however, could pressure the long-term financial profile. Environmental, social, and governance factors The combined utility has taken steps in recent years to reduce its carbon footprint and meet potential greenhouse gas emission regulations, given that its power supply centers on renewables and natural gas-fired peaking generation and has shifted away from coal. In February 2018, the city council adopted the Denton Renewable Resource Plan, which set a goal to generate 100% of the city's annual electricity from renewables by 2020. While the electric system still uses natural gas-fired generation and market purchases (which are generally gas-fired) to meet demand during peak periods, renewable sources provided more than 60% of energy requirements in fiscal 2019. The electric system executed PPAs for additional solar power in fiscal 2020. Through the early months of the pandemic, the city suspended shutoffs and disconnections of customers for health WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 3 Summary: Denton, Texas; CP; Combined Utility 58 and safety purposes. Although shutoffs resumed in August 2020, management will not assess penalty fees at least through March 2021, and the city continues to work with third-party non-profits for customer bill-pay assistance. The city used federal relief money plus some of its own reserves to further bolster the programs. We view governance-related characteristics as in line with those of comparable municipal utility systems. The city council is the final approver for base-rate adjustments, the annual budget, and the issuance of debt. The city has a long history of timely audits and continuing disclosure that we view as typical for the public finance universe. Stable Outlook Downside scenario If the impacts of the additional debt were to outstrip the currently ample financial capacity and weaken FCC over time to a level that is consistently below 1.4x, we could lower the rating. Upside scenario If, as S&P Global Economics projects, credit conditions for all governments and their related utilities face headwinds such as elevated unemployment for the next several years because of a potentially uneven and prolonged recovery, this could increase the likelihood of unfavorable variances to budget. Attainment of a higher rating would therefore be predicated mainly on the utility system's financial results far outstripping the forecast and at a level we would view as sustainable. Credit Opinion Enterprise risk profile The electric system's power supply has transitioned away from coal and now centers on contracted PPAs of renewable energy, natural gas-fired peaking capacity, and market purchases when doing so is economic. The electric system's Denton Energy Center, consisting of 12 quick-start combustion turbines with a capacity of 225 MW, began operations in July 2018. In fiscal 2019, the electric system derived 63% of its power supply from several PPAs (largely wind and solar), 22% from spot or day-ahead market purchases (which in Texas' market are usually gas-fired), and 15% from owned generation (natural gas). We view positively the number of projects from which the electric system gets power, reducing supply risk. The electric system is compliant with all environmental regulations. The combined utility's management annually updates its multiyear capital planning and financial forecasts. We view the planning and forecasts as credit positive because they can provide direction, identify problems, and require a forward-looking view. The electric system's weighted-average revenue per kilowatt-hour as a percentage of the state average was 117%, according to 2019 data from the U.S. Energy Information Administration. We believe that the electric system's rate-raising flexibility is limited given the rates are above the state average. The city did not implement a base-rate adjustment for any system in fiscal 2021 nor has it had to do so over the past five years, and in fact reduced water rates by 2% in 2020. Nor is the city planning to adjust base rates in the upcoming five years. The electric system has an ECA to recover changes in power costs. In our view, the ECA is a credit positive because it allows the electric system WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 4 Summary: Denton, Texas; CP; Combined Utility 59 to adjust rates when costs for purchasing power (or fuel) change. For the water and wastewater systems, the combined bill for a residential customer consuming 6,000 gallons per month is $74.70, or about 1.9% of median household effective buying income. In our view, the water and wastewater rates are affordable. In fiscal 2019 for the electric system, residential customers made up about 88% of customer accounts, 39% of kilowatt-hour sales, and 44% of revenue. We believe that residential customers provide stability, as residential sales are less volatile than commercial and industrial sales. Customer concentration is limited for the combined utility. In fiscal 2019, the top customer accounted for about 4% of the combined utility's revenue, while the top 10 customers accounted for 14%. The city's median household effective buying income is 91% of the national rate, skewed somewhat by the large number of college students living in Denton, chiefly the University of North Texas and Texas Woman's University, both of which had a mix of in-person and virtual enrollment in fall 2020. In November 2020, the unemployment rate in Denton was 6.4%, half of what it was in April 2020 and in line with the region's and nation's levels. Financial risk profile The combined utility's FCC was 1.43x in fiscal 2019, 1.8x in fiscal 2018, and 1.27x in fiscal 2017, all generally strong, in our view. FCC is S&P Global Ratings' adjusted debt service coverage metric that incorporates all use of utility operating revenues regardless of lien or accounting treatment, and also treats certain mandatory minimum costs as if they were debt service payments of the city even if they are in actuality operating expenses. We make these adjustments to inform our view of true financial capacity as well as to improve comparability between peer utilities. The city has represented that despite the macroeconomic conditions, COVID-19 has not had a material impact on cash flow. Still, management also implemented a number of cost-saving measures in fiscal 2020 to avoid any unfavorable variance to budget. Furthermore, management is projecting declining purchased power expenses over the next five years, while also assuming that revenue from the Denton Energy Center declines as renewable generation increases throughout the Electric Reliability Council of Texas market. The combined utility's unrestricted reserves totaled $181 million, equivalent to about nine months of operating expenses, at the end of fiscal 2019. In its long-term financial forecast for each of the three utility divisions, management considers beginning-of-the-year reserves to be available for appropriation, although the forecast also indicates operating reserves will be well above the respective targets of: • Electric: equivalent to 60-75 days of operating expenses; • Water: 120-180 days; and • Wastewater: 100-140 days. We believe that this amount of liquidity provides sufficient cushion to any lingering effects of the pandemic on the economy and customer accounts receivable. The extremely strong available reserves also provide the city the discretion if it chooses to strategically deploy cash toward the capital plan, which is substantial. The plan contains $501 million in capital commitments through fiscal 2025, about $385 million of which will be financed with additional debt. Currently, the only cash slated to be used to fund capital projects will be impact fees. WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 5 Summary: Denton, Texas; CP; Combined Utility 60 Related Research • Through The ESG Lens 2.0: A Deeper Dive Into U.S. Public Finance Credit Factors, April 28, 2020 Certain terms used in this report, particularly certain adjectives used to express our view on rating relevant factors, have specific meanings ascribed to them in our criteria, and should therefore be read in conjunction with such criteria. Please see Ratings Criteria at www.standardandpoors.com for further information. Complete ratings information is available to subscribers of RatingsDirect at www.capitaliq.com. All ratings affected by this rating action can be found on S&P Global Ratings' public website at www.standardandpoors.com. Use the Ratings search box located in the left column. WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 6 Summary: Denton, Texas; CP; Combined Utility 61 WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JANUARY 12, 2021 7 STANDARD & POOR’S, S&P and RATINGSDIRECT are registered trademarks of Standard & Poor’s Financial Services LLC. S&P may receive compensation for its ratings and certain analyses, normally from issuers or underwriters of securities or from obligors. S&P reserves the right to disseminate its opinions and analyses. S&P's public ratings and analyses are made available on its Web sites, www.standardandpoors.com (free of charge), and www.ratingsdirect.com (subscription), and may be distributed through other means, including via S&P publications and third-party redistributors. Additional information about our ratings fees is available at www.standardandpoors.com/usratingsfees. S&P keeps certain activities of its business units separate from each other in order to preserve the independence and objectivity of their respective activities. As a result, certain business units of S&P may have information that is not available to other S&P business units. S&P has established policies and procedures to maintain the confidentiality of certain non-public information received in connection with each analytical process. To the extent that regulatory authorities allow a rating agency to acknowledge in one jurisdiction a rating issued in another jurisdiction for certain regulatory purposes, S&P reserves the right to assign, withdraw or suspend such acknowledgment at any time and in its sole discretion. S&P Parties disclaim any duty whatsoever arising out of the assignment, withdrawal or suspension of an acknowledgment as well as any liability for any damage alleged to have been suffered on account thereof. Credit-related and other analyses, including ratings, and statements in the Content are statements of opinion as of the date they are expressed and not statements of fact. S&P’s opinions, analyses and rating acknowledgment decisions (described below) are not recommendations to purchase, hold, or sell any securities or to make any investment decisions, and do not address the suitability of any security. S&P assumes no obligation to update the Content following publication in any form or format. The Content should not be relied on and is not a substitute for the skill, judgment and experience of the user, its management, employees, advisors and/or clients when making investment and other business decisions. S&P does not act as a fiduciary or an investment advisor except where registered as such. While S&P has obtained information from sources it believes to be reliable, S&P does not perform an audit and undertakes no duty of due diligence or independent verification of any information it receives. Rating- related publications may be published for a variety of reasons that are not necessarily dependent on action by rating committees, including, but not limited to, the publication of a periodic update on a credit rating and related analyses. No content (including ratings, credit-related analyses and data, valuations, model, software or other application or output therefrom) or any part thereof (Content) may be modified, reverse engineered, reproduced or distributed in any form by any means, or stored in a database or retrieval system, without the prior written permission of Standard & Poor’s Financial Services LLC or its affiliates (collectively, S&P). The Content shall not be used for any unlawful or unauthorized purposes. S&P and any third-party providers, as well as their directors, officers, shareholders, employees or agents (collectively S&P Parties) do not guarantee the accuracy, completeness, timeliness or availability of the Content. S&P Parties are not responsible for any errors or omissions (negligent or otherwise), regardless of the cause, for the results obtained from the use of the Content, or for the security or maintenance of any data input by the user. The Content is provided on an “as is” basis. S&P PARTIES DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR USE, FREEDOM FROM BUGS, SOFTWARE ERRORS OR DEFECTS, THAT THE CONTENT’S FUNCTIONING WILL BE UNINTERRUPTED OR THAT THE CONTENT WILL OPERATE WITH ANY SOFTWARE OR HARDWARE CONFIGURATION. In no event shall S&P Parties be liable to any party for any direct, indirect, incidental, exemplary, compensatory, punitive, special or consequential damages, costs, expenses, legal fees, or losses (including, without limitation, lost income or lost profits and opportunity costs or losses caused by negligence) in connection with any use of the Content even if advised of the possibility of such damages. Copyright © 2021 by Standard & Poor’s Financial Services LLC. All rights reserved. 62 S&P Short‐Term Issue Credit Ratings 63 Date: January 15, 2021 Report No. 2021-006 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: Provide a report on the updated Business Retention and Expansion plan. EXECUTIVE SUMMARY: The Denton Business Retention and Expansion (BRE) Program is a community-based program used to open lines of communication and build relationships among the City and local businesses in order to maintain a healthy local economy and a positive business climate. The Denton BRE Program promotes job growth and business expansion by helping identify concerns and barriers to the survival and growth of local businesses. Staff initiated the development of a new BRE Program during 2020, with implementation beginning in 2021. BACKGROUND: The recent comprehensive economic development strategic plan identified a need to focus on fostering growth within the business community. Among the recommendations was a need to update and expand business retention and expansion efforts. With this in mind, staff worked to draft a new BRE Program to roll out in 2021. Staff worked through the Economic Development Partnership Board (EDPB) to develop the new BRE Program Plan. Staff presented the draft BRE Program outline and key program elements to the EDPB on Oct. 14, 2020 for the Board’s review and feedback. Based on the feedback provided, staff drafted a final BRE plan that was approved by the EDPB on Nov.11, 2020. The BRE program is the primary tool to assist staff in assessing the needs and barriers of existing businesses in the community. The program includes many ongoing local economic development programs that focus on retaining and growing the existing businesses in Denton, and also includes an increased emphasis on outreach, data collection and analysis, and seeking resolutions for businesses. The 2021 BRE Program Plan includes the following goals and objectives: Establish and build relationship with local employers to accurately assess their business needs, challenges, or opportunities for expansion and growth. Provide assistance to business that will help them overcome their challenges and assist them with expansions that add new jobs. Provide better information and understanding for all local leaders of the strengths and weaknesses of the business climate. Foster more employment opportunities. Build cooperation and consensus among local government, economic development organizations and businesses and support collective action focused on improving the local and regional business climate 64 Date: January 15, 2021 Report No. 2021-006 Provide support for Minority Business Enterprises and Historically Underutilized Businesses (MBE/HUB). A key factor in the BRE Program is business visits. These visits help build relationships between business leaders and the Economic Development team. The visit process includes an introductory email, a pre-survey, the visit survey, and a follow-up. Staff will include a cross- section of businesses in Denton in the visitation cycle which will occur from January to August 2020. The goal is to visit 10-15 business in each category of large, medium, small, and start-up business. A new feature this year is allowing businesses to request a visit. Staff are working on a request portal that will allow businesses to request a contact from the BRE team and arrange for a visit. In in interim, businesses requesting a visit can contact the City’s Economic Development department directly. While the COVID-19 pandemic is ongoing, all visits will be conducted under strict COVID-19 safety protocols, with digital visits being held whenever possible or requested. In addition to business visits, other components of BRE best practices have been incorporated into the Program. These additional efforts will strengthen engagement within the business community and connect businesses to the resources they need. These efforts include: Small business workshops Industry/sector roundtables Welcome letters to new businesses Business newsletter and online information Annual business survey Networking opportunities Workforce development MBE/HUB support Create cohort of local organizations for business support/resources (Denton Business Allies) Business Recognition Awards Access to local business resources Access to funding sources Establishing a MWBE Vendor Policy within the City Disaster recovery assistance Staff is working with several local and regional business support organizations and other City departments to either promote existing efforts or to develop programs around new efforts. In preparation to launch the revamped BRE Program, staff has completed developed of the pre- survey and business survey, finalized the BRE business visit list, and engaged with several community stakeholders to discuss program implementation. The BRE Program Plan is designed to be a living document, guided by the information collected and the feedback from engaged stakeholders. Much like the BRE Program is cyclical, the Plan 65 Date: January 15, 2021 Report No. 2021-006 and its elements will be reviewed, evaluated, and improve on a continuous basis to ensure that Denton businesses have access to the information and resources to be successful. ATTACHMENT(S): Exhibit 1 – BRE Program Plan STAFF CONTACT: Kay Brown-Patrick Business Development Administrator (940) 349-7771 Kay.Patrick@cityofdenton.com REQUESTOR: Staff initiated PARTICIPTAING DEPARTMENTS: Economic Development STAFF TIME TO COMPLETE REPORT: 1 hour 66 Updated: November 2020 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM 67 Page | 1 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM BUSINESS RETENTION & EXPANSION PROGRAM OVERVIEW The Denton Business Retention and Expansion (BRE) Program is a community-based program used to open lines of communication and build relationships among the City and local businesses in order to maintain a healthy local economy and an improved business climate. The Denton BRE Program promotes job growth and business expansion by helping identify concerns and barriers to the survival and growth of local businesses. Program Goals • Establish and build relationships with local employers to accurately assess their business needs, challenges, or opportunities for expansion and growth. • Provide better information and understanding for all local leaders of the strengths and weaknesses of the business climate. • Foster more employment opportunities. • Build cooperation and consensus among local government, economic development organizations, and businesses and support collective action focused on improving the local and regional business climate. • Provide support for Minority Business Enterprises (MBE) and Historically Underutilized Businesses (HUB). Short-term objectives • Provide community support for local business • Help businesses improve profitability • Identify and address immediate concerns of individual business • Let local businesses know how much they are valued in the community • Establish an implementation plan to improve the business climate • Compile an inventory of existing businesses with contact information Long-term objectives • Increase the competitiveness of local businesses • Promote business development and job creation • Establish an implementation plan of action for business growth Ultimately, BRE programs serve to answer the following two questions: 1) Who can we help to grow in order to expand employment and the tax base? and, 2) Who is at risk of closing or moving that we can help to stay open or remain in the community? 68 Page | 2 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Additionally, the BRE Program will assist the City, the Economic Development Department, partners, and community leaders gather business intelligence on local businesses. BRE surveys, company visits, and other formal or informal data gathering techniques can provide a snapshot of the community’s business climate. BUSINESS SELECTION & VISITS The City of Denton greatly values its existing Denton businesses and is poised to assist in their growth and expansion. A key factor in the BRE Program is business visits. These are visits made to as many area businesses as possible and help build relationships between business leaders and the Economic Development team. These visits create a connection between staff and businesses so as problems or obstacles arise, businesses know who to contact for assistance. The information gathered during such visits typically provides insights on local business needs, plans for relocation, expansion, or closure, and perceptions or attitudes of the business community. How does it work? Economic Development Program staff will arrange a site visit with a designated company. Before the visit, staff will collect information from a pre-survey. During the visit, staff will connect with the visit and fill out the associated business survey document. Following the visit, staff will work to resolve any issues or questions that arise during the meeting, follow-up as needed, or make connections to other partners or resources. After the visit, the business is encouraged to contact staff as appropriate when assistance is needed. These efforts a re meant to assist existing companies to ensure their retention and expansion within the community. How many visits are scheduled and how do they occur? • Visits: 10-15 targeted per size/focus area • Visits may be conducted face-to-face or virtually Who comes on the visit? • City of Denton Economic Development staff • Other business industry partners as appropriate What are the benefits? • Provides companies with an economic development contact within the City to address issues or needs. • Provides the City with greater insight and understanding of companies and their key decision makers. 69 Page | 3 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Increases communication and cooperation between the City and local companies. The following section outlines the general steps in the BRE business visit process. Introductory Contact Initial contact with the businesses will be made by a staff member via the preferred contact method (typically phone or email) to schedule a visit. This allows staff to make introductions or get a preliminary idea of what information or resources will be helpful to have prepared for the visit. Pre-Survey Once a visit is scheduled, the business will receive an electronic copy of an optional pre-survey to complete in advance of the visit. The pre-survey will assist in determining what partners should join on the visit and better prepare the team in researching for resources to address any concerns and having them prepared for the visit. Business Survey Form A generic survey (Attachment A – Business Survey) will be used during site visits to guide data collection and discussion. By using a consistent survey, staff are able to track businesses that have been contacted, categorize and better address concerns, and identify trends both within specific industries or other meaning categories. Follow-Up A “thank you” card will be sent to each person interviewed after the meeting expressing the City’s appreciation for the business. Staff will utilize a Client Relationship Management (CRM) system for tracking and follow up. Staff will maintain a contact list by company and input all information gathered into the system. Staff can then re-evaluate any business needs at the end of the year. If concerns are brought up during the initial interview, they will be addressed afterward with the appropriate persons, and actions taken will be relayed to the business. When needed, an additional visit will be made with appropriate representatives from the BRE team to address the issues. Business Selection Process Staff will include a cross-section of businesses in Denton in the visitation cycle. The City of Denton Economic Development Department will devise a process for selecting which businesses receive a visit based on various goals and targets. This process will allow for diversity and inclusion of particular subgroups of interest within the business community. Part of this process involves using the two-digit North American Industry Classification System (NAICS) business sector coding to ensure adequate representation of businesses chosen from each 70 Page | 4 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM sector of the local economy. Businesses will be prioritized using selection criteria including number of employees, building size, land and building space available for potential expansion, and other business factors. Although this method is not statistically representative o f the greater business population, it will provide the team with information from businesses in the following sub-categories: large, medium, small, and start-up. Businesses may be chosen at random or may be selected based on key factors or economic criteria. These businesses can include, but are not limited to: • Long-standing businesses in the community; • Creative, model businesses; • Large employers; • New businesses with growth potential; • Minority-owned businesses; • Businesses that serve an ethnic market; • Businesses that serve existing businesses; and • Unusual businesses that add character. TIMELINE Successful BRE programs are cyclical and continuous. Knowing what the issues are for businesses is an ongoing process for business and economic support organization s. Throughout the BRE cycle, there are months devoted to collecting and assessing data, providing reports to stakeholders, evaluating the effectiveness of the program, and making any needed adjustments. The cycle concludes with an evaluation period that includes follow-up on immediate ‘red flag’ issues in addition to short and long terms action plans. The follow-up phase is ongoing and includes action throughout the year to address concerns or needs. BRE visit cycle January – August Evaluation period September – December PARTNERS/LOCAL RESOURCES It takes a team of community and regional stakeholders to make a BRE program effective. A critical component of the Denton BRE Program will be to build a team of economic, community and workforce development organizations that provide programs, resources, and services to the business community. With a team of service and resource providers in place, we will more effectively build a cohesive, responsive approach to address the needs of businesses in Denton. The following groups/organizations will be utilized to assist in successfully supporting the business community: 71 Page | 5 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM • EDP • Denton County • Denton Chamber of Commerce • Denton Black Chamber of Commerce • SBDC • Texas Workforce Solutions • UNT Murphy Center for Entrepreneurship & Innovation • TWU Women Entrepreneur Center • NCTC • Stoke • Local business associations • United Way • Denton ISD • Individual business leaders in the community • Utility companies ACTIVITIES & INITIATIVES Fostering relationships with businesses and business leaders requires intentional engagement and support. It is integral to go beyond the basic business surveys and visitation model to a more comprehensive, value-added model that can address various aspects of business operations, including marketing, finances, workforce training and development, and strategic planning. Therefore, in addition to the business visits, there are other factors to the BRE plan that will be added to strengthen engagement within the business community. These include: • Small business workshops • Welcome letters to new businesses • Business newsletter and online information • Annual Business Survey • Networking opportunities/Peer roundtables • Workforce development • MBE/HUB support • Denton Business Allies • Business Recognition Awards • Access to local business resources • Access to funding sources • Establishing a MWBE Vendor Utilization Policy within the City • Disaster recovery assistance DATA COLLECTION The information gathered from visits and surveys can provide valuable intelligence on the successes and obstacles facing businesses in Denton. This information then helps the Economic Development team identify the key issues that need to be addressed. It also helps to tailor the programs and support services that provide the most value to local businesses. 72 Page | 6 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM The goal of the program is to capture both quantitative and qualitative data regarding business operations, expansions, challenges, and the overall business climate. The following are representations of the type of data sets that will be collected. Quantitative Measures • Number jobs created/retained • Number of retained businesses • Cost per job created/retained • Number of businesses visited • Number of businesses surveyed • Number of businesses assisted • Percent of jobs held by local residents/LMI • Average salary of jobs created Qualitative Measures • Business perceptions of local government • Business perceptions of the community • Relationship between business retention programs and City services available to businesses (e.g. workforce development initiatives) • Involvement of assisted businesses in other community activities ASSESSING RESULTS During the evaluation period (September-December), the information gathered during the visit cycle will be evaluated for general needs the businesses may have as well as to assess the success of our approach to supporting the business community. For example, tracking how many businesses have remained open and how many have expanded their activities can indicate whether or not the BRE program efforts are producing results. An annual assessment of the program will provide information on which aspects of the pro gram worked well and which did not. Questions to be considered in evaluating the BRE Program • To what extent was the BRE initiative effective in retaining and/or expanding business in our community? • What changes occurred in the community as a result of BRE ? Why? • What statistics or stories (e.g. a business did not relocate because of the program) can we report back to the community? • What objectives were not achieved? Why not? • What challenges or opportunities did we experience in terms of implementing the project? 73 Page | 7 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Report Results The Economic Development Department will communicate BRE results through periodic reports that summarizes the BRE activities. BRE visit and survey data, along with other reports, will be compiled into discernible trends to inform City Council, EDPB, stakeholders, investors, and the public. These periodic reports will be used to help track progress and identify things that require attention, as well as acknowledge achievements. Relevant information in these reports may include number of BRE visits, expansion plans, perception of the area’s business climate, utilization of economic development programs, and more. 74 Page | 8 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Attachment A- Business Survey Date of visit: _______________Met with: ____________________________________________ Company Name: Company Address: Company Website: Primary Contact: Business Phone: Mobile: ____________Email: Is your company locally owned? Yes No Where are your corporate headquarters located? Do you have multiple locations? Yes No If yes, where? Primary industry type: ______________________________________ NAICS Code: ___________ Brief description of the services or products provided:__________________________________ _______________________________________________________________________________ _______________________________________________________________________________ How many total employees locally? ______ FT? _____PT? _____ Temporary/Contract? _______ Does the current condition of your facility meet your needs for the next year? Yes No Is your facility owned or leased? ____ Plans to expand in the next three years? Yes No Is there room for expansion at your current site? Yes No Are you currently experiencing recruitment problems? Yes No If yes, Business Retention & Expansion Survey 75 Page | 9 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Explain. ____________ What is the desired level of education for the majority of your potential employees? What is the average hourly wage range paid to employees? Are there any areas of training that would be beneficial to your employees? For example, soft skills, accounting, welding, or coding. Explain Who are your top three suppliers? Please include business name and location. Who are your top three customers? Among the companies you do business with, supp liers or customers, are there any you think would benefit by moving to the DFW Region? Yes No Explain Name top 3 challenges your business is currently facing: 76 Page | 10 BUSINESS RETENTION & EXPANSION (BRE) PROGRAM Additional notes: FOR STAFF USE: Team Members Present: City __________________________________ Chamber ______________________________ Other _______________________________ VIA Phone In-Person Interview Follow-Up: Recommendations: ___________________________________________________________________________ Action: _____________________________________________________________________________________ ___________________________________________________________________________________ _________ Follow-up Date: ______________________________________________________________________________ Comments: __________________________________________________________________________________ ____________________________________________________________________________________________ ____________________________________________________________________________________________ Note any additional contact made with business 77 Date: January 15, 2021 Report No. 2021-007 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: Provide an update on the Economic Development Strategic Plan. EXECUTIVE SUMMARY: In 2019, the City engaged economic development consulting firm TIP Strategies to lead Denton’s comprehensive economic development strategic planning process. Since November 2019, staff and the TIP team have worked together to develop a plan that outlines Denton’s specific vision and the strategies and tactics to bring the concept to fruition. Community members and various internal and external stakeholders were engaged throughout the process, with the Economic Development Partnership Board serving as the primary steering committee. After months of community and stakeholder engagement, the Economic Development Strategic Plan was presented to City Council for consideration. On Oct. 27, 2020, the City Council provided direction to move forward with the plan. A formal resolution to adopt the plan will be brought forward for Council consideration in February. BACKGROUND: In 2019, the City engaged economic development consulting firm TIP Strategies to review the City’s partnership agreement with the Denton Chamber and lead Denton’s economic development strategic planning process. Since that time, staff and the TIP team have worked together to engage stakeholders, collect and analyze relevant data, and develop a strategic plan for economic development that outlines Denton’s vision and the strategies and tactics to bring the vision to fruition. The project goals for the development of the strategic plan were as follows: 1. Assess the community and compare it to similar communities, including a full SWOT analysis and analysis of the existing tax base. 2. Develop a vision and goals for economic development in Denton, incorporating feedback from relevant stakeholders. 3. Identify target industries and subsectors, make recommendations regarding how to attract and target specific industries, including demonstrating how targeted industries support the vision and goals, and identify the best methods for recruitment. 4. Review incentives and economic development tools, provide best practices and guidelines for strategic use, and provide recommendations on traditional and nontraditional incentives. 5. Analyze and make recommendations regarding areas for development and redevelopment. 6. Create an actionable work plan that guides the next three to five years of departmental work plans, staffing, assignment of duties, and include clear metrics to measure performance and execution of strategies. 78 Date: January 15, 2021 Report No. 2021-007 Overview of Process The work to develop the strategic plan was broken down into three phases (discovery, opportunity, and implementation), with specific tasks assigned to each phase. The discovery phase focused on stakeholder engagement. Community members and various internal and external stakeholders were engaged through roundtable discussions. The roundtable focus areas included: tech/entrepreneurship, industry, education and workforce, development and infrastructure, young professionals, developers, and higher education. Also, the team had discussions with representatives from the Denton Chamber of Commerce, Denton County Judge Andy Eads and Denton County Economic Development staff, Texas Woman’s University, the University of North Texas, North Central Texas College, Denton ISD, the Downtown Economic Development Committee, Stoke Denton, relevant City departments (Airport, Capital Projects, City Manager’s Office, Development Services, DME, Economic Development, and Utilities). The City Council Members also participated in individual conversations and work sessions with TIP Strategies. The Economic Development Partnership Board (EDPB) served as the primary steering committee and held many discussions with TIP Strategies and staff during the process, including at their January and February 2020 meetings. Once stakeholders had been engaged, a draft plan was developed, with the draft plan being representative of the input received through the engagement process. At this point in the plan development process, the COVID-19 pandemic forced changes to the development schedules and to the plan itself. Due to the cancellation of planned community meetings as a result of the COVID-19 pandemic, staff initiated a digital/online engagement process that included posting the plan on a dedicated webpage and allowed for an online public comment period (July 1 to July 31, 2020) to engage the community-at-large in the planning process. Public comments were incorporated into the plan wherever possible and shared with the EDPB and City Council during work sessions. To guide completion of the plan, the EDPB reviewed and discussed the draft plan at the June 24, July 8, and Aug. 12, 2020 EDPB meetings. At the July 8 meeting, the Board requested additional details be brought back regarding implementation, including an outline of the tasks associated with implementing the plan, the targeted implementation timeline, the responsible entity, the cost associated with tasks and programs, and the amount of funding needed for the proposed catalyst fund. Staff and TIP Strategies worked together to complete a draft Implementation Matrix and 79 Date: January 15, 2021 Report No. 2021-007 quantify estimated costs and an annual investment that correlates with the proposed implementation matrix. This information was presented to EDPB at their Aug. 12 meeting, with the EDPB voting 8-0 to recommend City Council adopt the Economic Development Strategic Plan. The City Council reviewed the plan at work sessions on Aug. 18 and Oct. 27, 2020, providing direction on Oct. 27 to move forward with adopting the plan. Staff worked with TIP Strategies to complete the formal preparation of the plan and implementation matrix. Staff intends to bring forward a resolution adopting the plan in early 2021. Overview of Strategic Plan This section includes a summary of the core sections of the Economic Development Strategic Plan. A copy of the full plan is attached as Exhibit 1. The Economic Development Strategic Plan includes guiding principles, developed from stakeholders’ input, which help define economic development in Denton, goals, and strategic growth areas, which allow the City to organize its economic development efforts. The plan also includes an implementation matrix, which outlines specific tasks, a proposed timeline, estimated costs, and identifies what entity will be responsible for implementation. The guiding principles of the plan reflect the values of the community. In the context of an economic development strategy, they are a set of statements expressing how a community defines economic development. These principles were crafted through input from Denton stakeholders throughout the planning process. The guiding principles are: Core Resiliency: Protect the City’s core economic base and major employers by retaining business and providing them with the support necessary to continue doing business in Denton. Future Focused: Position Denton for future growth by understanding trends and adopting a proactive approach to economic development. Inclusive Growth: Enhance economic development opportunity for all residents by utilizing different strategies that recognize the diverse needs and assets of different communities, especially those in south and east Denton. Entrepreneurial Spirit: Cultivate the City’s entrepreneurial ecosystem by investing in quality of place and catalyzing innovation that will continue to attract creative professionals to Denton. Cultural Vitality: Strengthen Denton’s cultural vitality by continuing to promote arts and music while also marketing the City as DFW’s cultural hub. The plan was built around three major goals, which provide the three primary areas under which the City should organize its economic development program over the next several years. The goals are: Accelerate Recovery: Coordinate short-economic recovery efforts from the COVID-19 pandemic by aggregating information, collaborating with regional partners, and allocating resources to top priorities. 80 Date: January 15, 2021 Report No. 2021-007 Foster Growth: Attract long-term economic growth aligned with community priorities by focusing on the four strategic growth areas of connectivity, creativity, sustainability, and competitiveness. Strengthen Community Inclusion: Align economic, workforce, and community development efforts to meet critical community needs and to strengthen community inclusion. Under each goal, the plan includes strategies and actions that are incorporated into current and future economic development programs. Under the “Foster Growth” goal, the plan also includes details regarding the creation and fostering of economic ecosystems. These ecosystems are the networks of resources, key players, and activities to help achieve the goals. This includes anchor institutions, competitions and events, local capital, emerging participants, building blocks, and public awareness activities that enhance and create a thriving ecosystem. Each goal also includes a detailed list of actions to be incorporated into economic development work plans. Each action includes the responsible entity, cost, and the timeline for implementation. The efforts are summarized in the Implementation Matrix, attached as Exhibit 2. The Implementation Matrix provides a mechanism through which staff can review and evaluate performance and track economic development activities. The Matrix is designed to be regularly reviewed and evaluated overtime by both staff and leadership. The Matrix is, and should remain, dynamic as priorities shift over time, resources come available, new programs get created, and opportunities are presented. Capacity and Resources In addition to the Economic Development Strategic Plan’s main sections, the plan also includes a section devoted to recommendations related to capacity building and the dedication of resources. This includes recommendations related to the role and administration of the EDPB regarding strategic decisions and the creation of a workgroup to focus on tasks and activities. Staff has already initiated the creation of the Economic Development Work Group, which was also detailed in the City’s partnership agreement with the Denton Chamber of Commerce. The Plan also includes a section related to funding and the creation of the Denton Catalyst Fund. Staff worked with TIP Strategies to conduct an analysis of recommended strategies, looked at comparative funding used by cities using the economic development sales tax, and other factors to develop recommendations related to the creation and funding of the Catalyst Fund. Staff presented options to the City Council at the Aug. 18 and Oct. 27, 2020, City Council meetings. The staff recommendation is to create a fund that uses available fund balances and a small percentage of ROI from the City’s utility funds that will be built up over time. Because a final recommendation regarding the specific funding process was not reached, staff are working to schedule future discussions with the City Council regarding the creation of the Catalyst Fund and the programming required by the strategic actions laid out in the Plan. ATTACHMENT(S): Exhibit 1 – Draft Economic Development Strategic Plan Exhibit 2 – Draft Implementation Matrix 81 Date: January 15, 2021 Report No. 2021-007 STAFF CONTACT: Jessica Rogers Director of Economic Development (940) 349-7531 Jessica.Rogers@cityofdenton.com REQUESTOR: Staff initiated PARTICIPTAING DEPARTMENTS: Economic Development STAFF TIME TO COMPLETE REPORT: 2 hours 82 ECONOMIC DEVELOPMENT STRATEGIC PLAN CITY OF DENTON, TEXAS DECEMBER 2020 83 ACKNOWLEDGMENTS Marty Rivers Denton Chamber of Commerce John Baines Denton Black Chamber of Commerce Keely Briggs Denton City Council, District 2 Jesse Davis Denton City Council, District 3 Tony Clark Independent Bank Group Chris Davis Peterbilt Charlie Dromgoole Denton Chamber of Commerce Bob Eames Aviation Steve Edgar Medical City Denton Todd Hileman City of Denton Jill Jester Denton Chamber of Commerce Mark McLellan University of North Texas Jimmy Mejia Denton Hispanic Chamber of Commerce Pamela Padilla University of North Texas Erica Pangburn Denton Chamber of Commerce Jessica Rogers City of Denton Erica Sullivan City of Denton Jason Tomlinson Texas Woman’s University Jamie Wilson Denton Independent School District CONSULTING TEAM TIP STRATEGIES, INC., is a privately held economic development consulting firm with offices in Austin and Seattle. TIP is committed to providing quality solutions for public sector and private sector clients. Established in 1995, the firm’s primary focus is economic development strategic planning. CONTACT TIP Strategies 2905 San Gabriel Street, Suite 309, Austin, TX 78705 PH: 512-343-9113 www.tipstrategies.com CONSULTING TEAM Tom Stellman, CEO/Founder Jaclyn Le, Consultant Brent McElreath, SVP, Research & Development Evan Johnston, Analyst Phoebe Polakovic, Analyst Meredith Eberle, Designer TIP Strategies would like to thank the following individuals for their participation in this planning process, along with the hundreds of business leaders, community leaders, young professionals, and other major stakeholders from Denton who participated in this project. ACKNOWLEDGMENTS All images in this report were provided by the city of Denton or purchased from Adobe Stock by TIP Strategies, unless otherwise noted 84 CONTENTS Executive Summary . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .1 Project Background and Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .2 Plan Framework . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 Guiding Principles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .3 Economic Development Goals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Strategic Recommendations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .5 Goal 1 Accelerate Recovery . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6 Goal 2 Foster Growth . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10 Goal 3 Strengthen Community Inclusion . . . . . . . . . . . . . . . . . . . . .42 Capacity and Resources . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 Economic Development Partnership . . . . . . . . . . . . . . . . . . . . . . . .46 Funding . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47 Programs and Policies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 Marketing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 Internal Systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .53 Strategic Performance Metrics . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 Appendices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 Appendix A. Data Findings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58 Appendix B. SWOT Analysis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60 Appendix C. Municipal Utility Comparison . . . . . . . . . . . . . . . . . . . .65 Appendix D. Ecosystem Directory . . . . . . . . . . . . . . . . . . . . . . . . . . .66 85 EXECUTIVE SUMMARY INTRODUCTION Denton has changed. Once considered a quiet college town on the outskirts of the Dallas-Fort Worth (DFW) Metroplex, Denton has grown significantly since the City’s last comprehensive economic development plan. The City leaders must be commended for the investments made in downtown Denton and the Westpark Industrial Park over the past decade. These intentional efforts have put Denton squarely in the path of growth. Today, Denton is well within the orbit of its surrounding DFW communities. The DFW Metroplex is one of the fastest-growing metropolitan regions in the country. As DFW grows, so will Denton. It is not only more connected to Dallas and Fort Worth but also the global markets and supply chains that are represented by a diverse array of industries across the region. All evidence points toward an upward trajectory for Denton. But Denton is at an inflection point—one not about attracting growth, but instead about how to respond to and embrace it. Denton must determine how it will welcome the opportunities associated with growth while also preserving the culture that makes this community so unique. The community must open its arms to new residents without letting existing residents fall behind. This is no easy feat, but Denton has already demonstrated that it has the leadership and assets necessary to successfully navigate through and thrive with change. What Denton needs now is a modern approach to economic development that is appropriate for a community of its size and is capable of leveraging public and private resources to capitalize on the opportunities that lie ahead. During this planning process, the coronavirus disease of 2019 (COVID-19) pandemic not only disrupted the writing of this plan but also upended almost every aspect of life for people around the world. The extent of the health crisis and economic damage cannot be understated. There is still immense uncertainty about the breadth and depth of the recession caused by this pandemic. The road to economic recovery will likely be bumpy, especially for a community like Denton that depends heavily on sales tax revenue to fund City operations and services. Denton’s immediate focus should be on accelerating economic recovery with a special focus on serving vulnerable populations that have been disproportionately impacted by this crisis. Still, there are a lot of reasons to be optimistic about Denton’s future. All the things that make Denton so attractive—its major industries, universities, arts and culture, downtown square, authentic people, and unique charm—will also be the things that help Denton to recover. 1 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS86 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2 This plan is meant to help focus economic development efforts to be more strategic and effective in responding to forthcoming changes in Denton. The plan’s framework, including guiding principles and goals are detailed in the next section. Strategic recommendations and actions are organized around three goals: accelerate recovery, foster growth, and strengthen community inclusion. Finally, the plan addresses the issue of organizational capacity and resources needed to modernize Denton’s economic development approach. PROJECT BACKGROUND AND SCOPE In late 2019, TIP Strategies (TIP) was engaged by the City of Denton Economic Development Department to develop an economic development strategic plan for the City. A strategic plan helps to focus and maximize economic development and workforce development efforts, especially during times of crisis. The economic development landscape is undergoing significant changes, and the economic fallout from the COVID-19 pandemic will be immense. Over the course of nine months, the TIP Strategies consulting team worked closely with the City of Denton (hereafter the City) to identify promising opportunities to capitalize on Denton’s growth. The planning process was conducted in three phases: discovery, opportunity, and implementation. The City should not view this strategic plan as a static document, but as one that invites revisions and amendments as conditions change. Now, more than ever, stakeholders should take a dynamic approach to implementation—one that revisits this plan on a regular basis to measure progress and to reprioritize strategies and actions as needed. ►Core Resiliency ►Future Focused ►Inclusive Growth ►Entrepreneurial Spirit ►Cultural Vitality ►Accelerate Recovery ►Foster Growth ►Strengthen Community Inclusion ►Connectivity ►Creativity ►Sustainability ►Competitiveness GUIDING PRINCIPLES ECONOMIC DEVELOPMENT GOALS STRATEGIC GROWTH AREAS PHASE 1 DISCOVERY Conducted roundtable discussions and interviews with Denton stakeholders. Important constituencies were engaged during this process, including the following. ►The Economic Development Partnership Board ►Denton City Council members ►Denton Chamber of Commerce ►Business and industry representatives ►City and county staff ►Entrepreneurs ►Higher education leaders ►Real estate developers ►Workforce development organizations ►Young professionals PHASE 2 OPPORTUNITY Identified major priorities for the strategic plan. A strengths, weaknesses, opportunities, and threats (SWOT) analysis, guiding principles, and strategies were developed based on input from discovery. PHASE 3 IMPLEMENTATION Developed action items and tactical recommendations. 87 PLAN FRAMEWORK With rapid changes reshaping the global economy, the need for strategic focus and organization is greater now. The purpose of this plan is to enable Denton’s Economic Development Department to better anticipate, respond, and evolve with changes affecting the economic success of residents and businesses. The framework, strategies, and actions detailed in this plan are informed by extensive data analysis and thorough stakeholder input, including interviews and roundtables with City, community, and business leaders. GUIDING PRINCIPLES Guiding principles reflect the values of a community. In the context of an economic strategy, they are a set of statements expressing how a community defines economic development. These principles were crafted through input from Denton stakeholders throughout the planning process. CORE RESILIENCY Protect the City’s core economic base and major employers by retaining businesses and providing them with the support necessary to continue doing business in Denton. FUTURE FOCUSED Position Denton for future growth by understanding trends and adopting a proactive approach to economic development. INCLUSIVE GROWTH Enhance economic opportunity for all residents by utilizing different strategies that recognize the diverse needs and assets of different communities, especially those in south and east Denton. ENTREPRENEURIAL SPIRIT Cultivate the City’s entrepreneurial ecosystem by investing in quality of place and catalyzing innovation that will continue to attract creative professionals to Denton. CULTURAL VITALITY Strengthen Denton’s cultural vitality by continuing to promote arts and music while also marketing the City as DFW’s cultural hub. 3 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS88 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 4 ECONOMIC DEVELOPMENT GOALS This plan is built around three major goals: accelerate recovery, foster growth, and strengthen community inclusion. Developed based on input from stakeholder engagement and economic assessments, the set of strategies and actions identified under each goal are meant to provide the City with a roadmap to organize its programs and bolster Denton’s vitality over the next several years. ACCELERATE RECOVERY Coordinate short-term economic recovery efforts from the COVID-19 pandemic by aggregating information, collaborating with regional partners, and allocating resources to top priorities.1 FOSTER GROWTH Attract long-term economic growth aligned with community priorities by focusing on four strategic growth areas: connectivity, creativity, sustainability, and competitiveness.2 STRENGTHEN COMMUNITY INCLUSION Align economic, workforce, and community development efforts to meet critical community needs and to strengthen community inclusion.3 89 STRATEGIC RECOMMENDATIONS 5 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS90 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 6 GOAL 1 ACCELERATE RECOVERY When the City of Denton and TIP Strategies began the planning process for this strategic plan, the original intent was to create a long-term vision for the City’s economic development efforts. The context for the planning process was one of optimism. The US was experiencing one of the longest uninterrupted periods of economic growth in history. Texas had one of the lowest unemployment rates in the country, and the DFW Metroplex was one of the fastest-growing metropolitan regions in the US. Much of that growth and opportunity was headed in Denton’s way. But now that context has shifted for everyone, everywhere. Early signs indicate that the current economic crisis might be one of the worst in US history. It is difficult to predict how things will evolve over the new few weeks and months. The lasting health and economic effects of the COVID-19 pandemic are still unfolding. Because strategic plans are meant to be forward looking, this plan would be incomplete, maybe even irrelevant, if it did not address the challenges that Denton will face as a result of this crisis. While the bulk of this strategic plan is still focused on Denton’s long-term future, this section provides recommendations for how the City can work to accelerate economic recovery once the health risks subside and sheltering mandates are lifted. Many of these strategies will likely need to be implemented virtually, as social distancing measures might be in place for an extended time. The City’s Economic Development Department team has already initiated positive efforts to support Denton’s businesses and residents during the early phase of crisis relief. Those efforts should be leveraged and expanded as the community moves into a recovery phase. Recognizing that resources in Denton will be impacted by the crisis, many of the recommendations are centered around the City in a convening and coordinating role with other community and economic development partners. STRATEGIES AND ACTIONS 1.1. ECONOMIC RECOVERY NERVE CENTER. The City’s Economic Development Department should function as Denton’s economic recovery nerve center with a primary focus on a cross-functional coordination of resources and responses related to the economic fallout from the COVID-19 pandemic. 1.1.1. Pull together a small group of top-level leadership from the City, the Economic Development Partnership Board (EDPB), and the Denton Chamber of Commerce to form the economic recovery nerve center. ►The purpose of the nerve center is to set the overall tone of economic recovery work, aggregate all information and actions across cross-functional teams, and allocate resources to integrate the responses of smaller teams. Coordinate short-term economic recovery efforts from the COVID-19 pandemic by aggregating information, collaborating with regional partners, and allocating resources to top priorities. 91 7 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 1.1.2. Shift the focus of the existing economic development structure from relief and policy enforcement to cross-functional elements of economic recovery, such as business retention, workforce development, and community services. ►BUSINESS RETENTION. Continue to focus on establishing a relationship with leaders in Denton’s main businesses, understanding short-term and long-term needs of those businesses, and communicating information with a unified voice. ► WORKFORCE DEVELOPMENT. Continue to work closely with Workforce Solutions, human resource leaders from businesses, and City departments to support businesses in protecting their employees while also maintaining business productivity as sheltering mandates begin to ease. ►COMMUNITY SERVICES. Provide vital wraparound services to Denton residents. Representatives of major nonprofits, foundations, and City departments should work together on creating a centralized inventory of resources, understanding resident needs, and identifying gaps in available services. 1.1.3. Develop an internal data dashboard to guide economic recovery efforts using a limited number of indicators that can be tracked over time and shared with partner organizations. ►Potential indicators include rate of full-time vs. part-time employment, retail sales, growth in construction permits, missed rent payments, access to broadband, and other qualitative information from business surveys (see Strategy 1.2). ►Where possible, indicators should be disaggregated by race and income levels to track how recovery efforts are reaching vulnerable communities. 1.2. TAKING THE PULSE OF THE BUSINESS COMMUNITY. As the health issues and economic fallout from COVID-19 evolve, the City should continue to implement strategies and tools to take the pulse of Denton’s businesses on a regular basis. 1.2.1. Continue to coordinate with the Denton Chamber of Commerce and Denton Main Street Association to assess short-term needs and long-term projections for Denton’s businesses. ►Ideally, the City and the chamber should distribute a joint survey to Denton businesses. Consistency in questions is integral to tracking data and information over time. ► As an alternative to surveys, the City could implement monthly virtual office hours or roundtables with businesses to gather information about their needs and challenges. 1.2.2. Stay connected to DFW organizations coordinating economic recovery and community service efforts across the DFW Metroplex. ►Organizations, such as the Dallas Regional Chamber, have created small business resources and a displaced workers job campaign that can be shared in Denton. 1.3. VIRTUAL BUSINESS RETENTION. The top economic development priority for the City is to continue supporting and retaining existing businesses through the recovery period. In-person visits might not be possible even after sheltering mandates are lifted, therefore, the City should create virtual business retention and expansion (BRE) options. 1.3.1. Continue to develop and maintain a database of Denton-based businesses. 1.3.2. Shift the City’s business visitation efforts to a virtual setting and establish a cadence of meetings with businesses as soon as appropriate. 1.3.3. Expand existing goals for business touchpoints on a monthly, quarterly, and annual basis. INTEGRATED NERVE CENTER RESPONSE “In an unfamiliar crisis, such as the COVID-19 outbreak, the nerve center concentrates crucial leadership skills and organizational capabilities and gives leaders the best chance of getting ahead of events rather than reacting to them.” —McKinsey & Company, “Responding to Coronavirus: The Minimum Viable Nerve Center.” GOAL 1 STRATEGIES 92 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 8 1.3.4. Reevaluate and adjust standard questions and protocols utilized in the City’s BRE program to be more responsive to the COVID-19 crisis and recovery. 1.3.5. Prioritize business retention efforts based on strategic growth areas (see Goal 2), employer size, employer growth (number of employees, revenue growth, etc.), and lease terminations. ►This data can be obtained through a database of existing businesses (see the “Internal Systems” section) as well as information from pulse surveys and other interactions with businesses. 1.3.6. Structure BRE efforts to serve several purposes. ►Educate businesses about resources and services offered by the City to aid in recovery. ►Collect answers to a short list of questions to quantify challenges the company is facing. ►Identify short-term and long-term issues the companies are grappling with across a variety of topics, including workforce and infrastructure needs. 1.3.7. Act as a concierge to priority businesses to help navigate processes within other municipal departments (e.g., partner with a project facilitator from the City’s Development Services Department). 1.4. WORKFORCE COLLABORATIVE. Focus on the workforce development function listed in Action 1.1.2 to develop broader strategies supporting Denton’s talent pipeline through recovery. 1.4.1. Prioritize engagement with the Denton County Workforce Success Leadership Team (DCWSLT) to connect City efforts to the broader regional context. ►While DCWSLT might be solely focused on the Asset Limited, Income Constrained, Employed (ALICE) population, the City should also focus on developing supports for unemployed residents, including those who have been displaced from jobs and might require upskilling or retraining in order to access new employment opportunities. ► The City can bring the perspectives of businesses to DCWSLT by aggregating and sharing information obtained through business retention activities and business engagement with the Denton Chamber of Commerce and the Denton Main Street Association. 1.4.2. Catalog which industries have been severely impacted by COVID-19 and determine if targeted resources can be deployed to support workers in those industries. ►For example, displaced retail workers might require special support in accessing training programs in order to switch occupations and/or sectors. 1.4.3. Use insights and data from business retention efforts and surveys of the business community as a baseline for employer demand. Couple this information with other data about unemployment rates and the needs of jobseekers. 1.4.4. Develop an inventory of training resources across providers, such as North Central Texas College (NCTC), Workforce Solutions for North Central Texas, and United Way. Include capacity levels and flexibility to streamline, redesign, or create new programs to meet employer needs. 1.4.5. Engage in demand planning to understand which businesses expect to hire and when. ►If specific occupations will be in demand, develop projections as well as competency requirements from employers. Communicate this information to training providers. ►Create a skills inventory using existing sources of data, such as Economic Modeling Specialists International (Emsi). 1.4.6. Identify barriers to accessing training and other workforce resources. Continue to coordinate with partner organizations to help remove these barriers for those seeking jobs. 1.5. INCLUSIVE ECONOMIC RECOVERY. The COVID-19 pandemic has had a disproportionate impact on low-income residents (of all races) and people of color (across socioeconomic status). Compared to other DFW cities, Denton has a larger proportion of its community (primarily in the southern and eastern parts of the City) that is more vulnerable to both GOAL 1 STRATEGIES 93 9 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS the health and economic fallout from COVID-19. Therefore, equitable and inclusive economic recovery strategies should be central in Denton’s efforts to stabilize its economy and recover from the pandemic. 1.5.1. Extend existing collaboration efforts with the City’s Community Development Department to coordinate resources and efforts to support residents through economic recovery. 1.5.2. Coordinate with the Denton Black Chamber of Commerce and other multicultural organizations to provide targeted information for businesses owned by women and people of color. ►Research indicates that these small business owners face structural exclusion from traditional sources of capital and aid packages, including the US Small Business Administration (SBA) Paycheck Protection Program. ► Partner with community development financial institutions in the DFW area to expand resources and programming into Denton to aid in economic recovery efforts. 1.5.3. Continue to collaborate with local and regional nonprofits in gathering information about what challenges residents are facing due to the economic impact of the COVID-19 pandemic. ►Use this information to work closely with other City departments, business leaders, and philanthropic entities to develop solutions that directly address resident needs. ►Having more accurate information about challenges and needs can be helpful in attracting funding from public and philanthropic sources. It can also help the City take actions or design policies that directly benefit vulnerable communities. 1.5.4. Disaggregate social and economic indicators by race and income levels to show how vulnerable populations are faring in comparison to other segments of the population. 1.5.5. Highlight businesses owned by women and people of color in marketing materials and through digital marketing channels to increase awareness and promote their success. 1.6. REGIONAL COLLABORATION. The economic fallout from COVID-19 will impact US metropolitan regions in different ways. Denton’s economic recovery is tied, in part, to recovery efforts in Denton County and in the broader DFW Metroplex. While Denton has unique assets and challenges as a college town, it can benefit from and contribute to regional resources and recovery efforts. 1.6.1. Continue the City’s existing support for the United Way of Denton County Information & Referral services to assist small businesses. ►If possible, add extra support for entrepreneurs and businesses owned by people of color by soliciting volunteers with expertise in these areas. ►Support DFW organizations, such as Capital Factory and Venture Dallas, to provide targeted support to Denton entrepreneurs and startups. 1.6.2. Strengthen the Denton County chamber and economic development workgroup and continue to build this network throughout the economic stabilization and recovery periods. ►In addition to information sharing, create task forces within the network to focus on critical issues and challenges that partner organizations are facing. 1.6.3. Leverage the Denton Innovation Group to develop targeted supports and resources to assist entrepreneurs through economic recovery. ►Continue to partner with organizations such as Stoke, the University of North Texas (UNT) Murphy Center for Entrepreneurship and Innovation, the Center for Women Entrepreneurs at Texas Woman’s University (TWU), TechMill, Denton Angel Investment Group, and the Dallas Entrepreneur Center. 1.6.4. Connect with regional DFW organizations, such as the Dallas Regional Chamber, to expand the information-sharing network beyond Denton County. GOAL 1 STRATEGIES 94 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 10 Attract long-term economic growth aligned with community priorities by focusing on four strategic growth areas: connectivity, creativity, sustainability, and competitiveness. GOAL 2 FOSTER GROWTH THE TRADITIONAL APPROACH Target industries have been a cornerstone of economic development programs. The six sectors in Figure 1 were identified as targeted sectors many years ago and have guided the work of Denton’s Economic Development Partnership (EDP). While these targets made sense at the time, they now cover much of Denton’s existing economy and do not capture the full extent of the City’s assets. Traditionally, target industries are defined by quantitative analysis to identify a concentration of industries that exist in a city or a region. Figure 2 illustrates the process by which traditional targets are identified. Analysis of data from the North American Industry Classification System (NAICS) is used to highlight where a community already has a larger- than-average concentration of employers and jobs. For example, a community with clusters of advertising, legal services, and tax preparation services might identify corporate and professional services as a target sector. This approach has several limitations. First, targets are identified using existing data that often fail to capture a community’s full assets and advantages. Emerging industries with growing momentum might not be captured in the NAICS taxonomy. Second, traditional targets say nothing about the institutions and organizations that contribute to building a concentration of industries. Third, traditional targets SUPPLY CHAIN LOGISTICS ADVANCED MANUFACTURING AVIATION RENEWABLE ENERGY INFORMATION TECHNOLOGY RESEARCH & DEVELOPMENT Figure 1. DENTON’S EXISTING TARGETS Quantitative analysis is used to identify a concentration of industries that exist in a city... TRADED CLUSTER LOCAL CLUSTER LOCAL CLUSTER TRADED CLUSTER Which are then grouped to form a target sector... TARGET SECTOR Figure 2. TRADITIONAL TARGET INDUSTRIES 95 11 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS are a static measure that can quickly become outdated. Or, in the case of Denton, a list of targets can keep growing until it covers most of the economy. Finally, from an organizational standpoint, traditional targets can, by default, tempt economic development offices to focus their time and measure their performance in inefficient ways. The challenge that Denton faces today is how to focus efforts and resources in a more strategic manner. THE PATH FORWARD As the DFW Metroplex grows, much of that growth will spread into Denton County. Planned developments, most notably Cole and Hunter Ranch, will continue to connect Denton to the broader DFW ecosystem. While the COVID-19 crisis will affect the timing of these developments, there is reason to be optimistic that Denton will continue to experience growth after a period of economic recovery. A modernized economic development approach is focused on cultivating strategic growth areas that fully leverage the community’s major employers, institutions, and intangible elements. Quantitative data, like NAICS codes, are one of many factors that informs a community’s strategic growth areas. Instead of targeting sectors, the main role for economic development organizations is to build ecosystems around their strategic growth areas. An ecosystem is comprised of many elements, including anchor institutions, principal and emerging participants, competitions and events, building blocks, local capital, and public awareness. The ecosystem overview on the next page provides a description of each element. The process of ecosystem building is illustrated in the case studies presented in this section. ►Connecting companies to top talent and innovations through the University of Arkansas Center of Excellence in Logistics and Distribution (CELDi) is one example of this concept in practice (page 19). ►An innovative business model mixing philanthropy with revenues earned from consulting services was part of building an entrepreneurial community in the Fargo, North Dakota, Emerging Prairie initiative (page 27). ►The focus of San Antonio, Texas, efforts to build a sustainable energy hub around its public utility was facilitating access to capital, expertise, and mentors through its Energy Partnerships Innovation center (EPIcenter) nonprofit (page 34). ►Chattanooga, Tennessee, efforts to upgrade its electrical grid with fiber optic cables laid the groundwork for the growth of a high-tech ecosystem and gave the city’s its Gig City moniker (page 41). Ecosystem building has several advantages. First, ecosystems factor in both quantifiable and intangible assets that a community possesses. Second, ecosystem building is a team sport that requires different contributions from different organizations so that economic growth is not the sole responsibility of one entity. Finally, ecosystems are more dynamic and more adaptable as elements change over time. DENTON’S STRATEGIC GROWTH AREAS The question remains, how will Denton respond to incoming growth? There is a way for Denton to welcome and attract growth that leverages the community’s assets and preserves its unique culture. Together the four growth areas below define a holistic approach to growth that applies to various aspects of Denton’s economy. By adopting growth areas, the City can ensure that Denton grows in a way aligned with both economic priorities and community needs. Furthermore, each of these growth areas can be used to organize economic development efforts. The following pages include more details about each growth area, including anchor institutions, principal and emerging participants, competitions and events, building blocks, local capital, and public awareness, that will drive growth in these areas. Appendix D includes more detailed information about trade associations, relevant conferences/events, and trade publications associated with each strategic growth area. CONNECTIVITY Denton’s major employers, interstate access, and planned infrastructure improvements make it a transportation and logistics hub for the DFW Metroplex. CREATIVITY A growing entrepreneurship community, including startups in the tech and arts/culture sectors, contributes to Denton’s unique vibe. SUSTAINABILITY The City’s investment in 100 percent renewable resources positions Denton to be a global leader in renewable energy and green technology. COMPETITIVENESS Denton’s economic competitiveness will continue to improve with planned housing developments, downtown amenities, digital marketing, and infrastructure improvements. 96 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 12 ANCHOR INSTITUTIONS Anchor institutions—universities, hospitals, and schools—are interwoven in a community’s economic, social, and cultural fabric. Partnering with anchors in economic development efforts can drive innovation and enrich economic vitality. COMPETITIONS & EVENTS Events can drive growth by cultivating sector-based networks, attracting tourists, and building a community’s brand. Competitions and events not only raise the profile of a community with outsiders, but also connect a community to a larger network of aligned stakeholders. LOCAL CAPITAL Access to capital can facilitate new ideas, deepen partnerships, and result in bigger impact for companies and community- based organizations. Ranging from venture capital to philanthropic grants, local capital is central to growth and success. BUILDING BLOCKS No ecosystem can thrive without a group of ecosystem builders that focus on collaboration across organizations, inclusion of diverse voices, and sustainability of economic development efforts. These builders can be coworking spaces, catalytic programs, or even visionary individuals. EMERGING PARTICIPANTS Every community has emerging players, including scrappy startups and innovative entrepreneurs, that have the potential to change the trajectory of the community. The buzz, innovation, and energy that emerging players bring is vital to renewing and reinventing a community’s economy. PUBLIC AWARENESS Branding and marketing are vital to growth. A community’s success stories should be shared widely through traditional media, social media, and industry- specific channels. Bringing attention to the businesses and people that are the heartbeat of a community can drive investment and foster growth. STRATEGIC GROWTH AREAS ECOSYSTEM DENTON’S GROWTH ECOSYSTEM 97 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS13 2A. CONNECTED DENTON THE VALUE In the past, Denton was viewed as a community on the outskirts of the DFW Metroplex, both geographically and economically. That has changed. The combination of highway improvements and significant growth into areas north of Dallas and Fort Worth has brought Denton into the DFW community in a more intensive way. Recent growth in Denton’s transportation and logistics-oriented businesses as well as improvements to the City’s infrastructure position Denton as a hub for business connectivity. THE ANCHORS Since the 1980s, Peterbilt has been one of Denton’s largest employers and a cornerstone of the City’s economy. Its success played a vital role in attracting other transportation and logistics companies to the west side of Denton. Both private sector businesses and publicly owned assets, such as Denton Enterprise Airport, contribute to Denton’s impressive transportation infrastructure. The airport’s recent addition of a second runway as well as the US Aviation Academy position the airport for increased business activity and usage. THE ECOSYSTEM Denton’s location at the intersection of I-35E and I-35W, as well as its proximity to three Class-1 railroad lines, makes it an ideal hub for transportation and logistics-focused businesses. Examples include companies that manufacture vehicles and transportation equipment, as well as warehousing and distribution activities. The expansion of e-commerce nationally, which has been accelerated by the COVID-19 pandemic, fuels demand for logistics firms. New entrants, such as United States Cold Storage and WinCo Foods, recognize Denton’s strategic advantages. As the industry undergoes major technological change, Denton is poised to be a leader in connectivity. Leveraging existing businesses and higher education institutions will make the City a nexus for supply chain innovation, research, and development. 98 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 14 ANCHOR INSTITUTIONS ►Peterbilt ►Denton Enterprise Airport ►US Aviation Academy ►UNT Center for Logistics & Supply Chain Management ►North Central Texas College COMPETITIONS & EVENTS ►International Conference on Information, Logistics and Supply Chain ►Accelerate! Conference & Expo ►Heavy Duty Aftermarket Week LOCAL CAPITAL ►Westpark Industrial Park TIRZ ►EDP Investment Fund BUILDING BLOCKS ►DFW Roundtable, Council of Supply Chain Management Professionals ►North Texas Commission, Logistics Development and Marketing Committee ►Institute for Supply Management Dallas ►Texas Association of Manufacturers EMERGING PARTICIPANTS ►United States Cold Storage ►Tetra Pak ►WinCo Foods ►Tyson Foods PUBLIC AWARENESS ►Item Journal of Commerce ►Advanced Manufacturing Insight ►Logistics Management ►International Journal of Shipping and Transport Logistics DENTON’S GROWTH ECOSYSTEM CONNECTED DENTON ECOSYSTEM 99 15 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS RELATED INDUSTRIES AND SECTORS Sectors and industries that keep Denton connected include all aspects of transportation, distribution, logistics, and communication systems, as well as manufacturing of vehicles and parts related to these systems. Representative Economic Development Administration (EDA) clusters include the following. Sources: US Bureau of Labor Statistics; Emsi 2020.1—QCEW Employees, Non-Quarterly Census of Employment and Wages (QCEW) Employees, and Self-Employed; US Economic Development Administration; Institute for Strategy and Competitiveness at Harvard Business School (HBS); TIP Strategies. Note: The cluster methodology developed at HBS has been adjusted by TIP Strategies to align with the six-digit NAICS classifications used by Emsi. STRATEGIES AND ACTIONS 2A.1. BUSINESS RETENTION AND EXPANSION (BRE). A strong BRE program is the foundation of any economic development program. In addition to developing a virtual business retention program (see Strategy 1.3), Denton also needs to enhance its existing BRE program in order to support existing businesses in a more intensive and robust manner. 2A.1.1. Refine and enlarge the City’s database of existing employers. The database should be expanded to include companies in the area that serve external markets or are suppliers to existing employers. 2A.1.2. Revise and ramp up the business visitation program to track trends among Denton employers and identify business needs. ►Virtual visits should be made until the COVID-19 health crisis recedes. ►Establish a visitation protocol, a list of information to be collected during each visit, and a goal for the number of businesses visited each year. DISTRIBUTION AND E-COMMERCE TRANSPORTATION AND LOGISTICS LOCAL LOGISTICS SERVICES AUTOMOTIVE (INCL. TRUCK MANUFACTURING) COMMUNICATIONS EQUIPMENT AND SERVICES CONNECTIVITY Number of jobs in the DFW metropolitan area: 423,873 Percent of jobs in the DFW metropolitan area: 10.7% EFFECTIVE BRE Businesses already in the community are well-positioned to create jobs and contribute to the tax base. Yet, often their achievements are overshadowed by the headlines of a new business moving to town. However, the effort and expense it can take to recruit a new business to town can be multiples of what it takes to support existing businesses, while the outcomes and impact of the two can be similar. An effective BRE program focuses on building relationships with existing businesses, establishing lines of communications such that any needs or challenges are voiced, and responding to those needs or challenges. One of the best means for doing this is to provide concierge services. Business concierges are often staff within an economic development organization who provide guidance to businesses in navigating planning, zoning, development, permitting, and construction processes. The concierge makes it easier for businesses to access services from different city departments so that any challenges are resolved efficiently. CONNECTED DENTON STRATEGIES 100 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 16 ►Organize joint business visits with area workforce development partners, including higher education and training providers. 2A.1.3. Communicate success stories that result from BRE visits. These might not translate directly to new job creation or increased capital investment, but they can still be valuable to businesses. ►Examples include assistance with permitting, workforce training, or infrastructure challenges. 2A.1.4. Provide incentives and/or grants to existing companies to assist with business expansion and help retain these valuable assets in Denton. 2A.2. ATTRACT NEW INVESTMENT. Recruiting new businesses should remain a top priority for the City’s Economic Development Department team. The City has a track record of success with business attraction, and efforts can be strengthened by focusing on external marketing and cultivating relationships in critical sectors. 2A.2.1. Cultivate relationships with real estate brokers and site selectors. ►Build a database of national and regional developers, brokers, and site consultants to identify targets, raise awareness of sites, development, and investment opportunities in Denton. ►Connect with site consultants in the DFW Metroplex and targeted regions on a regular basis. ►Host events that showcase specific assets, such as available sites, buildings, or new projects. Some communities host site tours or reverse pitch events where developers and brokers pitch their vision for a specific site or project. 2A.2.2. Create a centralized lead tracking system for Denton (see the “Capacity and Resources” section). 2A.2.3. Engage with regional economic development organizations, industry groups, and professional networks in the DFW Metroplex. ►Join regional industry associations and networks focused on Denton’s growth areas to remain current on critical issues, build stronger networks, and leverage resources. ►Attend conferences and trade shows held in the DFW Metroplex by national industry organizations aligned with Denton’s growth areas. 2A.2.4. Maintain and enhance the site location factors that are essential for connectivity industries: labor availability, highway access, affordable land and facilities, and favorable tax incentives. ►Denton’s triple freeport tax exemption is an example of a policy that is critical to business recruitment efforts in these sectors. 2A.3. WESTPARK INDUSTRIAL PARK. The industrial park is vital to Denton’s economic growth. Success in attracting new businesses, such as WinCo Foods and Tyson Foods, as well as retaining major employers like Peterbilt, is crucial for the City’s economic vitality. To build on this success, undeveloped land can be better marketed, and improvements can be made to core infrastructure. 2A.3.1. Prioritize infrastructure investments, particularly with respect to roads and utilities. ►Dedicate a set percentage of the City’s capital improvements budget to projects in the area to ensure that improvements are made in a timely manner. ►Expand Jim Christal Road to improve the connection between the industrial park and I-35. Stakeholders believe that the existing road cannot accommodate a growing number of businesses. This will require additional investment from the City beyond the Westpark tax increment reinvestment zone (TIRZ). 2A.3.2. Continue to track vacant properties and parcels, partnering with brokers and developers on new developments or redevelopments to increase the usefulness and value of these properties. 2A.3.3. Partner with UNT on relocating the sports recreation fields located at Precision Drive and Airport Road to an area outside the industrial park to improve safety and make better use of the land. CONNECTED DENTON STRATEGIES 101 17 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2A.3.4. Provide public infrastructure incentives (such as credits or reimbursements) for projects aligned to Denton’s growth areas. ►The City already utilizes most economic development tools available to incentivize development. Continue using the Westpark TIRZ to support the industrial park. 2A.4. CENTER OF EXCELLENCE. Denton has all the necessary assets to create a center of excellence (COE) focused on logistics and supply chain management. The presence of several logistics-oriented companies—Denton Enterprise Airport, NCTC, and UNT Center for Logistics & Supply Chain Management—provide Denton with a distinct advantage in the connectivity space. 2A.4.1. Leverage over $2.8 billion in planned projects from Texas Department of Transportation (TxDOT) in Denton to increase connectivity between Denton and surrounding DFW communities (Figure 3). ►A significant number of planned infrastructure improvements will continu e to make Denton a competitive community for logistics and transportation- oriented firms. ►Denton’s continued competitiveness in the connectivity space, coupled with other assets, should be the basis for creating a COE. It is essential for the partners interested in creating a COE to speak with a unified voice about the strategic advantages that Denton offers, which can be leveraged for even greater recognition and innovation. 2A.4.2. Explore the feasibility of a partnership between the businesses located in the Westpark Industrial Park, NCTC, UNT Center for Logistics & Supply Chain Management, and the City. ►Form a committee comprised of representatives from these organizations and other potential partners to meet regularly to move the concept forward. ►Compile an inventory of local and regional assets that would support the COE, including education and training programs, relevant university research, industry conferences and events, and companies. ►Research other COEs focused on logistics and distribution to understand potential organizational models, funding strategies, and areas of focus. ►Host a summit on topics affecting the logistics and distribution industry. ►Identify strategies for drawing researchers and faculty to the region, such as creating an endowed chair or designing opportunities for collaboration across institutions. 2A.4.3. Include workforce partners to create career pathways for Denton students and residents into in-demand occupations for Denton’s transportation and logistics businesses. 2A.4.4. Promote opportunities in the transportation, logistics, and supply chain fields to students in Denton and in economic development marketing materials. WHAT IS A CENTER OF EXCELLENCE? Centers of excellence are a collaboration between higher education institutions and businesses, leveraging the unique assets found within a region to support the advancement of research and training within a specific industry. They often serve as a magnet for industry expertise and are dedicated to the success of companies within a region. Expected outcomes include the following. ►Generating statewide and national recognition. ►Supporting Denton’s economic growth. ►Leveraging the unique assets of Denton’s higher education institutions. CONNECTED DENTON STRATEGIES 102 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 18 Figure 3. PLANNED TXDOT PROJECTS IN DENTON PHASE PROJECTS EST. COST Construction underway or begins soon 24 $99,035,892 Construction begins within 4 years 8 $421,055,003 Construction begins in 5 to 10 years 8 $756,529,022 Corridor Studies, construction in 10+ years 5 $1,394,440,290 TOTALS 45 $2,671,060,207 Source: Texas Department of Transportation, Project Tracker. CONNECTED DENTON STRATEGIES 103 CONNECTED DENTON CASE STUDY TAKEAWAYS FOR DENTON ►Establish a COE in Logistics at UNT with industry leaders in the area, like Peterbilt, to facilitate collaboration between the public and private sectors. ►Join CELDi to access an established network of universities, national companies, and funding. ►Creating a COE not only provides benefits to existing companies but also acts as a talent development strategy for Denton and its major employers. BACKGROUND Headquartered at the University of Arkansas in Fayetteville, CELDi (Center for Excellence in Logistics and Distribution) is a multidisciplinary industry and university research center established in 2001. The cooperative is comprised of six university partners from across the nation and 31 companies, ranging from global corporations to municipalities like San Pedro, Mexico. For universities, admission to CELDi is predicated on the expertise of each institution, while industry partners provide ongoing financial support for logistics research through tiered membership options. Companies benefit from increased efficiency in their supply chain as a direct result of the innovation created with university partners as well as having direct access to top students. CELDi hosts biannual joint meetings in which researchers and the Industrial Advisory Board (comprised of representatives from member companies) coordinate new projects and offer continuing education courses. CELDi’s mission is to produce the next generation of engineers in logistics and distribution centers while advancing the industry through innovations in products and systems.. PROGRAM OUTCOMES (2019) ►UA has received over $3 million in industry-funded research sponsorship. ►CELDi industry members include Walmart Stores, UPS—Chain Supply Solutions, Air Liquide, The Boeing Company, Lockheed Martin Aircraft & Logistics Center, and Medical Center Hospital in Odessa, Texas. CELDi | UNIVERSITY OF ARKANSAS, DEPARTMENT OF INDUSTRIAL ENGINEERING www.celdi.org 19 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS104 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 20 2B. CREATIVE DENTON Photo by Annie Spratt via Unsplash THE VALUE Denton’s reputation for arts and culture makes it a standout destination within the DFW Metroplex. Its cultural assets not only foster quality of place but also create an economic advantage. Over the past decade, a budding creative economy has attracted entrepreneurs to Denton, making the City a hub for big ideas and innovation. Denton has a vibe unlike any other community in the region. By continuing to nourish this creative ecosystem, the City can flourish and become a vibrant destination for talent and investment. THE ANCHORS From higher education to coworking spaces, Denton’s creative economy is anchored by diverse and thriving institutions. TWU and UNT are catalysts for innovation and drivers of the City’s talent pipeline. Stoke is the heartbeat of Denton’s startup scene, providing a hub for entrepreneurs near downtown amenities. Embracing and strengthening these anchor institutions will not only attract growth but also ensure that the creative elements at the heart of Denton’s culture will continue to thrive. THE ECOSYSTEM In recent years, a strong cluster of education technology companies has emerged in Denton. The presence of two universities along with strong support for entrepreneurs has made Denton an ideal location for edtech startups. Events such as the Denton Black Film Festival have also drawn tourists to Denton and strengthened community ties. However, Denton’s creative economy requires additional support, including stronger connections to the DFW tech scene and venture capital. The City can nurture Creative Denton by cultivating relationships with DFW capital sources and raising public awareness of Denton artists and entrepreneurs. 105 21 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS ANCHOR INSTITUTIONS ► UNT Murphy Center for Entrepreneurship and Innovation ► Center for Women Entrepreneurs at TWU ► North Central Texas College ► Denton ISD COMPETITIONS & EVENTS ► FlintConf ► Denton Black Film Festival ► Bootstrap Denton ► TIACON LOCAL CAPITAL ► Denton Angels ► Tech Wildcatters ► North Texas Angel Network EMERGING PARTICIPANTS ► Ready Rosie ► Kubos ► Wildcards ► iTeach BUILDING BLOCKS ► Stoke ► TechMill ► Capital Factory, Dallas ► Open Denton ► Dallas Entrepreneur Center PUBLIC AWARENESS ► Denton Record-Chronicle ► Discover Denton ► North Texas Daily ► Voice of Denton ► Dallas Innovates CREATIVE DENTON ECOSYSTEM CREATIVE DENTON ECOSYSTEM 106 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 22 RELATED INDUSTRIES AND SECTORS Sectors and industries that make Denton creative include computer technology, research, design, and the arts. Representative EDA clusters include the following. Sources: US Bureau of Labor Statistics; Emsi 2020.1—QCEW Employees, Non-QCEW Employees, and Self- Employed; US Economic Development Administration; Institute for Strategy and Competitiveness at Harvard Business School (HBS); TIP Strategies. Note: The cluster methodology developed at HBS has been adjusted by TIP Strategies to align with the six-digit NAICS classifications used by Emsi. STRATEGIES AND ACTIONS 2B.1. CHAMPION AND CONVENE. The City can strengthen entrepreneurship in Denton by advocating for local startups and serving as a connector between entrepreneurs and the talent, capital, and networks they need. 2B.1.1. Support the expansion of networking channels and opportunities for relationship building among the region’s entrepreneurs, startups, and students. ►While the City might not directly oversee these programs, it can support the efforts of partner organizations, such as Stoke and universities. 2B.1.2. Establish connections with DFW entrepreneurship organizations such as Dallas 1 Million Cups, 1 Million Cups Frisco, Dallas Innovates, Capital Factory, and the Dallas Entrepreneur Center. ►Connecting with regional efforts not only helps make local entrepreneurs aware of available resources but also helps raise awareness in DFW about the Denton’s assets and the City’s commitment to creating an entrepreneurial ecosystem. ►Networking with regional organizations and becoming more visible in these initiatives can also help attract entrepreneurs to Denton. 2B.1.3. Assemble a knowledge resource network to support entrepreneurs and companies with access to financial, legal, policy, and research information needed to grow their businesses. ►Communities take different approaches to creating “entrepreneur support mechanisms,” a phrase coined by the Ewing Marion Kauffman Foundation, to connect CREATIVITY Number of jobs in the DFW metropolitan area: 179,361 Percent of jobs in the DFW metropolitan area: 4.5% COMPUTER SERVICES SOFTWARE PUBLISHERS RESEARCH ORGANIZATIONS ARCHITECTURAL SERVICES PRINTING SERVICES DESIGN SERVICES OTHER MARKETING-RELATED SERVICES PUBLISHING ADVERTISING-RELATED SERVICES PERFORMING ARTISTS “There are a lot of pearls in Denton, but they’re not on a string yet.” —Denton entrepreneur CREATIVE DENTON STRATEGIES 107 23 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS entrepreneurs with the information they need. For example, KCSourceLink, an intermediary in the Kansas City region, created a Resource Navigator with over 240 businesses that can connect entrepreneurs to different types of knowledge and resources. More examples can be found through Kauffman’s ESHIP Communities initiative. ►Fargo’s Emerging Prairie initiative provides an ecosystem that brings together entrepreneurs, large corporations, educational institutions, nonprofits, and students through networking events, coworking space, skills training, and more (see case study on page 27). 2B.1.4. Partner with local and regional partners to design reverse-pitch competitions to engage major corporations and organizations in the DFW Metroplex with needs for innovation. ► In a reverse-pitch competition, established businesses pitch a challenge to entrepreneurs and solicit solutions. Businesses have their challenges addressed while entrepreneurs benefit from establishing connections and increased awareness about their startups. ► Denton can customize a reverse-pitch competition for its entrepreneurship community by connecting local entrepreneurs with school districts in the region to tackle edtech challenges. ► Helping the City solve issues, such as sustainability, housing, and other community challenges through social entrepreneurship, is another area where this approach could be beneficial. 2B.1.5. Ensure that targeted resources are available for businesses owned by women and people of color, who have historically faced barriers to accessing traditional economic development tools (e.g., create a dedicated fund to assist historically underutilized businesses). 2B.2. ACCESS TO CAPITAL. Increase access to capital for Denton entrepreneurs by aggregating information about diverse sources of funding and developing relationships with potential funders. 2B.2.1. Cultivate relationships with the DFW venture capital (VC) community so that local companies are not forced to relocate after they grow beyond their initial rounds of capital. ► Gather information about trends in the DFW market, what local VCs are investing in, and projections for growth. ► Connect Denton’s high-potential startups to local and regional funders. ► Create a database of capital resources, including local banks, angel investors, and high-net-worth individuals, to drive the City’s internal work plan (e.g., guide networking strategies and establish priorities) and share with partner organizations (i.e., Denton Innovation Group). 2B.2.2. Partner with the Denton Angels to expand access to capital for Denton startups. Work with other angel networks in the DFW Metroplex, and across Texas, to improve deal flow for Denton companies and investors. ►The role of the City should be focused on facilitating connections between investors and startups in Denton and making connections to regional organizations. 2B.2.3. Network with regional entrepreneurship programs so that they become familiar with Denton and the resources available for businesses looking to grow within the DFW Metroplex. 2B.2.4. Revise the funding requirements for the EDP Investment Fund to be more inclusive of innovative startups that might not meet current thresholds for employment and capital investment. ► Over the long term, creating a separate fund dedicated to entrepreneurship in Denton is preferable, however, a short-term solution is to create an exception for startups seeking support from the EDP Investment Fund. CREATIVE DENTON STRATEGIES 108 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 24 ► A potential model for a startup fund is the McKinney Innovation Fund (announced in January 2020) provided by the McKinney Economic Development Corporation. Eligibility and incentives are differentiated for startups at different phases of their life cycles. For example, growth startups have lower thresholds for minimum annual revenue and employees compared to established startups seeking to relocate to McKinney, Texas. ► A more rigorous analysis and exploration of the needs of startups in Denton is required to develop a new fund that effectively addresses barriers specific to this community. The City can convene a small task force of entrepreneurs and those connected to the DFW entrepreneurial ecosystem to provide input that can guide specific elements of a startup fund. ► Some elements that the City should consider for building a startup fund include differentiated support for startups at different phases of growth, target industries and sectors, hiring of targeted residents (such as women and Black, indigenous, and people of color [BIPOC]), number of jobs, and wages. 2B.3. ECOSYSTEM BUILDERS. Thriving entrepreneurial ecosystems rely on ecosystem builders to coordinate disparate organizations and initiatives. Denton has a handful of strong builders, including Stoke and TechMill. Their efforts to foster collaboration should be supported through financial resources and capacity building. 2B.3.1. Support the Denton Innovation Group to define a vision for entrepreneurship in Denton, establish goals, measure progress, and connect with DFW organizations. ► The City’s role in this effort is envisioned as a supporting partner rather than a lead. ► Support could include donating financial resources, such as helping to engage a consultant or facilitator to build out a detailed work plan, or the commitment of time and participation in this effort. 2B.3.2. Launch an accelerator to support growth of existing companies. ► Accelerators are programs that help startups scale-up by offering mentorship, facilitating connections to investors and other businesses, and building capacity for the startup to grow. Typically, accelerators support a small cohort of high-potential, early-stage startups that have already experienced some level of success or market validation. ►A major challenge in Denton is the lack of resources for companies that seek to scale up. Startups tend to “outgrow” Denton and move to more well-resourced communities. Examples of successful accelerators include Techstars and Y Combinator. The Innovation Depot in Birmingham, Alabama, is another potential model to follow. ► State and federal resources are available to support accelerators. For example, the US SBA Growth Accelerator Fund provides over $4 million in prizes to accelerators across the country on an annual basis. 2B.3.3. Host a Citywide pitch competition to identify and develop innovative entrepreneurs in Denton. This not only builds Denton’s creative brand but also provides the City with a way of identifying top talent in the community. 2B.3.4. Support the development of office space where companies can expand. Continuing to prioritize redevelopment in the downtown area and using flexible zoning will facilitate these efforts. WHAT IS ECOSYSTEM BUILDING? “Ecosystem building is emerging as a new profession at the intersection of economic and community development. Successful ecosystem builders must connect traditional, top-down economic development approaches with the grassroots, bottom-up, community-driven environments in which most entrepreneurs thrive.” —Ewing Marion Kauffman Foundation, “Entrepreneurial Ecosystem Building Playbook 3.0.” CREATIVE DENTON STRATEGIES 109 25 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2B.4. EDTECH CLUSTER. Strong higher education presence and innovation in Denton independent school district (ISD) make Denton a competitive spot for education technology (edtech) companies. A growing cluster of edtech companies in Denton is applying advanced technologies in K–12, higher education, and adult learning environments. 2B.4.1. Capitalize on Denton’s status as an emerging hub for edtech companies to drive additional growth and investment in this sector and to attract more creative professionals to Denton. ►Promote Denton’s edtech companies and link them with potential business expansion/relocation prospects in other markets. 2B.4.2. Create an edtech alliance with entrepreneurial companies, Denton ISD, UNT Murphy Center for Entrepreneurship and Innovation, and the Center for Women Entrepreneurs at TWU to identify opportunities to strengthen and diversify edtech in Denton. ►Research other edtech alliances across the US to understand how they are structured. ►Hold an introductory meeting to identify the range of possible partners and to explore common opportunities and/or needs the alliance could address. ►Consider possible activities the alliance could take on, such as hosting networking events and conferences, publishing materials, and advocating for policies supportive of edtech. ►Establish channels for students to engage with edtech companies and leaders through internships and case competitions. 2B.4.3. Support the expansion of Denton ISD’s annual Technology in Action Conference (TIACON) about education technology and curriculum. ►Utilize the event to highlight existing edtech businesses that have been founded in Denton, including ReadyRosie, Wildcards, ALL In Learning, From the Future, and Kinful. 2B.5. RECRUIT GROWING STARTUPS. Target and recruit growing early- stage firms in the DFW Metroplex and other target markets in the US, including larger urban areas on the coasts. Companies growing out of the startup phase might be looking for ways to expand their businesses. 2B.5.1. Engage with DFW entrepreneurship organizations, talent networks, and industry associations to identify new companies. 2B.5.2. Target successful startups in business incubators/accelerators that are on the cusp of outgrowing their existing spaces and are positioned for expansion/relocation to Denton. ►Denton can target startups in several ways, including alignment with the four strategic growth areas of this plan and size of the startup (i.e., by revenue or number of employees). The City is poised to best support small to medium-sized firms that have outgrown initial rounds of funding or support from incubators. Firms that are interested in expansion but not large enough to need extensive office space in Denton are a good fit. The related industries and sectors listed for each growth area also offer a starting point for identifying aligned startups. ► Many universities in the DFW Metroplex operate incubators and/or accelerators for businesses started by students or faculty. The City could target entrepreneurs located at these institutions who are ready to expand beyond the university. For example, Denton could partner with the UNT Murphy Center for Entrepreneurship and Innovation to identify the next level of funding and support that its entrepreneurs need to expand or stay in Denton. ►Some chambers of commerce and economic development organizations in the region maintain lists of major incubators and accelerators that the City can use to begin outreach and relationship-building efforts. One example is the incubator list from Say Yes to Dallas. CREATIVE DENTON STRATEGIES 110 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 26 2B.5.3. Track VC firms in DFW, Silicon Valley, Austin, and other markets that have recently funded high-growth, innovative businesses. ►Use this list to follow VC trends and identify high-growth businesses that might be targets for expansion or relocation. This will also help the City build relationships in the VC community and facilitate connections to Denton startups. 2B.5.4. Use resources like the Inc. 5000 (a list of the fastest-growing private firms in the US based on year-over-year revenue growth) to identify firms that would be a good fit for Denton. Additional resources include the following. ►Crunchbase (for identifying recipients of venture funding) ►Fast Company (magazine about the world’s most innovative companies) ►MIT Technology Review (magazine about the smartest companies) 2B.6. PROMOTING DENTON’S CREATIVE BRAND. A foundational component of building an entrepreneurial ecosystem is making residents aware of how entrepreneurship can help to drive the economy. The City should collaborate in raising awareness of success stories, both locally and regionally. More information about the need for a revamp of Denton’s marketing efforts is in the Capacity and Resources section. 2B.6.1. Revise marketing materials to include specific information about the economic impact of startups to Denton’s economy and the incentives/resources provided specifically to startups. 2B.6.2. Aggressively utilize the City’s social media channels to publicize successes. 2B.6.3. Pitch stories about successful Denton companies to media outlets, such as the Denton Record-Chronicle, Dallas Morning News, Fort Worth Star-Telegram, Dallas Innovates, and D Magazine. 2B.6.4. Develop a Citywide entrepreneurial recognition program to harness the strengths of local efforts that already exist in Denton. CREATIVE DENTON STRATEGIES 111 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS27 CREATIVE DENTON CASE STUDY EMERGING PRAIRIE | FARGO, ND www.emergingprairie.com TAKEAWAYS FOR DENTON ►At a critical point in its history, EP changed its business model in order to diversify its funding sources and become more financially stable. ►While the coworking space is an important part of EP, its ecosystem consists of broader components aligned to clear economic goals and targets for growth. ►Equity and inclusion are viewed as a business imperative, and intentional efforts are made to diversify the entrepreneur pipeline. BACKGROUND Emerging Prairie opened in 2013 with the mission of growing the entrepreneurial community in North Dakota and furthering economic growth for the state. Originally a for-profit organization, EP became a non-profit in 2016 in order to remain a financially stable independent organization. Their revenue model is a mix of philanthropy and earned income, which is generated through consulting services, membership to the coworking space (the Prairie Den), and paid partnerships. EP has three divisions: 1) the Ecosystem which includes the Prairie Den, events, conferences, and programming, 2) the Emerging Digital Academy, a full-time, 20-week coding school that launched in 2020, and 3) the Grand Farm Initiative, which will create an AI-based working farm prototype by the year 2025 while cultivating a support system for the future of farming. PROGRAM OUTCOMES (2019) ►Microsoft invested $1.5 million in the Grand Farm Initiative ►EP held 135 events with more than 11,000 community members in attendance ►41% increase in year-over-year membership 112 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2828 2C. SUSTAINABLE DENTON THE VALUE Cities and regions are starting to embrace the growing importance of sustainability to economic vitality. Due to its 100 percent renewable energy goal, Denton is on track to becoming one of the most sustainable communities in the country. A select group of US cities have committed to this ambitious goal, and only a handful have achieved it. Aligning the City’s economic development efforts with its sustainability goals can bring environmentally conscious growth to Denton that both enhances the City’s environmental ethos and attracts business investment. THE ANCHORS Denton Municipal Electric (DME) is one of Denton’s greatest assets not only because of affordable rates but also because of its role in fostering sustainable development and growth. Denton’s ability to meet 100 percent of its electric needs from renewable sources and have a local gas plant allows the City to maintain competitive rates, while also reducing its environmental impact. Building a sustainability-focused growth strategy with DME as a centerpiece will provide Denton with a strategic advantage in attracting green businesses and investment. THE ECOSYSTEM Denton has a significant opportunity to lead the sustainability ecosystem in North Texas as well as the entire state. Its commitment to renewable energy and environmentalism is forward looking and progressive. Working closely with DME, the City’s Economic Development Department can continue to build resources and incentives for greater energy efficiency among Denton’s businesses. The City can leverage its reputation for sustainability to attract environmentally conscious businesses and be a thought leader in DFW’s renewable energy sector. Strategies include identifying environmentally conscious businesses, preparing targeted marketing materials, helping developers and companies access federal energy incentives, and staying current on relevant trends. 113 29 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS SUSTAINABLE DENTON ECOSYSTEM ANCHOR INSTITUTIONS ►Denton Municipal Electric ►UNT Department of Geography and the Environment ►UNT College of Engineering DENTON’S GROWTH ECOSYSTEM COMPETITIONS & EVENTS ►NTAEP TCEQ Trade Fair ►CleanTX GridNEXT Conference ►Society of Texas Environmental Professionals Annual DFW Meeting LOCAL CAPITAL ►Energy Efficiency Incentive ►Solar Installation Incentive ►Engineering Audit ►Standard Offer Incentive ►Green Business Program BUILDING BLOCKS ►North Texas Association of Environmental Professionals ►CleanTX ►Texas Municipal Utilities Association ►Advancing Data Center and IT (Information Technology) Infrastructure Professionals EMERGING PARTICIPANTS ►Embassy Suites ►North Central Texas Council of Governments Public Works Council ►North Texas Green Council ►North Texas Renewable Energy Group ►Sierra Club Lone Star Chapter PUBLIC AWARENESS ►Green Source DFW ►Renewable Energy ►Journal of Renewable and Sustainable Energy ►The Solar Reflector 114 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 30 RELATED INDUSTRIES AND SECTORS Sectors and industries where Denton can have a sustainable impact include construction, utilities, and engineering. Representative EDA clusters include the following. Sources: US Bureau of Labor Statistics; Emsi 2020.1—QCEW Employees, Non-QCEW Employees, and Self- Employed; US Economic Development Administration; Institute for Strategy and Competitiveness at Harvard Business School (HBS); TIP Strategies. Note: The cluster methodology developed at HBS has been adjusted by TIP Strategies to align with the six-digit NAICS classifications used by Emsi. STRATEGIES AND ACTIONS 2C.1. SIMPLY SUSTAINABLE STRATEGIC PLAN. Denton’s Simply Sustainable strategic plan from 2012 was ahead of its time and offered a blueprint for improving the City’s sustainability. Integrating economic development efforts with those goals can strengthen Denton’s environmentally conscious identity and attract investments aligned with environmental priorities. This plan is not meant to replace other sustainability efforts from the City but is intended to draw attention to areas where the Economic Development Department can support and build on the City’s existing sustainability strategies. 2C.1.1. Prioritize the energy efficiency and conservation goal from the Simply Sustainable plan by focusing on building standards and incentives for greener residential and business development. ►Explore options for putting this priority into practice, such as creating a green incentive fund, dedicating part of an existing fund, or establishing a point system for the award of incentives. 2C.1.2. Work with DME and the City’s Development Services Department to better understand green building standards, including what is currently required of developers. ►Continue to incorporate leadership in energy and environmental design (LEED) certification and environmentally beneficial activities into incentive policies and development standards. ►Develop tiers of building standards that will promote sustainability and can be opted into by developers who want to build more environmentally friendly buildings. 2C.1.3. Build a more robust set of incentives to encourage developers to adopt green building standards. More incentives should be offered for developments that meet higher tiers of standards. ►Strengthen the commercial incentives currently offered by DME by offering stronger incentives differentiated by different levels of energy efficiency. SUSTAINABILITY Number of jobs in the DFW metropolitan area: 265,586 Percent of jobs in the DFW metropolitan area: 6.7% ENGINEERING SERVICES GENERAL CONTRACTORS SPECIALTY CONTRACTORS DEVELOPERS ALTERNATIVE ELECTRIC POWER ELECTRIC POWER DISTRIBUTION WATER PROCESSING WATER, SEWAGE, AND OTHER SYSTEMS WATER AND SEWER LINE DISTRIBUTION SANITARY SERVICES SUSTAINABLE DENTON STRATEGIES 115 31 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS ►Collaborate with the City’s Development Services Department in adding structural incentives for green buildings, such as expedited review/permitting processes and density bonuses. ►Reduce or reimburse fees for developments that follow green building standards. Examples of fees include review/permitting fees and impact fees. This might require setting aside funds for fee reduction/reimbursement. 2C.2. TARGET ENVIRONMENTALLY CONSCIOUS BUSINESSES. Denton has an opportunity to target environmentally conscious businesses that are attracted to the community’s sustainability and conservation efforts. The community’s commitment to and actions toward sustainability will make Denton a national, and even global, leader in sustainable growth and green development. 2C.2.1. Identify businesses that are high electricity users, such as data centers. DME’s competitive rates and the ability to power businesses using 100 percent renewables is a good marketing opportunity for both the company and for Denton. ►While data centers do not bring many jobs to a community, they consume vast amounts of electricity, which will provide Denton with additional revenue. Global innovation is focused on making data centers more energy efficient, and Denton can be on the cutting edge of this movement because of its renewable resources. ►According to a CBRE US Data Center Trends report, the DFW Metroplex was the second fastest-growing market for data centers in 2019. Low utility costs, ease of transportation access, incentives, and safe climate conditions make DFW an ideal location for data centers. 2C.2.2. Provide technical assistance to developers and businesses that want to leverage federal incentives, such as the Business Energy Investment Tax Credit, or obtain LEED certification. 2C.2.3. Network with regional and statewide organizations focused on clean energy, municipal utilities, and data centers to understand trends and develop relationships with industry leaders. 2C.2.4. Connect with real estate developers and site selectors who have experience supporting environmentally conscious firms or industries that would benefit from renewable energy. ►For example, there are data center operators and developers who specialize in data center development. Example firms include Edgecore Networks, Aligned Energy, and CBRE’s Data Center Solutions group. The City should develop relationships with these firms and pitch Denton’s value proposition for data centers, including low utility rates, 100 percent renewable energy, and other incentives offered to businesses seeking to expand or relocate to Denton. ►Denton should also build stronger relationships with site selectors, both general and those specializing in specific industries. The list of related industries and sectors provided earlier in this section provides a starting point. It is worth noting that priority relocation and attraction factors still include land availability, low utility rates, access to skilled labor, and easy logistics. Denton’s renewable energy is a value-add but should not be relied on alone to drive site selection and relocation decisions. ENERGY EFFICIENT DATA CENTERS “More and more IT companies are boasting of their commitment to achieving 100 percent reliance on renewable energy. To fulfil such pledges, some of the biggest are building their own energy campuses… More often, the data titans sign contracts to receive dedicated supply from existing wind and solar farms. In the U.S., those can still be hard to come by.” —Fred Pearce, “Energy Hogs: Can World’s Huge Data Centers Be Made MoreEfficient?” Yale Environment 360. SUSTAINABLE DENTON STRATEGIES 116 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 32 2C.3. THINK GLOBAL, ACT LOCAL. In 2015, the United Nations Member States adopted 17 Sustainable Development Goals (SDGs). The SDGs create a vision for economic prosperity, sustainability, and equity that is shared by many cities around the world, including Denton. The City’s leaders have an opportunity to think global and act local by adopting several SDGs focused on sustainability and economic growth. 2C.3.1. Adopt the SDGs as part of the City’s work plan and formally make them a priority for the City of Denton through Council approval. The four SDGs most related to Denton’s sustainability and economic development efforts are highlighted here. ►SDG 7: AFFORDABLE AND CLEAN ENERGY. Ensure access to affordable, reliable, sustainable, and modern energy for all. ►SDG 8: DECENT WORK AND ECONOMIC GROWTH. Promote sustained, inclusive, and sustainable economic growth, full and productive employment, and decent work for all. ►SDG 9: INDUSTRY, INNOVATION, AND INFRASTRUCTURE. Build resilient infrastructure, promote inclusive and sustainable industrialization, and foster innovation. ►SDG 11: SUSTAINABLE CITIES AND COMMUNITIES. Make cities and human settlements inclusive, safe, resilient, and sustainable. 2C.3.2. Align performance metrics with the targets and indicators associated with each SDG. Not all targets will be directly applicable, so Denton can also set its own targets aligned to the SDGs. See the “Strategic Performance Metrics” section for more details. 2C.4. GREEN MARKETING. Denton should be commended for the ambitious sustainability goals and significant progress toward those goals. These sustainability efforts should not be distinct from the City’s economic development activities. With better marketing of Denton’s sustainability as a business advantage, the City can achieve both its environmental and economic ambitions. See the “Marketing” section for more details. 2C.4.1. Incorporate Denton’s Green Business Program in economic development digital marketing. The program can benefit from more targeted promotion to the business community. ►Add an annual award or appreciation period for Denton’s most sustainable and energy efficient businesses. ►Promote the Green Business Program during BRE visits and include information on participation in the City’s database of existing businesses. 2C.4.2. Revise digital marketing materials to include a greater focus on Denton’s sustainability goals and 100 percent renewable energy resources. ►According to the Sierra Club, over 150 US cities have committed to 100 percent renewable electricity for their entire communities. Fewer than 10 cities have already achieved this milestone, and soon Denton will be in that elite group. This should be promoted widely and used as a focal point in economic development materials. ►Create more specific resources to target companies in the clean energy sector and include information on incentives for those companies to relocate or expand to Denton. 2C.4.3. Cultivate relationships with regional and statewide clean energy networks. Treat these networks as a channel for promoting Sustainable Denton as well as furthering business attraction efforts. SUSTAINABLE DENTON STRATEGIES 117 33 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS Figure 4. UNITED NATIONS SUSTAINABLE DEVELOPMENT GOALS Source: United Nations, Sustainable Development Goals Knowledge Platform. SUSTAINABLE DENTON STRATEGIES 118 34 PROGRAM OUTCOMES (2019) ►Since its inception in 2017, EEIA has supported six to seven startups per cohort. ►EPI has hosted three international summits and conferences focused on sustainable energy. ►San Antonio-based EEIA member, Terra Solar, won $50,000 in the Department of Energy’s 2020 American-Made Solar Prize. ►University of Texas at San Antonio Leaptran won a Smart 50 Award for its energy monitoring and control system for buildings in 2019. TAKEAWAYS FOR DENTON ►Municipal utilities can support economic development efforts in a variety of ways beyond providing utilities. ►DME can play a central role in facilitating green energy innovation in Denton, especially as the City reaches its 100 percent renewable resource goal. ►The combination of Denton’s entrepreneurial scene and broader sustainability goals makes Denton a prime location for clean tech and green energy startups. BACKGROUND Cofounded in 2015 by CPS Energy (San Antonio’s municipal electric utility company) and three energy technology companies (OCI Solar Power, Itron and Landis+Gyr), EPI (EPIcenter) is a nonprofit innovation hub focused on sustainable energy research with a local, national, and global perspective. EPI advances the industry through the EEIA (EPI Energy Incubator and Accelerator) program, advisory services, and networking events and conferences. EEIA’s mission is to support early-stage startups with commercially viable technologies and services related to sustainable energy innovation. EEIA matches startups with mentors and subject matter experts to help create and refine business plans as well as connect to the funding, legal, and capital sources needed to achieve commercialization and financial sustainability. EEIA also offers tiered membership for businesses and entrepreneurs who are looking for select services or virtual support. EPICENTER SAN ANTONIO, TX www.epicenterus.org SUSTAINABLE DENTON CASE STUDY 119 35 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2D. COMPETITIVE DENTON THE VALUE Planned developments and improved infrastructure will continue to elevate Denton as a vibrant economic node in the DFW Metroplex. Denton already has unique assets in its universities, hospital systems, and authentic town square that make it stand apart from other DFW communities. As new housing developments and transportation improvements are made over the next 10 years, Denton will be in a more competitive position for business development and talent attraction. THE ANCHORS Denton’s strong hospital systems draw visitors to the City to receive vital medical services. These hospitals provide a fundamental service for the entire county and contribute significant tax revenue for the City of Denton both directly and indirectly. Furthermore, the A-train rail service and bus system operated by the Denton County Transportation Authority (DCTA) provide critical transit infrastructure that many other DFW communities lack. Leveraging these anchors for future development is crucial for Denton’s long-term growth. THE ECOSYSTEM Numerous recent and planned developments are raising Denton’s profile and will position the community for more business investment and new residents. Most notably, the Cole and Hunter Ranch development off I-35W will alter Denton’s profile for the better and make the City a formidable competitor for DFW businesses and talent. Facilitating the success of these developments, continuing to incentivize downtown growth, and improving vital infrastructure will lay the groundwork for Denton’s long-term vitality. Photo by Annie Spratt via Unsplash 120 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 36 ANCHOR INSTITUTIONS ►Medical City Denton ►Texas Health Presbyterian Hospital Dallas ►Denton County Transportation Authority ►University of North Texas ►Texas Woman’s University ►North Central Texas College DENTON’S GROWTH ECOSYSTEM COMPETITIONS & EVENTS ►NTCAR Commercial Real Estate Expo ►Dallas Regional Chamber Annual Meeting ►Fort Worth Chamber of Commerce Annual Meeting LOCAL CAPITAL ►Downtown Denton TIRZ ►EDP Investment Fund BUILDING BLOCKS ►Denton Chamber of Commerce ►Denton Black Chamber of Commerce ►Commercial Real Estate Development Association EMERGING PARTICIPANTS ►Hillwood Communities ►Stratford Land ►Allegiance Hillview ►Denton Main Street Association PUBLIC AWARENESS ►Development Magazine ►Texas Hospitals ►BOMA Magazine COMPETITIVE DENTON ECOSYSTEM 121 37 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS RELATED INDUSTRIES AND SECTORS With the Hunter Ranch and Cole Ranch developments, Denton is poised for a major expansion of both residents and jobs. To be competitive, Denton must capture an adequate share of DFW’s growth in areas such as higher education, healthcare, and office campuses. Representative EDA clusters include the following. Sources: US Bureau of Labor Statistics; Emsi 2020.1—QCEW Employees, Non-QCEW Employees, and Self-Employed; US Economic Development Administration; Institute for Strategy and Competitiveness at Harvard Business School (HBS); TIP Strategies. Note: The cluster methodology developed at HBS has been adjusted by TIP Strategies to align with the six-digit NAICS classifications used by Emsi. STRATEGIES AND ACTIONS 2D.1. COLE AND HUNTER RANCH. Denton City Council’s approval of the Cole and Hunter Ranch development will bring significant change to Denton. The addition of new homes, an employment center, retail amenities, and greenways stretched across 6,400 acres will transform Denton into a major economic hub. The development also opens the potential for more industrial and commercial development, especially south of the airport. 2D.1.1. Dedicate staff resources to supporting Hillwood and Stratford in making the Cole and Hunter Ranch vision come to fruition. 2D.1.2. Provide concierge services to help the developers navigate processes across City departments and solve challenges that arise. 2D.1.3. Continue to work with Hillwood and Stratford to ensure that a mix of housing options, from high-density to low-density, are built to increase the diversity in Denton’s housing stock. ►The development will bring higher-end housing options that are necessary to attracting and retaining many high- paying jobs and professional talent. ►The City can work with Hillwood and Stratford to ensure that a mix of commercial, industrial, and retail opportunities unfold as planned. The developers already have a master plan for the development; therefore, the City should continue to work with them, maintain flexibility as issues arise, and help resolve challenges in a timely manner to not delay development. 2D.2. DOWNTOWN DEVELOPMENT. Successful downtown development and an authentic town square are among Denton’s top economic development achievements. The City should continue to prioritize the downtown area by incentivizing residential and commercial development beyond the square. 2D.2.1. Sustain implementation of the City’s Downtown Implementation Plan adopted in 2010. CORPORATE HEADQUARTERS FINANCIAL / CREDIT INTERMEDIATION SERVICES INSURANCE CARRIERS COLLEGES, UNIVERSITIES, PROFESSIONAL SCHOOLS HOSPITALS COMPETITIVENESS Number of jobs in the DFW metropolitan area: 504,819 Percent of jobs in the DFW metropolitan area: 12.8% HEALTHCARE PROVIDERS COMPETITIVE DENTON STRATEGIES 122 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 38 ►The plan’s recommendations to create more mixed use, pedestrian-friendly development extending off the downtown square are still essential to Denton’s success. 2D.2.2. Continue utilizing various tools (development incentives, Chapter 380 agreements, TIRZ financing, and historic tax exemptions) to stimulate new private investment in the downtown. ►Some communities offer incentives to developers in order to build developments aligned with the goals of the cities. Incentives for developers often come in the form of fee reimbursements, density bonuses, expedited processing, and other rebates. Developer incentives are commonly used to stimulate development of affordable housing (or mixed-income housing in dense areas) as well as energy- efficient buildings. 2D.2.3. Prioritize development of additional residential and commercial office space in downtown Denton, especially the corridors extending off the square. ►It is important to incentivize the location of new industrial businesses and the relocation of existing industrial businesses to Westpark Industrial Park so that downtown Denton can be more pedestrian friendly and accommodate nonindustrial companies. ►Though the downtown square is thriving, more focus on the corridors extending off the square will help transform downtown Denton into a thriving residential and commercial district. 2D.3. PROFESSIONAL OFFICE SPACE. Denton’s lack of professional office spaces poses a barrier to the growth of existing companies as well as the attraction of larger professional services firm. To boost Denton’s competitiveness for business investment, the City must incentivize the development of office spaces. 2D.3.1. Promote the development of Class A buildings for office space and creative redevelopment of existing structures to attract professional services and tech-oriented companies. ►The City could utilize a Chapter 380 agreement to incentive the development of new or refurbished office space in the downtown for small businesses and entrepreneurs. ►Alternatively, the City might apply for a grant from the US EDA to support the public infrastructure needed for a development project. ►Ensure that new Class A building office space is developed as planned in the Cole and Hunter Ranch developments to create a new employment center for Denton. 2D.3.2. Utilize financial incentives to support the development of new or refurbished office space. ►For example, Sugar Land, Texas, created an incentive focused on Class A building development. The existing incentives (e.g., grants, loans, tax abatements) to real estate developers who create new Class A building office space according to a range of guidelines. 2D.3.3. Strengthen relationships with the regional real estate development and brokerage community by hosting quarterly or annual meetings with DFW real estate professional and trade associations. 2D.4. INFRASTRUCTURE. As Denton continues to grow, the need for its infrastructure to keep up is paramount. The City’s Economic Development Department team should work with the City’s Development Services Department in prioritizing improvements that will provide the most return on investment and catalyze other transformational projects. 2D.4.1. Extend basic infrastructure to north Denton around Loop 288 to lay the groundwork for future residential and commercial development after TxDOT completes reconstruction of the loop. 2D.4.2. Improve the aesthetics and accessibility of main corridors leading into the downtown square. Dallas Drive and Fort Worth Drive are the main entrances from I-35 into the City core. COMPETITIVE DENTON STRATEGIES 123 39 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 2D.4.3. Launch a Denton Fiber initiative to expand broadband connectivity and access to all businesses and residents. ►Work with all broadband internet providers in Denton to create an initiative under one brand as a tool to attract technology companies, investors, and talent. ►Develop procedures and requirements for the installation of 5G infrastructure in new developments to prepare Denton for future technology. ►Close the digital divide by targeting resources to expand internet access for Denton residents. As seen in Figure 5, a larger share of Denton’s residents lacks broadband internet at home compared to surrounding communities. ►Explore building a municipally owned broadband network and leasing it to internet service providers to incentivize last-mile services to residents in low- and moderate- income neighborhoods. ►The City can also apply for an EDA grant to help cover infrastructure costs associated with an initiative to expand broadband connectivity in Denton. 2D.5. DIGITAL MARKETING. One of the most common challenges cited by stakeholders is the ability to tell the “Denton story” in a way that fully captures the City’s advantages and leverages modern communications platforms. Digital marketing resources are necessary for a modernized economic development program. 2D.5.1. Refresh the Denton EDP website so that it serves as the City’s primary online portal for economic development prospects, site location consultants, commercial real estate brokers, and other business decision-makers. The new sites should include features and information such as the following. ►The City’s specific functions related to economic development (e.g., incentive programs, economic development initiatives, staff directory). Figure 5. BROADBAND CONNECTIVITY IN DENTON SHARE OF HOUSEHOLDS WITH ACCESS TO BROADBAND INTERNET AT HOME Sources: American Community Survey, 2018 5-year sample; TIP Strategies. COMPETITIVE DENTON STRATEGIES 124 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 40 ►Focus on providing relevant details highlighting what makes Denton competitive for investment and talent in its strategic growth areas. ►Present in-depth profiles and descriptions of local and regional workforce strengths. ►Include testimonials from business leaders about why Denton is a great place to do business. This information can be captured during BRE visits. 2D.5.2. Establish a digital marketing campaign to highlight Denton’s economic development advantages and success stories. Develop baseline digital marketing tools and engage in regular digital marketing activities, including the following. ►Infographics created to visually highlight Denton’s core assets and advantages. ►Periodic LinkedIn Pulse articles that describe Denton’s competitive business advantages, using interviews with existing businesses to tell their story. ►Weekly Facebook, LinkedIn, and Twitter posts linking to the Pulse article. ►Short YouTube videos created to highlight what makes Denton a great community for businesses and residents. These videos can also be aired on Denton Television. 2D.5.3. Collaborate with the Denton Chamber of Commerce to create digital materials aimed at commercial real estate brokers, describing the attractive environment for business relocation. ►Use the material to teach local brokers about the top selling points of Denton and why it stands out compared with the rest of the DFW Metroplex. COMPETITIVE DENTON STRATEGIES 125 41 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS TAKEAWAYS FOR DENTON ►Leverage DME’s workforce and capabilities to lay the foundation for advanced technology benefitting both residents and businesses. ►Create an inclusive and affordable broadband network for residents and businesses to enable growth and prosperity. ►Market Denton as a technologically advanced and inclusive community to attract new residents and drive business investment in the city. BACKGROUND In the last half of the twentieth century, Chattanooga was a city in decline. Many residents did not have access to broadband services, and talent was fleeing in search of better opportunities. TEC (The Enterprise Center), a nonprofit public- private partnership, was created and tasked with growing a high-tech ecosystem in Chattanooga and improving its citizens’ lives through technology. To minimize power outages and create a smart grid for the city, EPB (Chattanooga’s municipal electric utility company) began to update its electrical grid with fiber optic cables. EPB and city officials realized that universal access to fiber could also slow the outflow of talent and attract businesses. Since then, TEC has prioritized research and development of the smart grid by connecting EPB and the University of Tennessee at Chattanooga with organizations across the nation. In 2019, EPB remains the only provider in the nation to offer residential 10-gigabit internet service. EPB’s territory extends over 600 miles and includes more than 100,000 customers for its telecom services.PROGRAM OUTCOMES (2019) ►In 2009, EPB received $111 million from the US Department of Energy to build its fiber network. ►Between 2011 and 2016, almost 4,000 jobs were created or maintained in Hamilton County, Tennessee. Chattanooga generated nearly $1 billion as a direct result of its fiber optic network. ►Having the fastest internet connection in the nation has attracted major businesses (e.g., Volkswagen and Amazon), startups and investors, and led to the creation of an Innovation District. GIG CITY CHATTANOOGA, TN www.chattanoogagig.com COMPETITIVE DENTON CASE STUDY 126 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 42 GOAL 3 STRENGTHEN COMMUNITY INCLUSION Many in the economic development field are beginning to recognize the importance of inclusive economic growth to provide opportunity for all residents, particularly those with lower incomes or levels of educational attainment. An economic development strategic plan that does not address how to deliver broader prosperity to all constituents would be shortsighted. This is especially imperative for Denton, which has a larger share of low- income residents than its peers. The median household income in Denton is $56,500, falling below the overall median household income in Denton County of $83,400 (American Community Survey, 2018 5-year sample). Efforts to grow Denton’s existing industries and attract new business investment will not guarantee that Denton’s vulnerable communities will be able to share in this prosperity. Denton cannot afford to leave existing residents behind. Addressing the challenges and barriers that low- and moderate-income residents face will be crucial to creating a more economically vibrant and resilient community. The City’s Economic Development Department and Community Development Department teams already recognize this reality and are collaborating on efforts to expand affordable housing in Denton. This collaboration should be expanded on and integrated with workforce development priorities. Expanding affordable housing options and building career pathways in high-demand industries are two central ways that the City can align its economic, workforce, and community development efforts to benefit Denton’s most vulnerable residents. STRATEGIES AND ACTIONS 3.1. WORKFORCE COLLABORATIVE. Successful communities across the US are focused on aligning the needs of businesses and creating workforce pathways for residents. Denton should convene businesses, training providers, and nonprofits to work together in creating meaningful career pathways in critical sectors. 3.1.1. Build off the workforce collaborative, detailed in Strategy 1.4, to focus on workforce needs during the period of economic recovery. ►Convening a workforce collaborative should be an ongoing task of the City’s Economic Development Department team. ►Connect any efforts of a Denton-specific workforce collaborative to the work of the DCWSLT focused on the ALICE population. 3.1.2. Continue to convene regular meetings with major employers, Workforce Solutions, NCTC, and other providers to identify business needs and connect unemployed residents to jobs. Align economic, workforce, and community development efforts to meet critical community needs and to strengthen community inclusion. 127 43 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS ►Considering COVID-19, the immediate focus should be on supporting unemployed residents in connecting to jobs or reskilling them for new opportunities. 3.1.3. Over the long term, identify two to three occupations and/or skills that are critical to Denton employers and develop pathways to support residents in moving into those roles. 3.1.4. Organize the collaborative around sharing data, coordinating demand and supply, aligning efforts to build talent pipeline, and streamlining BRE efforts. 3.2. HOUSING AFFORDABILITY. In addition to needing higher-end housing options (see Appendix A for more details), Denton also has a housing affordability issue. Compared to surrounding cities, Denton has a larger share of high-need populations. City leaders must address the needs of low- and moderate-income residents to ensure that Denton’s growth is equitable and inclusive. 3.2.1. Continue to collaborate with the City’s Community Development Department in supporting the development or redevelopment of affordable housing in south and east Denton. 3.2.2. Preserve existing housing by offering financial assistance for repairs or retrofitting to maintain naturally occurring affordable housing. ►Work with community development organizations to leverage and scale up existing programs (versus creating new ones). ►Coordinate with the organizations and individuals preparing the City’s affordable housing strategic plan to identify the best approach. 3.2.3. Leverage the federal Opportunity Zones incentive and New Markets Tax Credit to support the development of valuable projects that will support the needs of existing residents. ►Work with the Community Development Department and community organizations to identify projects that need access to capital and can add value to under-resourced neighborhoods. ►Identify specific projects that would benefit the community and pitch the projects to investors in the DFW area with Opportunity Funds. ►Offer financial and other incentives to facilitate the development of these projects. Utilize community development block grants and other economic development grants as well as support through City processes. ►Seek philanthropic funding to support project finances in order to reduce risk for developers and make affordable housing projects more financially feasible. 3.2.4. Identify opportunities for adaptive reuse of existing buildings that can be converted into multiunit housing and preserve existing structures and utility connections. 3.2.5. Improve the development review process to decrease costs for those committed to building workforce and affordable housing. ►Expedited reviews, fee reimbursements, and preapproved plans at low or no cost are best practices used by other communities. TALENT-DRIVEN ECONOMIC DEVELOPMENT PRIORITIES 1. “Realign state economic development spend to invest in proven training solutions, such as customized job training grants and community college partnerships. 2. Target economic development incentives towards opportunity-rich business practices that help build local talent pipelines. 3. Develop and disseminate new skills-based hiring tools that facilitate more efficient and equitable hiring practices. 4. Test new local talent financing solutions, such as revolving loan funds, that target training toward high-demand jobs. 5. Experiment with new regional Talent Exchange intermediaries that connect middle schools, high schools, community colleges, higher education institutions, and in-demand skills providers with businesses in key growth sectors.” —Joseph Parilla and Sifan Liu, Talent-Driven Economic Development: A New Vision and Agenda for Regional and State Economies, Brookings Institution, 2019. GOAL 3 STRATEGIES 128 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 44 3.3. GROW YOUR OWN TALENT INITIATIVE. One of Denton’s top assets is the young talent and energy that the City possesses, due in part to the presence of multiple universities. Over 58 percent of Denton’s population is below the age of 35. By strengthening youth programs and retaining more graduates, Denton can significantly strengthen its talent pipeline and competitiveness for business investment. 3.3.1. Support youth entrepreneurship programs at the local level to foster a culture of innovation and cultivate an entrepreneurial spirit. ►Support could include promotion of activities, programs, and events; financial sponsorships; or participation in the event and/or planning. ►Entrepreneurship education is significant for helping low- income youth to develop skills and knowledge that will support their future success and benefit their communities. ►The National Consortium for Entrepreneurship Education provides resources and technical assistance for entrepreneurial education (http://www.entre-ed.org). 3.3.2. Encourage Denton ISD to incorporate entrepreneurship into academic curricula and increase exposure and access to Denton’s startups. 3.3.3. Gather data from UNT, TWU, and NCTC about graduates, including how many students stay in Denton and the DFW Metroplex versus relocating to other parts of the state or country. ►Identify programs or departments that produce graduates in industries and sectors related to Denton’s strategic growth areas. ►Enhance student connections to the Denton community and businesses by creating internship opportunities, showcasing Denton businesses on campus, and targeting digital marketing for some events and programs to students. GOAL 3 STRATEGIES 129 CAPACITY AND RESOURCES 45 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS130 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 46 Denton’s ability to successfully modernize its economic development programs and implement this plan will depend on a revised approach to its governance and funding mechanisms for economic development. Additionally, the City will require more robust customer relationship management (CRM) systems to track leads and manage information about Denton’s businesses. This section describes considerations for Denton’s capacity and resources to carry out a modernized economic development approach. Recommendations and considerations are provided related to Denton’s EDP, funding resources for short- term economic recovery and long-term success, and internal systems for the City. ECONOMIC DEVELOPMENT PARTNERSHIP The Denton EDP was created in 1987 to formalize shared economic development responsibilities and functions between the City and the Denton Chamber of Commerce. One of TIP’s primary recommendations in the 2003 economic development strategic plan was to create the EDPB to oversee activities of both the City and the chamber. Since then, the EDPB has grown to include representatives from the public and private sectors, anchor institutions, and major constituencies across Denton. The goals and mission of the EDP remain relevant and appropriate for Denton’s economic development efforts. As Denton navigates economic recovery from the COVID-19 pandemic, the EDP will play a critical role in supporting businesses and residents. The economic fallout will be too great for individual organizations and entities to manage alone. It is pivotal that the EDP coordinates efforts to accelerate recovery. Once Denton’s economy recovers from the COVID-19 effects, the EDP will play a leading role in fostering growth and capitalizing on planned investments, such as the Cole and Hunter Ranch development. It will be more necessary than ever to have a high-functioning EDP that can be aggressive, targeted, and strategic in its approach to economic development. Figure 6 provides an overview of the EDP governance structure. Recommendations for the EDP structure include three changes. 1. Creating a partners working group with staff to coordinate core economic development activities. 2. Aligning representation on the EDPB with priorities and strategic growth areas outlined in this plan. 3. Changing the EDPB’s meeting cadence to a quarterly, rather than monthly, basis. Figure 6. ECONOMIC DEVELOPMENT PARTNERSHIP STRUCTURE PARTNERS WORKING GROUP EDP BOARD Membership City, Chamber, DME staff, EDPB Chair or Vice-Chair Broad group of stakeholders Meeting Frequency Monthly Quarterly Purpose Coordinate economic development tasks and activities with a focus on prospect generation, business attraction, BRE, and marketing. Make strategic decisions related to Denton’s economic development goals and the resources necessary to meeting those goals. To facilitate closer coordination, the EDP needs a smaller working group, including primary partners who can manage day-to-day economic development activities. ►This working group should be comprised of staff from the City, the chamber, and the DME. Regular participation from the EDPB chair and/or vice-chair should be included to bridge between the working group and full EDPB. ►Monthly meetings of the partners working group will provide a regular cadence of check-ins about prospects and progress toward implementing the strategies and actions in this plan. A more focused and strategic EDPB should be revised to include representatives from critical sectors and organizations in Denton aligned to the strategies outlined in this plan. ►EDPB meetings should be shifted to a quarterly schedule and focused on Denton’s broad economic development goals and the resources necessary to meeting those goals. ►The current size of the EDPB should be maintained, but seats on the board should be revised to include new representation from the following sectors and functions. ►Denton Municipal Electric ►Entrepreneurship and/or technology ►Workforce development ►Community development ►Marketing and/or tourism 131 47 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS ►Additionally, the EDPB should explore using informal, ad hoc task forces (as needed) to advance work around significant issues like COVID-19 economic recovery and workforce development. FUNDING One of the reasons why Texas is one of the most economically competitive states in the country is a statewide policy allowing local communities to dedicate a portion of their sales tax to fund economic development corporations (EDCs). Communities across the state utilize Type A (focused on industrial development) or Type B (focused on industrial development, parks, museums, sports facilities, and affordable housing) EDCs in order to fund economic development projects. As evidenced in Figure 7, many of Denton’s surrounding neighbors dedicate resources toward economic development in this way. Denton has elected to dedicate its sales tax resources to the DCTA rather than create an EDC. With a sizeable portion of the City’s land off the tax rolls, most of the City’s total revenue comes from sales tax and property taxes from a smaller group of businesses and households. Denton needs to find creative ways to increase the level of resources dedicated to economic development efforts. Successful implementation of this strategic plan will demand increased investment. ECONOMIC RECOVERY AND RELIEF In the short term, Denton’s resources should be focused on providing relief to and accelerating recovery for business and residents. This can be challenging for many communities, as the level of need far exceeds the resources and capacity available. Furthermore, local governments will likely see a decline in their budgets as revenue from sales and other taxes have decreased during the COVID-19 pandemic. Fortunately, Denton County received a large share of the federal 2020 Coronavirus Aid, Relief, and Economic Security (CARES) Act and plans to use $24 million for business support. Communities across the US have implemented a few best practices in supporting economic recovery that might be models for Denton. In addition to the strategies highlighted under Goal 1 Accelerate Recovery, the City should apply for federal stimulus funds, repurpose existing tools, and create public- private initiatives. ►APPLY FOR FEDERAL STIMULUS FUNDS. The EDA allocated $1.5 billion from the CARES Act to supplement existing funds dedicated to the Public Works and Economic Adjustment Assistance programs. These programs provide economically distressed communities and regions with funds to support job creation and retention, innovation, enhanced manufacturing, workforce development, and business investment. Some census tracts within Denton meet economic distress criteria. The City’s Economic Development Department team has already identified potential projects that will benefit important communities and priorities in Denton. Efforts to package a possible grant submission to the EDA should be prioritized, as this is a prime opportunity to leverage federal funds to accelerate economic recovery and to support catalyst projects. ►REPURPOSE EXISTING TOOLS. As Denton businesses start to reopen, it is possible that county-level funds will be enough to meet the needs of the business community. However, as the City continues to develop an understanding of how economic recovery is unfolding, there might be gaps in relief and recovery tools that can be filled by temporarily revising existing tools. For example, the EDP Investment Fund, TIRZ funds, and Chapter 380 grants might need to be repurposed to benefit groups that are unable to access county or federal funds. The City could provide targeted supports by creating more flexibility within existing tools. ►CREATE PUBLIC-PRIVATE INITIATIVES. Some communities have formed a public-private partnership to coordinate resources across organizations, provide technical assistance for businesses applying for federal funds and sharing information about the effects of COVID-19 across their cities. Denton is already doing this to provide rental and residential utility assistance. A more robust example of this is #BhamStrong, a public-private partnership formed in Birmingham, Alabama. The partnership includes local businesses, the United Way, the municipal government, and more. Partners have created a resource directory for businesses and residents seeking relief, financial assistance, and information. While existing resources might be limited for the City, creating an economic relief fund in collaboration with the chamber might be helpful in aiding recovery efforts. Alternatively, repurposing the EDP Investment Fund in the short term to provide relief and recovery aid is another option. The regional economic development group formed with the chamber, Denton County, and other economic development partners could potentially be expanded to play a stronger role in aggregating information, providing technical assistance, and offering other resources during economic recovery. 132 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 48 Figure 7. SALES AND USE TAX ELECTIVES AS OF MARCH 2020 Sources: Texas Comptroller of Public Accounts; TIP Strategies. Note: Larger bubble sizes indicate higher elective rates. 133 49 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS UTILITIES Percentage contribution from utility for economic development activities CITY Incentive rollbacks or earmarked percentage of tax revenue from future developments BUSINESSES Fundraising campaign led by the Denton Chamber to increase private sector engagement DENTON CATALYST FUND DENTON CATALYST FUND Denton’s economic competitiveness over the long term will require more significant investment in economic development. Many strategies outlined in this plan depend on an increased investment in economic development efforts. It is paramount that Denton’s leaders make a strong commitment to increasing resources dedicated to economic development. Figure 8 provides information about the level of resources invested in economic development by some of Denton’s surrounding communities. Many communities in Texas dedicate a portion of their sales tax for economic development. These resources are often funneled through local EDCs that are categorized by the intended use of those funds. Type A EDCs support industrial development projects, such as business infrastructure, manufacturing, research and development, job training, and public transportation. Type B EDCs can support not only all projects eligible for Type A funding but also parks, museums, sports facilities, and affordable housing. Without sales tax election for economic development, Denton’s best course of action is to establish a catalyst fund that can be used not only to provide incentives but also fund specific programs to grow Denton’s economy. Catalyst funds can also be used to support transformational projects or provide seed funding for innovative initiatives. Several successful communities in Texas are turning to similar funds as either an alternative to Type A or Type B EDCs or to supplement the work of their EDCs. Developing a catalyst fund will allow Denton to better meet the strategic objectives and goals of this plan; however, maintaining flexibility in determining how to build resources to meet those goals will be necessary. What is possible and reasonable for other DFW communities might not be for Denton. It is up to Denton’s leaders to determine what level of commitment and investment they should make for economic development. Increasing Denton’s level of investment in economic development will require gradually building resources over time, and the level of resources needed to carry out the City’s strategic goals will likely not be static from year to year. Ultimately, a catalyst fund will provide Denton with more options and mechanisms to better support economic development initiatives and projects aligned with the City’s strategic priorities. A catalyst fund is often comprised of resources from both the public and private sectors. Aggregating resources from several sources not only increases the level of resources available but also builds broad community support for economic development. Typically, contributions to a catalyst fund come from major businesses and institutions as well as public investments from local and/or regional governments. In addition to public and private resources, one of Denton’s greatest untapped assets for economic development is DME. Denton can draw on its utility, public resources, and businesses to create a robust catalyst fund appropriate for modernized economic development efforts (Figure 9). ►UTILITIES. Communities with municipally owned utilities often leverage their utilities to support economic development efforts. Beyond providing competitive rates and supporting incentive packages, some utilities transfer a percentage of utility revenues into a fund dedicated to economic development. This contribution is made on top of revenue transfer into a Figure 8. ECONOMIC DEVELOPMENT CORPORATION REVENUE FOR SELECT- ED DFW CITIES (2019) CITY SALES TAX TYPE TOTAL EDC REVENUE ($ MILLION) Allen Type A $13.5 Type B $11.1 Coppell Type B $13.1 Flower Mound Type B $3.2 Frisco Type A $43.0 Type B $29.6 Grapevine Type B $19.3 Lewisville Type B $9.0 McKinney Type A $16.7 Type B $14.1 Southlake Type A $6.3 Type B $8.0 Source: Texas Comptroller of Public Accounts. Figure 9. RECOMMENDED STRUCTURE FOR A DENTON CATALYST FUND 134 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 50 city’s general fund. In addition to contributing financial resources, a utility can also support economic development through education and workforce development programs that build the talent pipeline for a city’s primary industries. More information about creative uses of municipal utility funds can be found in Appendix C. ►CITY RESOURCES. Cities often contribute resources to an economic development fund that can be used to provide incentives for business attraction or to support economic development programs. There are several ways that cities set aside resources for economic development. The most common way is to fund economic development through a general fund. Alternatively, cities can adopt policies to roll back expired incentives into other economic development efforts. Some communities earmark a portion of anticipated tax revenue from future developments to support economic development. For example, the City could earmark a portion of future tax revenue from the Cole and Hunter Ranch development for an investment in the catalyst fund. This would require consideration by and approval from City Council members. ►BUSINESS INVESTMENT. It is critical that existing businesses continue supporting economic development efforts that will grow Denton’s economy. Successful and effective catalyst funds require significant business engagement in both financial support and participation in economic development efforts, such as business attraction and support for education and workforce development. Existing businesses often invest in a catalyst fund to maximize the effectiveness of their investments in their communities and efforts to improve economic conditions. A business-oriented organization, such as a chamber of commerce, is usually responsible for leading a fundraising campaign and ensuring continued business engagement. These organizations can set up and manage funds more easily than public sector partners. INCENTIVES Cities invest in economic development efforts in many ways. Most cities provide financial and/or operational support for programs and initiatives that support residents and businesses. For example, entrepreneurship and business recruitment programs often receive municipal support. In addition, cities make infrastructure improvements that have a significant effect on growth and development. Marketing, site selection support, and data analysis are also common functions provided by municipal economic development departments. Incentives are also common ways that cities support economic development efforts. They are only one tool used by cities, and there are many types of incentives that can be offered to support economic growth. Figure 10 highlights the portfolio of incentives provided by a select group of DFW communities. Denton already utilizes most incentives used by other cities; therefore, the City should update its incentive policies to align with the goals of this strategic plan in order to continue being competitive in the DFW market. Resources from a catalyst fund should support the development of various incentive funds that will promote the goals and priorities listed in this strategic plan. Currently the City’s primary vehicles for economic development investments are the EDP Investment Fund, the Westpark TIRZ, and the downtown TIRZ. Allocating resources for more targeted incentive funds will allow the City to better support its goals. Figure 11 includes a listing of recommended incentive funds. The City will likely need to adopt a phased approach to building these funds. 135 51 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS Figure 10. ECONOMIC DEVELOPMENT INCENTIVES OFFERED BY SELECTED DFW CITIES ALLENCARROLLTONCOPPELLFARMERS BRANCHFLOWER MOUNDFRISCOGRAPEVINEIRVINGLEWISVILLEMCKINNEYRICHARDSONSOUTHLAKEDENTONJob cash grants Property tax abatements Sales tax rebates/credits ** Fee waivers (impact or permit)* Infrastructure grants Special district financing (TIRZ, TIF, FTZ, PID) Expedited services * Figure 11. PROPOSED INCENTIVE FUNDS FUND PURPOSE GOAL ALIGNMENT DESCRIPTION Business recruitment Multiple goals Fund for recruiting and attracting new businesses to Denton. Business retention and expansion Goal 2A: Connected Denton Fund for the retention and expansion of existing businesses, particularly in the Westpark Industrial Park area. Infrastructure, utilities, and development assistance Goal 2D: Competitive Denton Fund to support major infrastructure and development needs, including broadband connectivity. Job-based grants Multiple goals Grants to businesses based on number of jobs and wages. Innovation and entrepreneurship Goal 2B: Creative Denton Fund to grow and expand Denton’s entrepreneurship ecosystem. Access for historically underutilized businesses (HUBs)Goal 2B: Creative Denton Fund to provide resources to businesses owned by women and people of color in Denton. Green incentives Goal 2C: Sustainable Denton Fund providing incentives to attract environmentally conscious businesses or support greater energy efficiency. Class A office space development Goal 2D: Competitive Denton Fund to incentivize the development of Class A office space, especially in the downtown area. Affordable housing or housing redevelopment Goal 3: Strengthen Community Inclusion Fund to support the City’s affordable housing goals and priorities. *Carrollton only provides sales tax rebates for data centers. Irving provides sales tax rebates for certain retail projects. McKinney provides general permitting and inspection assistance. Denton provides expedited development services for a fee. Acronyms are defined as follows: TIRZ (tax increment reinvestment zone), TIF (tax increment financing), FTZ (foreign trade zone), and PID (public improvement district). Source: TIP Strategies research. 136 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 52 PROGRAMS AND POLICIES The strategies and actions outlined in this plan will require significant changes to the City’s current economic development program; however, it is important to remember that this is a long-term plan intended to be refined and implemented over a 5-year horizon. TIP will provide the City with a detailed implementation matrix with recommendations for how to phase all the strategies and actions in this plan. Figure 12 summarizes potential new programs and policies that will need to be enacted. While this plan has laid the foundation for what the City needs to do, the process to implement the strategies and actions will likely require several additional steps for the Economic Development Department and its partners. A framework for developing new programs and policies for adoption includes the following steps. ►RESEARCH AND ANALYSIS. The City’s Economic Development Department might need to conduct additional research and analysis to provide details for a new program or policy. For example, the development of an edtech alliance (see Strategy 2B.4.2) will likely require additional research about models of similar alliances from which Denton can adopt. Analysis of existing edtech companies in Denton and trends in the edtech sector should also be conducted to inform a new program. ►PARTNER CONVENING. Many of the strategies recommended require the City to work in partnership with other economic and workforce development organizations in Denton and the DFW Metroplex. Where existing partnerships do not yet exist, the City might need to convene potential partners to discuss how the entities can collaborate and for what purpose. For example, the Denton Innovation Group and Stoke could be partners with the City in developing an entrepreneurship knowledge resource network. ►POLICY DEVELOPMENT. Once specific parameters of a new program or fund are identified, the City’s Economic Development Department should draft policies for adoption by the EDPB and the City Council. Not all programs might require formal policy adoption. New incentive funds will likely require new policies to outline fund eligibility and requirements. Figure 12 lists a few policies that might need to be developed or revised in order to meet the strategic goals of this plan. Staff will be able to craft more detailed policies after conducting additional research and gathering information from partners for the specific focus area. ►IMPLEMENTATION. The City can move into an implementation phase once these additional steps have been completed. Again, not all programs or policies will require staff to go through each step. Additional work required to implement new programs and policies will vary based on numerous factors, including the level of resources required, whether there are existing partnerships, and the level of oversight by the EDPB and/or City Council. Implementation is also an iterative process that will require the City to continually refine and improve its strategies and actions. Flexibility is necessary for the City to adapt to changing economic conditions, address challenges in a timely manner, and respond to new opportunities that will emerge. Figure 12. RECOMMENDED NEW PROGRAMS AND POLICIES NEW PROGRAMS NEW OR REVISED POLICIES ►Center of excellence for logistics and supply chain management ►Entrepreneurship knowledge resource network ►Pitch and reverse-pitch competitions ►Startup accelerator ►Edtech alliance ►Broadband connectivity initiative ►Expanded workforce collaborative ►Youth talent initiative ►Eligibility requirements and policies for each incentive fund (Figure 11) ►Adoption of sustainable development goals (SDGs) ►Revision of policies associated with the EDP Investment Fund, Westpark TIRZ, and downtown TIRZ (as needed) MARKETING How a city is perceived—by the public, by visitors, by the media, by corporations, and by site selectors—is crucial to its economic health. This perception can be heavily influenced by marketing programs. The most effective city marketing efforts build on a community’s existing brand and tell authentic stories that highlight local assets. A common theme that emerged from stakeholder input was that Denton needed to do a better job of marketing itself and telling the “Denton story” to a variety of audiences, including prospective residents, business prospects, and visitors. Effective marketing can also foster a greater sense of community and build stronger ties of existing residents to Denton. 137 53 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS While this plan is not meant to serve as a comprehensive marketing assessment, Denton could benefit from refreshed and rebranded marketing. Given the new priorities and focus areas outlined in this strategic plan, the City should conduct a more extensive review of its current marketing efforts, realign marketing to the goals of this plan, and create more sophisticated branding that promotes Denton’s people, businesses, and assets. The City should consider undertaking the following steps to refresh its marketing and branding efforts. ►REGIONAL MARKETING AUDIT. A marketing audit will allow Denton to gain a sense of the image it is projecting. What do people think of when they think of Denton? What is Denton’s current image to different audiences? Marketing audits typically include a review of other organizations’ websites to assess how Denton is conveyed and promoted (if at all) by other economic and workforce development organizations. ►MARKETING PLAN. Based on information gathered through the marketing audit, the City should create a more comprehensive marketing plan that includes new messaging and branding. A marketing plan will help the City determine the kind of image and messaging it wishes to convey to potential residents and businesses. While a stronger marketing plan will be beneficial, TIP has also identified a few strategies in this plan that touch on the need for marketing improvements. ►2B.6. PROMOTING DENTON’S CREATIVE BRAND. Incorporate entrepreneurship into Denton’s marketing. The purpose of this is to both identify specific resources for entrepreneurs and to raise awareness about entrepreneurial success stories in Denton. ►2C.4. GREEN MARKETING. Include Denton’s sustainability goals and successes in the City’s marketing materials. Denton’s leadership in renewable energy and sustainability is a way to distinguish this community from others for both placemaking and economic efforts. ►2D.5 . DIGITAL MARKETING. Lean on more digital channels to communicate the “Denton story” to different audiences. The City can do more to leverage digital platforms to raise awareness about Denton as a desirable place for people and businesses. ►DIGITAL MARKETING MATERIALS. Information from a marketing audit and plan will inform what kinds of information should be included in new digital marketing materials. Modern economic development programs rely on digital marketing materials and social media to communicate to external audiences. Information such as the City’s specific economic development functions (e.g., incentives, initiatives, staff contacts) should still be included. Additionally, the City needs to communicate its specific value proposition for different industries and sectors (i.e., what does Denton offer for entrepreneurs and companies interested in sustainability). Leading examples of high-quality economic development marketing include Tampa Bay EDC, Fairfax County Economic Development Authority, One Columbus, and Thrive in Fort Worth. INTERNAL SYSTEMS In addition to a revised governance structure and increased funding, the City can also benefit from modernizing internal systems to track data and manage information about businesses. Like all business enterprises, the ability to quickly access reliable data is an essential feature of successful economic development organizations. Creating and maintaining well-organized information systems helps facilitate the best decision-making. The City’s Economic Development Department has already made great strides in improving its internal systems over the past few years. As Denton navigates economic recovery and returns to a path of growth, the need for strong systems will be even greater. High-functioning economic development organizations all have organized and centralized information systems that are flexible enough to easily share information with partners. The core systems that the City should invest in and continue to improve include the following. ►DATABASE OF DENTON BUSINESSES. A database of existing businesses is central to BRE efforts. Information gathered about business needs, challenges, and successes should be recorded in the database on a regular basis. It is paramount that this database is up to date so the City can generate timely reports, identify potential warning signs, and make decisions about how to support Denton’s businesses and employers. ►CENTRALIZED PROSPECT/LEAD GENERATION SYSTEM. Having a centralized system to track prospects and leads is crucial so that information (and therefore opportunities) is not lost between partner organizations. Standardized information gathered about prospects should be entered into the system and be used to develop a package for potential businesses. ►RELATIONSHIPS/CONTACTS DATABASE. As the Economic Development Department team builds relationships across the City, the DFW Metroplex, and beyond, maintaining an updated contacts database is vital. As noted throughout the plan, networking with VC firms, entrepreneurship organizations, and regional economic development entities is a central function that the City needs to play. A relationships/contacts database is vital to facilitating that relationship building. 138 ►PROCESS AND POLICY DOCUMENTATION. The City needs a more organized way to document different processes and polices associated with economic development. For example, the process and cadence by which the City conducts BRE visits should be clearly documented for the benefit of current and future staff as well as more consistency in business engagement. Updates to policies should also be documented in a clear and accessible manner for both City staff as well as partners, including the EDPB and the chamber. ►PERFORMANCE MEASUREMENT. Tracking a short set of meaningful metrics is important for evaluating progress toward desired outcomes. The City should establish a mechanism for tracking reporting metrics to the EDPB and the City Council to establish transparency and accountability for achieving economic development goals. Metrics can rally partners around a common vision and standard for progress. Suggested metrics are provided in the next section. ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 54139 STRATEGIC PERFORMANCE METRICS 55 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS140 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 56 A critical component of a successful strategic plan is the set of metrics by which the plan’s implementation is tracked. It is imperative that the EDPB and the City Council focus on a set of strategic metrics to track progress on critical economic outcomes. Staff should create a performance dashboard that can be used to communicate performance metrics to City leadership on a regular basis. This is vital to tracking progress as well as maintaining accountability throughout the implementation of this plan. Figure 13 provides a list of performance metrics that are intended to focus the EDPB and the City Council on high-level strategy and outcomes; however, the City’s staff will also need to identify programmatic and operational metrics to track progress toward program-specific goals. TIP strongly recommends that the City disaggregate metrics by race and ethnicity where possible and that disaggregated data is shared in a transparent manner. Figure 13. RECOMMENDED STRATEGIC PERFORMANCE METRICS GOAL ALIGNMENT LEGEND:Economic Recovery Connected Denton Creative Denton Sustainable Denton Competitive Denton Community Inclusion METRIC DESCRIPTION SOURCE GOAL Unemployment rate Unemployment rate, overall and by gender and race/ethnicity.Texas Workforce Commission Labor force participation Civilian labor force participation rate.US Census Bureau American Community Survey Employment gap Percentage difference in employment rate between white and people of color (ages 16-64).US Census Bureau American Community Survey Retail sales growth Rate of growth or decline in retail sales within Denton. Texas Comptroller Job growth Number of jobs created and retained.Texas Workforce Commission, business surveys, and interviews Vacancy rate Percentage of Westpark Industrial Park area with vacancies. In-house data collection, business surveys, and interviews Startup survival Percentage of startups that are active after 1 year and 5 years. In-house data collection, business surveys, and interviews New business establishments Number of new businesses in Denton and year-to-year growth. In-house data collection, business surveys, and interviews Access to capital Number and dollar value of venture capital, angel investment, or other capital for startups.In-house data collection, business surveys, and interviews Energy competitiveness Electricity cost rate (and comparison to peers).DME Energy efficient businesses Percentage of businesses benefiting from federal energy efficiency tax credits or local rebates.In-house data collection, business surveys, and interviews Downtown retail occupancy Occupancy rate of downtown retail spaces (or vacancy decline).In-house data collection, business surveys, and interviews Downtown housing Increase in downtown housing units over time.In-house data collection, business surveys, and interviews Office space Amount of new office space (square feet) added as well as vacancy rate.Regional commercial real estate brokerage (e.g., Jones Lang LaSalle—JLL) Broadband internet access Percentage of population without access to broadband internet access. US Census Bureau American Community Survey Talent availability Population 25+ with associate’s degree or higher.US Census Bureau American Community Survey Population 25+ with bachelor’s degree or higher.US Census Bureau American Community Survey Cost-burdened households Percentage of households spending more than 30 percent of income on rent or mortgage. US Census Bureau American Community Survey Portion of jobs at a livable wage Percentage of jobs in Denton that pay a living wage (see MIT living wage calculator). Texas Workforce Commission, Massachusetts Institute for Technology 141 APPENDICES 57 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS142 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 58 AppenDix A. DATA FINDINGS ECONOMIC INDICATORS AND DEMOGRAPHICS ►ESTABLISHED AND GROWING INDUSTRIES. The education and healthcare sectors continue to dominate in Denton, together accounting for nearly one-third of total employment in 2019.1 Manufacturing employment has steadily risen in recent years, focused on automobile and related component manufacturing, and has overtaken retail and accommodation/food services as the third largest industry sector in the City. The transportation and warehousing sector has also become a significant source of jobs in Denton since 2017, employing nearly 4,000 workers in 2019.1 These employment trends support the notion that Denton has been successful in strengthening some of its existing target sectors, such as supply chain logistics and advanced manufacturing. ►BUILDING AN INCLUSIVE AND DIVERSE DENTON. Compared to neighboring communities, Denton is racially and ethnically diverse with BIPOC residents accounting for more than 40 percent of the population in 2018.2 Among these, the Hispanic or Latinx population is the largest, representing more than half the non-white population and nearly one-quarter of all residents. Leaders should pay close attention to the developing needs of Denton’s relatively large, BIPOC population in the wake of the COVID-19 crisis in order to promote inclusive economic recovery across racial, ethnic, and socioeconomic groups. ►TRAINING AND RETAINING TALENT. Though the presence of two major higher education institutions can attract economic and research activity and talent, Denton has not been able to retain a workforce as educated as its neighboring communities. Denton is educating a substantial number of workers with potential to enter the labor market.2 However, less than 40 percent of Denton residents 25 and older have a bachelor’s degree or higher, compared to well over 50 percent in neighboring Plano and Frisco.2 This suggests that Denton’s college graduates are leaving the City to work elsewhere, possibly to seek higher wages. Denton’s relatively low household median income is partially attributable to the presence of two large universities, where students tend to have lower incomes, but Denton also lacks a base of moderate-to-high-income households compared to nearby communities—there are about 4,000 households in Denton (<10 percent) with an income over $150,000, compared to about 14,000 in McKinney (about 25 percent) and over 22,000 in Frisco (>40 percent).2 1 US Bureau of Labor Statistics; Emsi 2019.4—QCEW (quarterly census of employment and wages) Employees, Non-QCEW Employees, and Self-Employed. The City of Denton is based on the aggregation of 10 ZIP Codes (76201, 76202, 76203, 76204, 76205, 76206, 76207, 76208, 76209, and 76210). 2 American Community Survey, 2018 5-year sample. HOUSING ►MORE MULTIFAMILY HOUSING. Denton has a larger share of multifamily housing and renters compared to its neighbors, in part because of the student population’s need for short-term housing options. Almost half (47.8 percent) of all housing units in Denton were occupied by renters in 2018, compared to about one-third in Plano and McKinney, respectively, and less than one-quarter in Frisco, Corinth, and Argyle.2 Moreover, multifamily housing accounted for nearly 40 percent of Denton’s housing stock as of 2018, compared to one-third of Plano’s and less than one-quarter of McKinney’s, Frisco’s, Corinth’s, and Argyle’s.2 ►STRADDLING AFFORDABILITY. The median home value and rent in Denton were much lower than the surrounding communities in 2018 (more than half of Denton’s owner-occupied housing was valued under $200,000).2 Relatively lower housing costs than neighboring communities make Denton more attractive for those seeking affordable housing in the northern DFW Metroplex. However, more than one-quarter of Denton homeowner households are cost-burdened (spend more than 30 percent of income on housing)—a higher rate than the surrounding communities with higher housing costs.2 Because Denton household incomes tend to be lower than those in neighboring communities, many households struggle with housing costs even at relatively reduced rates. For instance, suppose a Denton household earning the median income ($56,500) who currently rents at the median monthly rate ($1,046) wants to buy a median-priced home ($196,900).2 Depending on the mortgage terms, monthly payments range from $800 to $1,200.3 While those able to get more favorable loan terms might be able to make payments without financial strain, other households with lower down payments and higher interest rates would likely find the mortgage payment unaffordable. ►HIGHER-VALUE HOUSING. In addition to its affordable housing challenge, Denton also has fewer high-value homes that are often needed to attract professional service businesses. Denton lacks a substantial stock of high- value housing (less than 18 percent of owner-occupied homes were valued over $300,000 in 2018),2 which stakeholders cited as a challenge in recruiting high-paying jobs and professionals to the City. In comparison, over 47 percent of Plano’s and over 67 percent of Frisco’s owner-occupied homes are valued above $300,000. 3 Estimated mortgage payments and associated affordability calculated using a modified version of Texas A&M University Real Estate Center’s Housing Affordability Index. 143 59 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS COMMUTING PATTERNS ►EXCHANGING LABOR IN DFW. In 2017, more than 43,000 Denton residents had jobs outside the City.4 More than half those jobs (22,000) were in nine DFW cities with Dallas and Fort Worth together accounting for over 10,000 jobs. Among those 22,000 jobs, about half earned less than $40,000 annually.4 In contrast, about 39,000 Denton workers who lived outside the City in 2017 had residences spread more evenly across DFW communities (i.e., 30 DFW cities account for about half these workers), and more than two-thirds of these workers (27,000) earned less than $40,000 annually.4 This suggests that the jobs in Denton that attract workers from outside the region tend to be lower-earning positions compared to the jobs many Denton residents seek outside the City. In other words, the commuting story in Denton also reflects the notion that the City might be losing skilled labor to neighboring regions with higher-wage job opportunities. ECONOMIC DEVELOPMENT RESOURCES ►GROWING DIVERSE TAX REVENUE STREAMS. Denton’s tax revenue sources have followed the same general trend between 2009 and 2018; property tax accounts for more than one-third of revenues (averaging 38 percent over 10 years), sales and use tax generate an average of 20 percent, franchise fees at 15 percent, and other sources make up the remaining 25 percent.5 Additionally, the City saw substantial revenue growth in 2017 (11 percent increase) and 2018 (19 percent increase) driven mostly by increased property tax revenues and other sources.5 Denton appears to have more diverse tax revenue sources than neighboring communities that depend more heavily on property and sales and use taxes. ►AN OPPORTUNITY FOR MORE ROBUST ENTREPRENEURSHIP. The DFW Metroplex has received more than $6 billion in capital funding for startups since 2009, and about two-thirds of this capital was invested in Dallas, Plano, and Irving startups.6 Though investors tend to be based in the capital hubs outside the state (nearly half of investment funds are sourced from California, Massachusetts, and New York), Texas accounts for about one- fifth of the funding, with most dollars coming from Dallas investors (>$500 4 LODES (Longitudinal Employer-Household Dynamics’ Origin-Destination Employer Statistics). 5 TIP Strategies analysis of the most recent CAFRs (comprehensive annual financial reports) for Denton and selected DFW communities. Revenue categories are generally consistent across most Texas municipal CAFRs: property taxes, sales and use taxes, and franchise fees. Other revenues is a catchall term for all other taxes and service fees for government and business-type activities. Denton's CAFR specifically notes on page 119 that the electric fund is not shown separately due to confidentiality of information necessary for competitive rates. 6 Investment data from Crunchbase—a crowdsourced data set that is not comprehensive. Analysis of VC funding should be interpreted with this limitation in mind. million).6 Denton’s startups have not received much of this funding ($3.2 million).6 It might benefit the City’s developing entrepreneurial ecosystem to network with VC firms and startups in the DFW Metroplex. 144 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 60 AppenDix B. SWOT ANALYSIS A thorough SWOT analysis of Denton was developed based on direct input from stakeholders through interviews and roundtable discussions. These findings offer insights into areas that can be leveraged or strengthened to support economic growth as well as potential challenges and risks that might impede growth. Areas of the SWOT are defined as follows. ►STRENGTHS: Advantages that can be leveraged and strengthened to bolster economic vitality. ►WEAKNESSES: Challenges and risks to economic development that might stifle growth. ►OPPORTUNITIES: Positive trends and assets that have potential to increase prosperity. ►THREATS: External factors and risks that might negatively affect the local/ regional economy. Though the City has less influence over national and global trends, it can focus on how Denton should respond to those trends and prioritize local/regional opportunities (see Figure 14). The graphics on the subsequent pages summarize the results of the analysis. NATIONAL STATE LOCAL & REGIONAL GLOBAL DE G R E E O F C O N T R O L followtrends shape trends STRENGTHS WEAKNESSES OPPORTUNITIES THREATS Figure 14. SWOT FRAMEWORK 145 61 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS Downtown Convention Center Sustainability Hiking & biking trails Water rights University of North Texas Texas Woman’s University Power generation Unique culture Growing DFW metro Music & arts Land availability Interstates Airport NCTC WorkforceAffordable cost of living Growing tech scene Manufacturing Competitive tax climate Lower cost of living compared to coasts Inmigration growth LOCAL/REGIONALSTATENATIONALGLOBAL Venture capital Innovation capacity Diverse economic base STRENGTHS Denton’s numerous strengths should be leveraged to attract business investment and to develop talent pipelines for the City’s major industries. Certainly, Denton’s higher education assets make it stand out among other DFW communities. A robust arts and culture scene has also attracted students, tourists, and new residents to Denton over the years. Much of this development and growth has centered around Denton’s downtown square. What is less known about Denton is its strong base of transportation and logistics- oriented companies that benefit from the City’s proximity to the intersection of I-35E and I-35W. Denton’s location in the DFW Metroplex is one of its biggest strengths, especially as the DFW Metroplex continues to grow. Furthermore, the community’s commitment to sustainability puts Denton in an elite group of US cities that will rely on 100 percent renewable resources. A strategic focus on these strengths will continue to make Denton an attractive place to live and work. 146 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 62 LOCAL/REGIONAL STATE NATIONAL GLOBAL WEAKNESSES Stakeholder input highlighted housing as one of Denton’s top challenges. Housing—both affordable housing and higher-value homes—is one of the top barriers to Denton’s growth. Compared to its DFW peers, Denton has a higher share of low-income and moderate-income residents who cannot afford to live in Denton. At the same time, Denton’s housing value tends to be lower than that of other communities, making it difficult to attract professional service businesses, medical professionals, and more. Beyond housing, Denton’s lack of resources available for economic development makes it difficult for the City to compete for business investment and talent. The lack of an EDC or fund, along with reduced tax revenue, will require Denton to find creative ways to invest more significantly in its business attraction, retention, and expansion efforts. Lack of affordable housing Equity & inclusion Infrastructure Limited jobs Lack of high-end housing Limited (ED) economic development resources Leadership transitions Town vs. gown No tax base for community colleges No Class A office stock Lack of uniting vision Many non-taxing entities High share of vulnerable populations Corridors into city Retention of graduates Construction costs Reliance on volatile industries (oil & gas) Workforce for skilled trades Talent shortages Aging population Growing income inequality US national debt 147 63 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS LOCAL/REGIONALSTATENATIONALGLOBAL OPPORTUNITIES Denton’s economic future depends on the community’s ability to capitalize on investments already made and opportunities that will come with growth. For example, the City should continue to prioritize downtown development and placemaking to attract businesses and talent. The City’s support of Stoke has led to increased entrepreneurship and a cluster of edtech startups that should be fostered. The biggest opportunity will be the Hunter and Cole Ranch development, which is set to add thousands of new houses, create a new employment center, and improve retail options along I-35W. Cole and Hunter Ranch will also create more possibilities for both industrial and commercial development on the west side of Denton. If the City does nothing else, it should dedicate staff time and resources to ensuring that the original vision for the development is implemented successfully and in a timely manner. Denton Catalyst Fund Leverage higher education assets Golden Triangle Mall redevelopment Telling the “Denton Story” better Utilizing DME funds for economic development Airport expansion Hunter & Cole Ranch Edtech Cluster Logistics hub Downtown development & placemaking Expand tech, R&D, innovation Talent retention Athletic complex Younger workforce Renewable energy Migration from urban areas on the coasts Growing tech sector Economic diversification Opportunity Zones Rise of remote workers Historic preservation tax credits Federal stimulus funds New Market Tax Credits Global sustainable development goals (SDGs) Foreign Direct Investments 148 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 64 LOCAL/REGIONAL STATE NATIONAL GLOBAL THREATS It is necessary to understand threats not in order to control them, but instead to develop a proactive response to factors that are often outside the influence of local and regional organizations. Before COVID-19 became a pandemic, it was a looming threat that had the potential to disrupt every aspect of life. There are other looming threats that can impact Denton soon or over a long horizon. Climate change is a threat to which the City is already developing a response by investing in renewable energy sources. On a smaller scale, threats to Denton’s vitality include outmigration of talent because of a lack of professional opportunities, attractive housing, or amenities. Coupled with aggressive growth in other parts of the DFW Metroplex, the need to develop and retain talent in Denton has never been greater. Many of the recommendations offered throughout this plan are meant to support Denton’s leaders in proactively responding to these threats. Aggressive growth in other DFW communities Higher wages in other DFW cities Outmigration of talent Industries vulnerable to disruption Retention of existing employers & industries Boom/bust cycle of oil & gas industry Inequitable distribution of jobs & opportunity Aggressive business recruitment across US South Aging workforce Economic recession Workforce for skilled trades US political uncertainty Decreased defense spending Disruption in healthcare industry Immigration restrictions (workforce) Trade policy uncertainty COVID-19 Competition with China Fragile global supply chains Cybersecurity threats Climate change 149 65 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS AppenDix C. MUNICIPAL UTILITY COMPARISON Utility Company AE (AUSTIN ENERGY) 2018 CPS (CPS ENERGY) 2019 EPB (2019)CU (CITY UTILITIES) 2019 City Austin, TX San Antonio, TX Chattanooga, TN Springfield, MO City Population 962,469 1,547,253 182,799 167,882 Economic Development Budget $47,261,386 $15,354,284 $8,268,037 $481,989 ED Budget Per Person $49.10 $9.92 $45.23 $2.87 Electricity Customers ~485,000 ~ 820,000 ~170,000 ~111,000 Total Utility Revenue $945,000,000 $2,744,159,000 (includes gas)$741,651,000 $474,126,000 Revenue Transferred to General Fund $109,000,000 (12% of total revenue) $361,351,000 (13% of total revenue) $7,618,000 (1% of total revenue) $14,559,000 (3% of total revenue) Workforce and Education Initiatives ►Energy and education program with eight school districts in its service territory to increase interest in green energy. ►Summer internship program for college-aged students. ►Three paid internship programs for high school juniors and a Corporate College Internship Program. ►New Energy Economy program generated $23M for local schools and created 600 jobs. ►STEP-UP paid summer internship program for high school students. ►EPB Institute of Technology and Networking to prepare students for careers in coding and IT. ►Workforce development program with local high school covering team building, goal setting, conflict resolution, and career exploration. Sustainability Initiatives ►Climate Protection Plan seeks to achieve 100% carbon-free electricity generation by 2035. ►65% renewable energy by 2027. ►AE offers commercial and residential rebates when using smart thermostats and other technologies. ►Solar powers more than 55K homes in the region. ►Cut nitrogen oxide emissions by 75% since 1997. ►Invested in a smart grid for the city and, in 2017, installed the one millionth advanced meter or gas meter-enhancing device, completing 90% of the project. ►EPB-owned fiber optic communications network provides a smart grid for the entire service area. ►$3M Chattanooga Clean Energy for Low Income Communities Accelerator. ►Green and Healthy Homes pilot to reduce childhood asthma through better air quality. ►Since 2006, CU generates electricity from methane gas produced by the city’s landfill. ►CU Solar Farm (powers 902 homes) leased to CU through Purchased Power Agreement with purchase option after 25 years. ►Commercial and residential rebates for adoption of smart technology. 150 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 66 AppenDix D. ECOSYSTEM DIRECTORY CONNECTIVITY Industrial Supply Association www.isapartners.org Institute for Supply Management—Dallas www.ismdallas.org/index.cfm Intermodal Association of North America www.intermodal.org Logistics & Transportation Association of North America www.ltna.org National Industrial Transportation League www.nitl.org Southern Association of Wholesale Distributors the-southern.org Texas Airports Council texasairportscouncil.org Texas Association of Manufacturers manufacturetexas.org Texas Commercial Airports Association www.texas-airports.com Texas Trucking Association www.texastrucking.com Texas Warehouse Association www.texaswarehouseassociation.org Transportation Club of Dallas/Fort Worth www.tcdfw.org TRADE ASSOCIATIONS Design-2-Part Show February 26–27, 2020 | Grapevine, TX www.d2p.com International Conference on Information, Logistics and Supply Chain April 22–24, 2020 | Austin, TX 10times.com/ils-austin Aviation Conference to Focus on Innovation June 11, 2020 | Virtual www.texas-airports.com/p/getinvolved Accelerate! Conference & Expo September 23–25, 2020 | Dallas, TX www.womenintrucking.org/accelerate-conference Heavy Duty Aftermarket Week January 25–28, 2021 | Grapevine, TX www.hdma.org/content/heavy-duty-aftermarket-week-hdaw HOUSTEX February 23–25, 2021 | Houston, TX houstexonline.com RELEVANT CONFERENCES / EVENTS American Shipper americanshipper.com American Trucker www.trucker.com/american-trucker-magazine International Journal of Adv. Manufacturing Technology www.springer.com/engineering/industrial+management/journal/170 Int’l. Journal of Shipping and Transport Logistics www.inderscienceonline.com/loi/ijstl Journal of Commerce www.joc.com Logistics Management www.logisticsmgmt.com Manufacturing Technology Insights www.manufacturingtechnologyinsights.com Supply Chain www.supplychaindigital.com/magazine TRADE PUBLICATIONS Note: Events were correct at the time this document was created. Due to the COVID-19 pandemic, details are subject to change. 151 67 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS CREATIVITY Denton County India Cultural Association www.dcica.org Denton Film Society www.facebook.com/DentonFilmSociety Denton Main Street Association www.dentonmainstreet.org Keep Denton Beautiful kdb.org Master Networks, Denton Chapter www.meetup.com/Master-Networks-Denton-Chapter North Texas State Fair Association www.ntfair.com Stoke stokedenton.com TechMill techmill.co Technology Resource Center of America www.trca.com UNT Murphy Center for Entrepreneurship and Innovation cob.unt.edu/murphycenter TRADE ASSOCIATIONS FlintConf 2020 April 29–May 1, 2020 | Virtual stokedenton.com/events/2020/4/10/flintconf-2020 Business Success Summit May 4–8, 2020 | Virtual www.mnbusinesssuccesssummit.com 1 Million Cups Frisco June 2, 2020 | Virtual www.meetup.com/1-Million-Cups-Frisco/events/skvdrrybcjbfb CONNECT 2020 August 6–8, 2020 | Allen, TX www.attend-connect.com/connect-2020 Techstars Startup Week Waco October 19–22, 2020 | Waco, TX waco.startupweek.co Denton Arts & Jazz Festival April 23–25, 2021 | Denton, TX dentonjazzfest.com DFW Open Data Day TBD 2021 | Frisco, TX www.dfwopendataday.com RELEVANT CONFERENCES / EVENTS Arts and Culture Texas artsandculturetx.com Journal of Innovation and Entrepreneurship innovation-entrepreneurship.springeropen.com Stoke Newsletter stokedenton.com/join-newsletter Techstars Startup Digest www.startupdigest.com Texas Highways texashighways.com Texas Monthly www.texasmonthly.com TRADE PUBLICATIONS Note: Events were correct at the time this document was created. Due to the COVID-19 pandemic, details are subject to change. 152 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS 68 SUSTAINABILITY Conserve North Texas conservenorthtexas.org Environment Texas environmenttexas.org North Texas Association of Environmental Professionals www.ntaep.org North Texas Green Council northtexasgreencouncil.org North Texas Renewable Energy Group www.ntreg.org Society of Texas Environmental Professionals txstep.org Texas Conservation Alliance www.tcatexas.org Texas Municipal Utilities Association tmua.org Texas Public Power Association www.tppa.com Texas Renewable Energy Industries Alliance www.treia.org Texas Solar Energy Society txses.orgtxses.org TRADE ASSOCIATIONS NTAEP Fourth Annual Texas Commission on Environmental Quality (TCEQ) Trade Fair May 12, 2020 | Austin, TX www.ntaep.org/happyhour GRIDNEXT 2020 June 3, 2020 | Houston, TX https://www.treia.org/gridnext-2020-virtual Texas STEP Annual Joint DFW Meeting July 21, 2020 | Grapevine, TX txstep.org/meetings/annual-dfw Regional Centre of Expertise North Texas Symposium September 16, 2020 | Arlington, TX sustainability.uta.edu/rce/events/rce-symposium TMUA Utility Leadership and Management Conference April 28–30, 2021 | Round Rock, TX tmua.org/future-conference-dates RELEVANT CONFERENCES / EVENTS Green Source DFW www.greensourcedfw.org Journal of Renewable and Sustainable Energy aip.scitation.org/journal/rse POWER Magazine www.powermag.com Renewable Energy www.journals.elsevier.com/renewable-energy Utilities Policy www.journals.elsevier.com/utilities-policy Texas Journal of Oil, Gas, and Energy Law tjogel.org The Solar Reflector txses.org/the-solar-reflector TRADE PUBLICATIONS Note: Events were correct at the time this document was created. Due to the COVID-19 pandemic, details are subject to change. 153 69 ECONOMIC DEVELOPMENT STRATEGIC PLAN | CITY OF DENTON, TEXAS COMPETITIVENESS Association of Texas College & University Facilities Professionals www.t-cuf.org BOMA Greater Dallas www.bomadallas.org Career & Technical Association of Texas www.ctat.org NAIOP North Texas www.northtexasnaiop.com National Association of Colleges and Employers www.naceweb.org North Texas Commercial Association of Realtors and Real Estate Professionals www.ntcar.org Texas Association of Healthcare Facilities Management www.tahfm.org Texas Higher Education Human Resources Association www.txhehra.org Texas Hospital Association www.tha.org Texas Medical Association www.texmed.org TRADE ASSOCIATIONS TMA Winter Conference January 29–30, 2021 | Austin, TX www.texmed.org/Winter 2020 NACE Conference + Expo June 2–5, 2020 | Minneapolis, MN www.naceweb.org/conferenceexpo/default.htm 2020 Commercial Real Estate Expo September 9, 2020 | Dallas, TX www.ntcar.org/ntcar-events/2020-expo NTCAR Reunion and Hall of Fame September 22, 2020 | Dallas, TX www.ntcarhalloffame.org THEHRA Summer 2020 October 18–20, 2020 | Galveston, TX www.txhehra.org/conferences.html 2021 TAHFM Annual Conference March 28–31, 2021 | Fort Worth, TX www.tahfm.org/general/custom.asp?page=2020conference RELEVANT CONFERENCES / EVENTS BOMA Magazine www.boma.org/BOMA/Research-Resources Development Magazine www.naiop.org/en/Research-and-Publications/Magazine Texas Hospitals www.tha.org/TexasHospitalsMagazine The American Journal of Medicine www.amjmed.com The Journal of Continuing Higher Education www.tandfonline.com/loi/ujch20 The Journal of Higher Education www.tandfonline.com/loi/uhej20 The Journal of Real Estate Research https://aresjournals.org/loi/rees TRADE PUBLICATIONS Note: Events were correct at the time this document was created. Due to the COVID-19 pandemic, details are subject to change. 154 Economic Development Strategic Plan Implementation Matrix POTENTIAL PARTNERS (lead partner highlighted in bold) 12-18 months 2-3 years 3-5 years Ongoing Current Foundational Aggressive POTENTIAL FUNDING SOURCES 1.1.1. Pull together a small group of top-level leadership from the City, the EDPB, and the Denton Chamber of Commerce to form the “economic recovery nerve center.” City, Chamber, EDPB <City - Economic Development IN-PROGRESS 1.1.2. Shift the focus of the existing economic development structure from relief and policy enforcement to cross-functional elements of economic recovery, such as business retention, workforce development, and community services. City, Chamber, EDPB <City - Economic Development IN-PROGRESS 1.1.3. Develop an internal data dashboard to guide economic recovery efforts using a limited number of indicators that can be tracked over time and shared with partner organizations. City, Chamber, EDPB <City - Economic Development IN-PROGRESS 1.2.1. Continue to coordinate with the Denton Chamber of Commerce and Denton Main Street Association to assess short-term needs and long-term projections for Denton’s businesses. City, Chamber, Main Street Association <City - Economic Development IN-PROGRESS 1.2.2. Stay connected to DFW organizations coordinating economic recovery and community service efforts across the DFW Metroplex. City, Chamber, Denton County <City - Economic Development IN-PROGRESS 1.3.1. Continue to develop and maintain a database of Denton-based businesses. City, Chamber <City - Economic Development Excel or free option $7,500 per year $10,000 for CRM system City General Fund IN-PROGRESS 1.3.2. Shift the City’s business visitation efforts to a virtual setting and establish a cadence of meetings with businesses as soon as appropriate. City <City - Economic Development IN-PROGRESS 1.3.3. Expand existing goals for business touchpoints on a monthly, quarterly, and annual basis. City <City - Economic Development IN-PROGRESS 1.3.4. Reevaluate and adjust standard questions and protocols utilized in the City’s BRE program to be more responsive to the COVID-19 crisis and recovery.City <City - Economic Development IN-PROGRESS 1.3.5. Prioritize business retention efforts based on strategic growth areas (see Goal 2), employer size, employer growth (number of employees, revenue growth, etc.), and lease terminations. City <City - Economic Development IN-PROGRESS 1.3.6. Structure BRE efforts to serve several purposes: educate businesses about resources offered by the City, identify challenges companies are facing, and identify short-term and long-term issues.City <City - Economic Development IN-PROGRESS 1.3.7. Act as a concierge to priority businesses to help navigate processes within other municipal departments (e.g., partner with a project facilitator from the City’s Development Services department).City, Development Services <City - Economic Development INCOMPLETE 1.4.1. Prioritize engagement with the DCWSLT (Denton County Workforce Success Leadership Team) to connect City efforts to the broader regional context. City, DCWSLT, Workforce Solutions <City - Economic Development IN-PROGRESS 1.4.2. Catalog which industries have been severely impacted by COVID-19 and determine if targeted resources can be deployed to support workers in those industries. City, Denton County, Chamber <City - Economic Development INCOMPLETE 1.4.3. Use insights and data from business retention efforts and surveys of the business community as a baseline for employer demand. Couple this information with other data about unemployment rates and the needs of jobseekers. City, Chamber <City - Economic Development IN-PROGRESS 1.4.4. Develop an inventory of training resources across providers, such as NCTC (North Central Texas College), Workforce Solutions for North Central Texas, and United Way. Include capacity levels and flexibility to streamline, redesign, or create new programs to meet employer needs. City, DCWSLT, Workforce Solutions <City - Economic Development INCOMPLETE 1.4.5. Engage in demand planning to understand which businesses expect to hire and when.City <City - Economic Development INCOMPLETE 1.4.6. Identify barriers to accessing training and other workforce resources. Continue to coordinate with partner organizations to help remove these barriers for those seeking jobs. City, DCWSLT, Workforce Solutions <City - Economic Development IN-PROGRESS 1.5.1. Extend existing collaboration efforts with the City’s Community Development Department to coordinate resources and efforts to support residents through economic recovery.City, Community Development <City - Economic Development IN-PROGRESS None None None None None None None None None 1.1. ECONOMIC RECOVERY NERVE CENTER. GOALS & STRATEGIES TIMELINE LEVEL OF COMPLETION ORGANIZATION RESPONSIBLE GOAL 1. ACCELERATE RECOVERY ESTIMATED ANNUAL COSTS 1.2. TAKING THE PULSE OF THE BUSINESS COMMUNITY. 1.3. VIRTUAL BUSINESS RETENTION. None None None None None 1.4. WORKFORCE COLLABORATIVE. 1.5. INCLUSIVE ECONOMIC RECOVERY. None None None None 155 Economic Development Strategic Plan Implementation Matrix 1.5.2. Coordinate with the Denton Black Chamber of Commerce and other multicultural organizations to provide targeted information for businesses owned by women and people of color. City, Chamber, Denton Black Chamber <Chamber IN-PROGRESS 1.5.3. Continue to collaborate with local and regional nonprofits in gathering information about what challenges residents are facing due to the economic impact of the COVID-19 pandemic. City <City - Community Development IN-PROGRESS 1.5.4. Disaggregate social and economic indicators by race and income levels to show how vulnerable populations are faring in comparison to other segments of the population. City <City - Economic Development INCOMPLETE 1.5.5. Highlight businesses owned by women and people of color in marketing materials and through digital marketing channels to increase awareness and promote their success.City, Chamber <Chamber INCOMPLETE 1.6.1. Continue the City’s existing support for the United Way of Denton County Information & Referral services to assist small businesses. City, United Way, Denton County <City - Community Development Already funded IN-PROGRESS 1.6.2. Strengthen the Denton County chamber and economic development workgroup and continue to build this network throughout the economic stabilization and recovery periods. City, Denton County, Chamber <City - Economic Development IN-PROGRESS 1.6.3. Leverage the Denton Innovation Group to develop targeted supports and resources to assist entrepreneurs through economic recovery. City, Denton Innovation Group, Stoke <City - Economic Development IN-PROGRESS 1.6.4. Connect with regional DFW organizations, such as the Dallas Regional Chamber, to expand the information-sharing network beyond Denton County. City, Chamber, Dallas Regional Chamber <Chamber IN-PROGRESS 2A.1.1. Refine and enlarge the City’s database of existing employers. The database should be expanded to include companies that serve external markets or are suppliers to existing employers.City, Chamber <City - Economic Development IN-PROGRESS 2A.1.2. Ramp up the business visitation program to track trends among Denton employers and identify business needs. City <City - Economic Development $150,000/year dedicated to Investment Fund $250,000 to $500,000 Up to $1,000,000 New job-based incentive program IN-PROGRESS 2A.1.3. Communicate success stories that result from BRE visits. These might not translate directly to new job creation or increased capital investment, but they can still be valuable to businesses. City <City - Economic Development INCOMPLETE 2A.2.1. Cultivate relationships with real estate brokers and site selectors. City, Chamber <Chamber Use existing fund and abatements $2,000,000 $3,000,000 General incentive fund IN-PROGRESS 2A.2.2. Create a centralized lead tracking system for Denton.City, Chamber <City - Economic Development IN-PROGRESS 2A.2.3. Engage with regional economic development organizations, industry groups, and professional networks in the DFW Metroplex. City, Chamber, Denton County <Chamber IN-PROGRESS 2A.3.1. Prioritize infrastructure investments, particularly with respect to roads and utilities. City, Development Services <City - Development Services Use existing funds $250,000 to $500,000 $1,000,000 for infrastructure incentive funding Utility development line funds; future TIRZ funds; IN-PROGRESS 2A.3.2. Continue to track vacant properties and parcels, partnering with brokers and developers on new developments or redevelopments to increase the usefulness and value of these properties. City, Chamber <Chamber IN-PROGRESS 2A.3.3. Partner with UNT on relocating the sports recreation fields located at Precision Drive and Airport Road to an area outside the industrial park to improve safety and make better use of the land.City, UNT <City - Economic Development INCOMPLETE 2A.3.4. Provide public infrastructure incentives (such as credits or reimbursements) for projects aligned to Denton’s growth areas. City, Development Services <City - Economic Development None $50,000 per year $100,000 per year Can be provided as reimbursements or credits as part of incentives on high priority projects IN-PROGRESS 2A.4.1. Leverage over $2.8 billion in planned projects from TxDOT in Denton to increase connectivity between Denton and surrounding DFW communities.City, Development Services <City - Economic Development IN-PROGRESS 2A.4.2. Explore the feasibility of a partnership between the businesses located in the Westpark Industrial Park, NCTC, UNT Center for Logistics & Supply Chain Management, and the City.City, Chamber, EDPB <City - Economic Development INCOMPLETE Same as 1.3.1 Same as 1.3.1 None 2A.4. CENTER OF EXCELLENCE. GOAL 2. FOSTER GROWTH 2A. CONNECTED DENTON 2A.1. BRE (BUSINESS RETENTION AND EXPANSION). 2A.2. ATTRACT NEW INVESTMENT. 2A.3. WESTPARK INDUSTRIAL PARK. None None $50,000 None None None None None None None None None None 1.6. REGIONAL COLLABORATION. 156 Economic Development Strategic Plan Implementation Matrix 2A.4.3. Include workforce partners to create career pathways for Denton students and residents into in- demand occupations for Denton’s transportation and logistics businesses. City <City - Economic Development INCOMPLETE 2A.4.4. Promote opportunities in the transportation, logistics, and supply chain fields to students in Denton and in economic development marketing materials. City, Chamber, EDPB <City - Economic Development INCOMPLETE 2B.1.1. Support the expansion of networking channels and opportunities for relationship building among the region’s entrepreneurs, startups, and students. City, Chamber, EDPB <City - Economic Development No additional staff No additional staff $150,000 for qualified staff City General Fund IN-PROGRESS 2B.1.2. Establish connections with DFW entrepreneurship organizations such as Dallas 1 Million Cups, 1 Million Cups Frisco, Dallas Innovates, Capital Factory, and the Dallas Entrepreneur Center. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.1.3. Assemble a knowledge resource network to support entrepreneurs and companies with access to financial, legal, policy, and research information needed for their businesses to grow. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.1.4. Partner with local and regional partners to design reverse-pitch competitions to engage major corporations and organizations in the DFW Metroplex with needs for innovation. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development None City General Fund or private funds INCOMPLETE 2B.1.5. Ensure that targeted resources are available for businesses owned by women and people of color, who have historically faced barriers to accessing traditional economic development tools.City, Chamber <City - Economic Development INCOMPLETE 2B.2.1. Cultivate relationships with the DFW VC (venture capital) community so that local companies are not forced to relocate after they grow beyond their initial rounds of capital. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.2.2. Partner with the Denton Angels to expand access to capital for Denton startups. Work with other angel networks in the DFW Metroplex, and across Texas, to improve deal flow for Denton companies and investors. City, Denton Angels, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.2.3. Network with regional entrepreneurship programs so that they become familiar with Denton and the resources available for businesses looking to grow and expand within the DFW Metroplex. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.2.4. Revise the funding requirements for the EDP Investment Fund to be more inclusive of innovative startups that might not meet current thresholds for employment and capital investment.City, EDPB <City - Economic Development $150,000/year in Investment Fund $250,000 $500,000 General incentive fund, programmed for entrepreneurship INCOMPLETE 2B.3.1. Partner with the Denton Innovation Group to define a vision for entrepreneurship in Denton, establish goals, measure progress, and connect with DFW organizations.City, Denton Innovation Group <City - Economic Development Work done in- house Hire limited consultant ($25,000) $100,000 for entrepreneurship plan development City funds and private funds IN-PROGRESS 2B.3.2. Launch an accelerator to support the growth of existing companies. City, Denton Innovation Group, Stoke <City - Economic Development None None $250,000 City funds and private funds INCOMPLETE 2B.3.3. Host a Citywide pitch competition to identify and develop innovative entrepreneurs in Denton. This not only builds Denton’s creative brand but also provides the City with a way of identifying top talent in the community. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development City General Fund INCOMPLETE 2B.4.1. Capitalize on Denton’s status as an emerging hub for edtech companies to drive additional growth and investment in this sector and to attract more creative professionals to Denton. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.4.2. Create an edtech alliance with entrepreneurial companies, Denton ISD, UNT Murphy Center for Entrepreneurship and Innovation, and the Center for Women Entrepreneurs at TWU to identify opportunities to strengthen and diversify edtech in Denton. City, UNT, TWU, Denton Innovation Group, Stoke <City - Economic Development City funds and private funds INCOMPLETE 2B.4.3. Support the expansion of Denton ISD’s annual TIACON (Technology in Action Conference) about education technology and curriculum. City, Denton ISD, Denton Innovation Group, Stoke <City - Economic Development City General Fund INCOMPLETE 2B.5.1. Engage with DFW entrepreneurship organizations, talent networks, and industry associations to identify new companies. City, Chamber, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 2B.5.2. Target successful startups in business incubators/accelerators that are on the cusp of outgrowing their existing spaces and are positioned for expansion/relocation to Denton.City <City - Economic Development General incentive fund, programmed for entrepreneurship; Job- based incentive program INCOMPLETE 2B.5.3. Track VC firms in DFW, Silicon Valley, Austin, and other markets that have recently funded high- growth, innovative businesses. City <City - Economic Development INCOMPLETE $10,000 for event or sponsorship costs None $5,000 for administrative, marketing, or operating costs $10,000 for sponsorships or support funding None Included in 2B.2.4. 2B.4. EDTECH CLUSTER. 2B.5. RECRUIT GROWING STARTUPS. None 2B.1. CHAMPION AND CONVENE. 2B.2. ACCESS TO CAPITAL. 2B.3. ECOSYSTEM BUILDERS. None None None None None None None $10,000 for sponsorships 2B. CREATIVE DENTON None 157 Economic Development Strategic Plan Implementation Matrix 2B.5.4. Use resources like the Inc. 5000 (a list of the fastest-growing private firms in the US based on year- over-year revenue growth) to identify firms that would be a good fit for Denton.City <City - Economic Development INCOMPLETE 2B.6.1. Aggressively utilize the City’s social media channels to publicize successes.City <City - Economic Development INCOMPLETE 2B.6.2. Pitch stories about successful Denton companies to media outlets, such as the Denton Record- Chronicle, Dallas Morning News, Fort Worth Star-Telegram, Dallas Innovates, and D Magazine.City, Chamber <Chamber INCOMPLETE 2B.6.3. Develop a Citywide entrepreneurial recognition program that harnesses the strengths of local efforts that already exist in Denton. City, Chamber, Denton Innovation Group, Stoke <Chamber INCOMPLETE 2C.1.1. Prioritize the energy efficiency and conservation goal from the Simply Sustainable plan by focusing on building standards and incentives for greener residential and business development. City, Development Services, DME <City - Economic Development IN-PROGRESS 2C.1.2. Work with DME and the City’s Development Services department to better understand green building standards, including what is currently required of developers.City, Development Services <City - Economic Development IN-PROGRESS 2C.1.3. Build a more robust set of incentives to encourage developers to adopt green building standards. More incentives should be offered for developments that meet higher tiers of standards. City, Development Services <City - Economic Development None (Scored during incentive process) $50,000 $100,000 DME; Green Sense Program INCOMPLETE 2C.2.1. Identify businesses that are high electricity users, such as data centers. DME’s competitive rates and the ability to power businesses using 100 percent renewables is a good marketing opportunity for both the company and for Denton. City, DME <Chamber INCOMPLETE 2C.2.2. Provide technical assistance to developers and businesses that want to leverage federal incentives, such as the Business Energy Investment Tax Credit, or obtain LEED certification. City, Development Services, DME <DME INCOMPLETE 2C.2.3. Network with regional and statewide organizations focused on clean energy, municipal utilities, and data centers to understand trends and develop relationships with industry leaders.City, Chamber <DME INCOMPLETE 2C.3.1. Adopt the SDGs and formally make them a priority for the City of Denton. The four SDGs most related to Denton’s sustainability and economic development efforts are highlighted here.City <City - Economic Development INCOMPLETE 2C.3.2. Align performance metrics with the targets and indicators associated with each SDG. Not all targets will be directly applicable, so Denton can also set its own targets aligned to the SDGs. City <City - Economic Development INCOMPLETE 2C.4.1. Incorporate Denton’s Green Business Program in economic development digital marketing. The program can benefit from more targeted promotion to the business community.City, Chamber <Chamber INCOMPLETE 2C.4.2. Revise digital marketing materials to include a greater focus on Denton’s sustainability goals and 100 percent renewable energy resources. City, Chamber <Chamber INCOMPLETE 2C.4.3. Cultivate relationships with regional and statewide clean energy networks. Treat these networks as a channel for promoting Sustainable Denton as well as furthering business attraction.City, Chamber <DME INCOMPLETE 2D.1.1. Dedicate staff resources to supporting Hillwood and Stratford in making the Cole and Hunter Ranch vision come to fruition. City, Development Services <City - Economic Development None None $100,000 for future staff Revenues from Cole and Hunter Ranch development INCOMPLETE 2D.1.2. Provide concierge services to help the developers navigate processes across City departments and solve any challenges that arise. City, Development Services <City - Economic Development INCOMPLETE 2D.1.3. Continue to work with Hillwood and Stratford to ensure that a mix of housing options, from high- density to low-density, are built to increase the diversity in Denton’s housing stock. City, Development Services <City - Economic Development IN-PROGRESS 2D.2.1. Sustain implementation of the City’s Downtown Implementation Plan adopted in 2010.City, Development Services <City - Economic Development IN-PROGRESS None 2D.1. COLE AND HUNTER RANCH. None None None 2D. COMPETITIVE DENTON 2D.2. DOWNTOWN DEVELOPMENT. None None None None None 2B.6. PROMOTING DENTON’S CREATIVE BRAND. 2C. SUSTAINABLE DENTON 2C.1. SIMPLY SUSTAINABLE STRATEGIC PLAN. None None None None 2C.2. TARGET ENVIRONMENTALLY CONSCIOUS BUSINESSES. 2C.3. THINK GLOBAL, ACT LOCAL. 2C.4. GREEN MARKETING. None None None None 158 Economic Development Strategic Plan Implementation Matrix 2D.2.2. Continue utilizing various tools (development incentives, Chapter 380 agreements, TIRZ financing, and historic tax exemptions) to stimulate new private investment in the downtown. City, EDPB, Development Services <City - Economic Development Use existing tools $500,000 $1,000,000 Downtown TIRZ fund IN-PROGRESS 2D.2.3. Prioritize development of additional residential and commercial office space in downtown Denton, especially the corridors extending off the square. City, EDPB, Development Services <City - Economic Development INCOMPLETE 2D.3.1. Promote the development of Class A buildings for office space and creative redevelopment of existing structures to attract professional services and tech-oriented companies.City, EDPB <Chamber INCOMPLETE 2D.3.2. Utilize financial incentives to support the development of new or refurbished office space.City, EDPB, Development Services <City - Economic Development None None Up to $1,000,000 for office space incentives General incentive fund; future TIRZ; tax abatement INCOMPLETE 2D.3.3. Strengthen relationships with the regional real estate development and brokerage community by hosting quarterly or annual meetings with DFW real estate professional and trade associations.City, Chamber <Chamber INCOMPLETE 2D.4.1. Extend basic infrastructure to north Denton around Loop 288 to lay the groundwork for future residential and commercial development after TxDOT completes reconstruction of the loop.City, Development Services <City - Economic Development INCOMPLETE 2D.4.2. Improve the aesthetics and accessibility of main corridors leading into the downtown square. Dallas Drive and Fort Worth Drive are the main entrances from I-35 into the City core. City, Development Services <City - Economic Development INCOMPLETE 2D.4.3. Launch a Denton Fiber initiative to expand broadband connectivity and access to all businesses and residents. City, EDPB, Development Services <City - Economic Development INCOMPLETE 2D.5.1. Refresh the Denton EDP website so that it serves as the City’s primary online portal for economic development prospects, site location consultants, commercial real estate brokers, and other business decision- makers. City, Chamber <Chamber Private funds INCOMPLETE 2D.5.2. Establish a digital marketing campaign to highlight Denton’s economic development advantages and success stories. Develop baseline digital marketing tools and engage in regular digital marketing activities, including the following. City, Chamber <Chamber None $10,000 $25,000 Private funds INCOMPLETE 2D.5.3. Collaborate with the Denton Chamber of Commerce to create digital materials aimed at commercial real estate brokers, describing the attractive environment for business relocation.City, Chamber <Chamber IN-PROGRESS 3.1.1. Build off the workforce collaborative, detailed in Strategy 1.4, to focus on workforce needs during the period of economic recovery. City, DCWSLT, Workforce Solutions <City - Economic Development INCOMPLETE 3.1.2. Continue to convene regular meetings with key employers, Workforce Solutions, NCTC, and other providers to identify business needs and connect unemployed residents to jobs. City, DCWSLT, Workforce Solutions, NCTC <City - Economic Development INCOMPLETE 3.1.3. Over the long term, identify two to three occupations and/or skills that are critical to Denton employers and develop pathways to support residents in moving into those roles. City, DCWSLT, Workforce Solutions, NCTC <City - Economic Development Job-based incentive fund INCOMPLETE 3.1.4. Organize the collaborative around sharing data, coordinating demand and supply, aligning efforts to build talent pipeline, and streamlining BRE efforts. City, DCWSLT, Workforce Solutions, NCTC <City - Economic Development INCOMPLETE 3.2.1. Continue to collaborate with the City’s Community Development department in supporting the development or redevelopment of affordable housing in south and east Denton. City, Community Development <City - Economic Development IN-PROGRESS 3.2.2. Preserve existing housing by offering financial assistance for repairs or retrofitting to maintain naturally occurring affordable housing. City, Community Development <City - Economic Development Use existing abatements $25,000 per year $50,000 per year Tax abatements; Neighborhood empowerment zones IN-PROGRESS 3.2.3. Leverage the federal Opportunity Zones incentive and New Markets Tax Credit to support the development of valuable projects that will support the needs of existing residents.City, Community Development <City - Economic Development INCOMPLETE 3.2.4. Identify opportunities for adaptive reuse of existing buildings that can be converted into multiunit housing and preserve existing structures and utility connections. City, Community Development <City - Economic Development INCOMPLETE 3.2.5. Improve the development review process to decrease costs for those committed to building workforce and affordable housing. City, Community Development, Development Services <City - Economic Development INCOMPLETE None None None None None TBD $10,000 for website upgrades None None None Included in 2A.1.2 3.1. WORKFORCE COLLABORATIVE. 3.2. HOUSING AFFORDABILITY. 3.3. GROW YOUR OWN TALENT INITIATIVE. 2D.3. PROFESSIONAL OFFICE SPACE. 2D.4. INFRASTRUCTURE. 2D.5. DIGITAL MARKETING. GOAL 3. STRENGTHEN COMMUNITY INCLUSION None None None TBD TBD 159 Economic Development Strategic Plan Implementation Matrix 3.3.1. Support youth entrepreneurship programs at the local level to foster a culture of innovation and cultivate an entrepreneurial spirit. City, Denton ISD, Denton Innovation Group, Stoke <City - Economic Development City General Fund INCOMPLETE 3.3.2. Encourage Denton ISD to incorporate entrepreneurship into academic curricula and increase exposure and access to Denton’s startups. City, Denton ISD, Denton Innovation Group, Stoke <City - Economic Development INCOMPLETE 3.3.3. Gather data from UNT, TWU, and NCTC about graduates, including how many students stay in Denton and the DFW Metroplex versus relocating to other parts of the state or country. City, UNT, TWU, NCTC <City - Economic Development INCOMPLETE Explore options to update and/or refine Denton's economic development operations, including a Customer Relationship Management (CRM) system for information and contact management.City <City - Economic Development Excel or free option $7,500 per year $10,000 for CRM system City General Fund INCOMPLETE Update the City's incentive policies to align with the strategies and actions outlined in the economic development strategic plan.City <City - Economic Development INCOMPLETE Develop cost estimates for implementation of the strategic plan and options for the City to allocate the resources necessary for implementation.City <City - Economic Development IN-PROGRESS None None $10,000 for sponsorship programs CAPACITY AND RESOURCES None None 160 Date: January 15, 2021 Report No. 2020-008 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: FY20-21 Acceptance of Sponsorships and Donations Update. BACKGROUND: On Februar y 11, 2020, the City Council approved Ordinance 20-169 outlining requirements for accepting sponsorships and donations. Under the new ordinance, Parks and Recreation will provide Council with a report, at least annuall y, which includes information on the sponsorships and donations collected. DISCUSSION: The COVID pandemic significantl y impacted special events and programs that would typicall y collect sponsorships during the first quarter of FY 20-21. Special events and programs were suspended for a period of time with gatherings of large groups restricted. The Parks and Recreation Department has collected a total of $3,995 in sponsorships and donations for the following events, programs or projects: Sponsor/Donor Name First Quarter Sponsorship Value Project/Program Category Parks Foundation $1,000 Vela Art Sculpture Special Project Parks Foundation $258 Signs at Cross Timbers Park Special Project MLK Advisory Board $385 Treat to Trunk Special Event Eaties $10 Treat to Trunk Special Event Denton Police Department $100 Treat to Trunk Special Event Mt. Calvary Baptist $80 Treat to Trunk Special Event Denton Together Coalition $25 Treat to Trunk Special Event Juneteenth $40 Treat to Trunk Special Event Joppa Lodge $51 Treat to Trunk Special Event NAACP $40 Treat to Trunk Special Event 161 Date: Report No. Empowered Outreach Church $50 Treat to Trunk Special Event Birdia J ohnson for City Council $150 Treat to Trunk Special Event DCTA $700 Treat to Trunk Special Event RSVP $60 Treat to Trunk Special Event SEDNA $25 Treat to Trunk Special Event LJ3 $50 Treat to Trunk Special Event Omega Alpha, Omega Chapter of Alpha Kappa Alpha $396 Treat to Trunk Special Event Denton County Friends of the Family $40 Treat to Trunk Special Event Anonymous $92 ALH Holiday Bags Special Event The Cookie Crave $68 Cookies & Cocoa Drive Thru Special Event Insomnia Cookies $75 Cookies and Cocoa Drive Thru Special Event Eaties $300 Tree Giveaway Special Event Total $3,995 CONCLUSION: The Parks and Recreation Department will continue to seek sponsorships and donations in an effort to enhance and subsidize the costs of programs, events, and projects. STAFF CONTACT: Jennifer Eusse Special Event Supervisor Parks and Recreation Jennifer.Eusse@cit yofdenton.com PARTICIPATING DEPARTMENTS: Parks and Recreation Department STAFF TIME TO COMPLETE REPORT: Parks and Recreation Department 1 hour Total Staff Time 1 hours 162 Date: January 15, 2021 Report No. 2021-009 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: Quarterly Financial Report for the period ending September 30, 2020. BACKGROUND: Attached for your review is the Quarterly Financial Report for the period ending September 30, 2020. If you have any questions or need additional information, please let me know. STAFF CONTACT: Cassey Ogden, Finance Director (940) 349-7195 cassandra.ogden@cityofdenton.com 163 164 About This Quarterly Financial Report This report has been prepared by the City of Denton’s Finance Department. The Quarterly Financial Report is intended to provide our users (internal and external) with information regarding the City’s financial position and economic activity. This report includes information for the quarter ending September 30, 2020. This report is presented in four sections. 1. The Executive Dashboard section contains a high level summary of the major operating funds using graphic illustrations and key economic indicators. Narrative disclosures are also included to highlight any significant changes or fluctuations. 2. The Financial Summary section reports the performance of the major operating funds of the City. In addition, the report provides an end of year projection and a comparison to the budget for major revenue sources and expenditure items. 3. The Revenue & Economic Analysis section provides additional analysis regarding key revenue sources and economic indicators. 4. The Quarterly Investment Report section provides a summary of the City’s investment portfolio, interest earnings and a brief market outlook. The Quarterly Financial Report is intended to provide our users with timely and relevant information. Please provide us with any comments or suggestions you may have. If you would like additional information, feel free to contact me. Cassandra Ogden Director of Finance 215 East McKinney Street Denton, TX 76201 940-349-7195 165 Section 1 City of Denton Quarterly Financial Report September 2020 Executive Dashboards 166 Note: All figures presented are in millions of dollars. FY 2019-20 FY 2019-20 ANNUAL PRELIMINARY FY 2019-20 DESCRIPTION BUDGET 1 ACTUALS VARIANCE Beginning Fund Balance as of 09/30/19 30.13$ 30.74$ RESOURCES: Ad Valorem Taxes 48.63 48.63 0% Sales Tax 39.28 39.34 0% Franchise Fees 4.60 4.60 0% Other Taxes 0.50 0.30 -40% Service Fees 8.17 6.85 -16% Fines and Fees 3.58 2.28 -36% Licenses and Permits 6.63 5.22 -21% Miscellaneous Revenue 3.31 2.29 -31% Transfers In 21.64 27.35 26% Total Revenues 136.34 136.86 0% Total Resources 166.47 167.60 EXPENDITURES: Personal Service 93.24 92.85 0% Material and Supplies 3.25 2.47 -24% Maintenance and Repairs 1.67 1.32 -21% Insurance 1.57 1.57 0% Miscellaneous 1.50 1.10 -27% Operations 16.98 15.98 -6% Transfers Out 17.73 18.27 3% Fixed Assets 0.56 0.44 -21% Total Expenditures 136.50 134.00 -2% Net Income (Loss)(0.16) 2.86 Ending Fund Balance 29.97$ 33.60$ City of Denton, Texas General Fund Executive Dashboard $- $20 $40 $60 $80 $100 $120 $140 Revenue & Expenses (in Millions) YTD Revenue YTD Expenses Key Trends ➢Service Fees revenues are $1.32M less than budgeted mainly due to the Aquatics Center closure during the summer. ➢Fines and Fees revenues are $1.30M less than budgeted mainly due to lower Municipal Court fines and fees. ➢Licenses and Permits revenues are $1.41M less than budgeted mainly due to lower Building Permits. ➢Transfers In revenues are $5.71M more than budgeted mainly due to Public Safety payroll reimbursed by the Coronavirus Relief Fund. ➢Operations expenditures are $1.00M less than expected mainly due to 380 Agreement tax rebates reductions due to COVID-19 impact. $- $0.5 $1.0 $1.5 $2.0 $2.5 $3.0 $3.5 $4.0 Sales Tax Monthly Average by Quarter 1Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019-20 budget process. 167 Note: All figures presented are in millions of dollars.City of Denton, Texas Electric Fund Executive DashboardFY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTION BUDGET ACTUALS VARIANCEBeginning Working Capital and Reserves as of 9/30/19 55.64$ 77.92$ RESOURCES: Rate Revenues 146.49 145.21 0% Transmission Revenue 46.70 48.49 4% Other Revenues 3.98 9.73 145% DEC Revenues 25.07 12.76 -49%Total Revenues 222.24 216.19 -3%Total Resources 277.88 294.11 EXPENDITURES: Purchased Power 74.30 60.16 -19% DEC Fuel 12.48 3.60 -71% Transmission of Power 18.62 16.77 -10% Personnel Service 22.75 19.66 -14% Operation and Maintenance 31.67 27.93 -12% Debt Service 54.73 54.57 0% Transfers Out 15.85 14.98 -5% Capital Outlay 1.83 5.99 227%Total Expenditures 232.23 203.66 -12%Net Income (Loss) (9.99) 12.53 Ending Working Capital and Reserves 45.65$ 90.45$ $0$50$100$150$200$250Revenue & Expenses (in Millions)YTD RevenueYTD ExpenseKey TrendsRevenues are 3% lower than budgeted. Transmission revenue is $1.8 Million higher than budgeted while DEC Revenue is $12.3 Million less than budget as a result of DEC running fewer hours due to cooler weather in the summer months. Other Revenues are 145% higher than budget as a result of $5.6 Million in TMPA Transmission revenue.Purchased Power expenditures are $14.1 Million less than budget and DEC Fuel is $8.9 Million less than budget as a result of cooler weather in the summer months. Transmission of Power is $1.8 Million less than budget due to filings by other electric utilities.Personnel costs are $3.1 Million less than budget as a result of eliminating positions.Operation and Maintenance costs are $3.7 Million less budget as a result of conservative measures taken to lessen the potential financial impact of COVID‐19. This more than offset the increased ROI rate from 3.5% to 6%, which resulted in payments $1.1 Million higher than budget. The Ending Working Capital and Reserves is $44.8 Million higher than budget as a result of lower Purchased Power costs, lower DEC Fuel cost, reduced operational costs, and receiving $5.6 Million in unanticipated revenue from TMPA.01002003004005006002014 – 2020 Historical Quarterly GWH Sales1 Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019‐20 budget process. 168 Note: All figures presented are in millions of dollars.FY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTION BUDGET 1ACTUALS VARIANCEBeginning Working Capital and Reserves as of 09/30/19223.54$ 25.46$ RESOURCES: Water Sales 39.35 39.08 -1% Other Water Revenues 1.16 1.51 30% Transfers In 0.95 1.15 21% Impact Fee Revenue 6.61 6.61 0%Total Re ve n u e s48.07 48.35 1%Total Resources71.61 73.81 EXPENDITURES: Personal Service8.90 8.14 -9% Operations, Services10.82 9.78 -10% Capital Outlay13.69 13.84 1% Debt Service12.88 12.88 0% Transfers Out4.77 4.90 3%Total Expenditures51.06 49.54 -3%Net Income (Loss)(2.99) (1.19) Ending Working Capital and Reserves 20.55$ 24.27$ City of Denton, Texas Water Fund Executive DashboardKey TrendsOther Water Revenues are favorable to budget due to increases in tapping fee and rawwater resale revenues. Transfers in are higher than budget due to a larger administrative transfer fromElectric.1Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019‐20 budget process.2The Beginning Working Capital balance excludes $13.05M of Impact Fee Reserves and $0.75 million for Development Plan Line Reserves. $‐ $10 $20 $30 $40 $50 $60Revenue & Expenses (in Millions)YTD RevenueYTD Expenses05001,0001,5002,0002,5002014‐2020 Historical Quarterly Gallons Sold (in Millions)169 FY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTIONBUDGET 1ACTUALS VARIANCEBeginning Working Capital and Reserves as of 09/30/19216.19$ 16.93$ RESOURCES: Wastewater Fees 25.08 24.03 -4% Other Wastewater Revenue1.81 2.14 18% Drainage Fees4.96 5.09 3% Transfer In0.59 0.59 0% Impact Fee Revenue4.27 4.27 0%Total Revenues36.71 36.12 -2%Total Resources52.90 53.05 EXPENDITURES: Personal Service 9.35 8.60 -8% Operations, Services 10.22 7.91 -23% Capital Outlay 6.81 8.04 18% Debt Service 7.49 7.48 0% Transfer Out 4.45 4.87 9%Total Expenditures38.32 36.90 -4%Net Income (Loss)(1.61) (0.78) Ending Working Capital and Reserves 14.58$ 16.15$ Note: All figures presented are in millions of dollars.City of Denton, Texas Wastewater1Fund Executive DashboardKey TrendsOther Wastewater Revenues are favorable to budget due to increases in tipping feeand compost revenues. Operations, Services are favorable to budget due to reductions in materials,supplies, and maintenance and repair expenditures.1Includes Drainage.2Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019‐20 budget process.3The Beginning Working Capital balance excludes $6.77 million of Impact Fee Reserves, $1.0 million for Drainage Reserves, and $0.54 million for Development Plan Line Reserves. $‐ $5 $10 $15 $20 $25 $30 $35 $40Revenue & Expenses (in Millions)YTD RevenueYTD Expenses02004006008001,0001,2001,4002014‐2020 Historical Quarterly Gallons Billed (in Millions)170 FY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTIONBUDGET ACTUALS VARIANCEREVENUES: Residential Drainage Fees1.90$ 1.95$ 3% Nonresidential Drainage Fees 3.06 3.14 3% Wastewater Resources0.04 - -100% General Fund Transfer0.35 0.35 0%Total Revenues5.35 5.44 2%EXPENDITURES: Personal Service2.31 2.04 -12% Operations, Services0.94 0.68 -28% Capital Outlay1.14 1.62 42% Debt Service0.48 0.47 -2% Transfer Out0.48 0.63 31%Total Expe n di tu re s5.35 5.44 2%Net Income (Loss)-$ -$ Note: All figures presented are in millions of dollars.City of Denton, Texas Drainage Operations Executive DashboardKey TrendsOperations, Services expenditures are favorable to budget due to lower than expected materials & supplies and outside services costs.Capital Outlay expenses are over budget due to year‐end expendituretrue‐ups and additional funding provided for the channel rehabilitation drainage project. $‐ $1.0 $2.0 $3.0 $4.0 $5.0 $6.0Revenue & Expenses (in Millions)YTD RevenueYTD Expenses171 FY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTIONBUDGET 1ACTUALS VARIANCEBeginning Working Capital and Reserves as of 09/30/19210.36$ 9.21$ RESOURCES: Collection & Disposal27.08 28.51 5% Recycling7.04 6.74 -4% Other Revenue1.27 1.63 28%Total Revenues35.39 36.88 4%Total Resources45.75 46.09 EXPENDITURES: Personal Service11.10 10.44 -6% Operations, Services9.83 8.18 -17% Capital Outlay3.81 4.41 16% Debt Service8.45 8.45 0% Landfill Closure0.61 - -100% Transfer Out4.65 4.37 -6%Total Expenditures38.45 35.85 -7%Net Income (Loss)(3.06) 1.03 Ending Working Capital and Reserves7.30$ 10.24$ 01,0002,0003,0004,0005,0006,0007,0008,0009,00010,0002019Qtr 12019Qtr 22019Qtr 32019Qtr 42020Qtr 12020Qtr 22020Qtr 32020Qtr 4Refuse TonnageRecycling and ReuseTonnageResidential Curbside Collection TonnageNote: All figures presented are in millions of dollars.City of Denton, Texas Solid Waste Fund Executive DashboardKey TrendsCollection & Disposal was more than expected because of an increase in Landfill Gate receipts. The increase in Landfill gate receipts was driven by an increase in wholesale and residential tons. Other revenue increased due to a sale of assets throughout the year.The contribution to the Landfill Closure Fund was suspended this fiscal year until the landfill expansion is finalized.05,00010,00015,00020,00025,00030,0002019Qtr 12019Qtr 22019Qtr 32019Qtr 42020Qtr 12020Qtr 22020Qtr 32020Qtr 4Commercial Refuse & Recycling (Front & Side Load)Cubic Yards Serviced per WeekCommercial RefuseCommercial Recycling1Annual adopted budget as amended or modified. Beginning Working Capital and Reserves represents the amount which was estimated in the FY 2019‐20 budget process.2The Beginning Working Capital and Reserves excludes $11.06 million of Landfill Closure/Post Closure reserves.172 City of Denton, Texas Airport Fund Executive DashboardKey TrendsBoth revenues and expenses were less than budgeted due to COVID‐19.$0.0$1.0$2.0$3.0$4.0$5.02010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020GAS WELLREVENUE(in millions of dollars by fiscal year) 20,000 30,000 40,000 50,000 60,000AIRPORT OPERATIONS BY QUARTER(takeoff or landing by fiscal year)Note: All financial amounts presented are in millions of dollars.FY 2019-20 FY 2019-20ANNUAL PRELIMINARY FY 2019-20DESCRIPTIONBUDGET 1ACTUALS VARIANCEBeginning Working Capital and Reserves as of 09/30/18 2.81$ 2.88$ RESOURCES: Airport Ground Leases 0.77 0.79 3% FBO Commissions 0.21 0.18 -14% Fuel Flowage Fees 0.13 0.12 -8%Total Operating Revenues 1.11 1.09 -2%EXPENDITURES: Personal Service 0.52 0.43 -17% Operations, Services 0.39 0.20 -49% Transfer Out 0.38 0.38 0%Total Operating Expenditures 1.29 1.01 -22%Net Operating Income (Loss) (0.18) 0.08 NON-OPERATING REVENUES: Investment Income 0.02 0.08 300% Gas Well Royalties 0.36 0.19 -47% Miscellaneos Income 0.00 0.00 0%Total Non-Operating Revenues 0.38 0.27 -29%NON-OPERATING EXPENDITURES: Transfer Out - Capital 0.25 0.30 20%Total Non-Operating Expenditures 0.25 0.30 20%Net Non-Operating Income (Loss) 0.13 (0.03) Net Income (Loss) (0.05) 0.05 Ending Working Capital and Reserves 2.76$ 2.93$ 1Annual adopted budget as amended or modified. Beginning Working Capital and Reserves represents the amount which was estimated in the FY 2019‐20 budget process.173 FY 2019-20 FY 2019-20ANNUAL PRELIMINARYDESCRIPTIONBUDGET 1ACTUALS VARIANCEBeginning Working Capital and Reserves as of 09/30/19 2.35$ 3.44$ RESOURCES: Franchise Fees 13.09 12.97 -1% Street Cuts 0.37 0.37 0% Investment Income 0.01 0.07 600% Transfers In 1.18 1.32 12%Total Revenues 14.65 14.73 1%Total Resources 17.00 18.17 EXPENDITURES: Personal Service 3.51 3.25 -7% Materials & Supplies 0.09 0.08 -11% Maintenance & Repairs 7.36 5.78 -21% Operations, Services0.81 0.75 -7% Transfer Out3.96 4.15 5%Total Expenditures15.73 14.01 -11%Net Income (Loss)(1.08) 0.72 Ending Fund Balance1.27$ 4.16$ FY 2019-201Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019-20 budget process.City of Denton, Texas Street Improvement Fund Executive DashboardKey TrendsMaintenance & Repairs are lower than budgeted due to a delay of street projects related to weather and the impact of COVID‐19.No surface treatments were completed in the 4thquarter for FY18‐19 or for FY19‐20. Note: All figures presented are in millions of dollars.036912Qtr1 Qtr2 Qtr3 Qtr4Tons of Asphalt Laid (in Thousands)FY18-19FY19-20020406080100Qtr 1 Qtr 2 Qtr 3 Qtr 4Lane Miles Surface TreatmentFY 18-19FY 19-20 $- $1.0 $2.0 $3.0 $4.0 $5.0 $6.0 $7.0 $8.0 $9.0 $10.0 $11.0 $12.0 $13.0 $14.0 $15.0 $16.0Oct-19 Nov-19 Dec-19 Jan-20 Feb-20 Mar-20 Apr-20 May-20 Jun-20 Jul-20 Aug-20 Sep-20Revenue & Expenses (in Millions)YTD RevenueYTD Expenses174 FY 2019-20 FY 2019-20GRANT PRELIMINARY FY 2019-20DESCRIPTIONAMOUNT ACTUALS VARIANCE2019-20 Budget Comm Development13.77$ 1.62$ -57% Public Safety 0.63 0.56 -11% Transportation161.80 21.55 -65% Other 0.36 0.04 -89%Total Budget 66.56 23.77 -64%New Awards Public Safety 1.80 1.72 -4% Transportation 3.21 3.21 0% Coronavirus Relief Fund (CRF) 7.62 4.80 -37% Other 0.21 0.21 0%Total New Awards 12.84 9.94 -23%Totals 79.40$ 33.71$ -58%COMM DEV4.75%PUBLIC SAFETY3.07%TRANS81.87%CRF9.60%OTHER0.71%FY 2019‐20 Grants Awarded $‐ $20.0 $40.0 $60.0 $80.0COMMDEVPUBLICSAFETYTRANSCRFOTHERMillionsAwardsExpensesFY 2019‐20 Awards & Expenses (in Millions)Key Trends:The following grants have been received in FY 2019-20: Federal Equitable Sharing: $243,254Chapter 59 Asset Forfeitures: $26,105U.S. Marshals Violent Offenders Task: $78,223Organized Crime Drug Enforcement: $18,148USSS’ N Texas Crimes Task Force: $5,000PD-Law Enforcement Officer Education: $9,600Sexual Assault Nurse Examiners: $1,779National Sexual Assault Kit Initiative Grant: $27,417North Texas Organized Crime Task Force: $8,857Ambulance Services-Uncompensated Care Cost: $923,869Urban Search & Rescue Response System: $323,143Texas Intrastate Fire Mutual Aid System: $38,156Texas Department of Public Safety's Texas Division of Emergency Management (TDEM): $16,725Coronavirus Emergency Supplemental Funding: $1,080IH35 E FR & Brinker Signal: $204,937Fort Worth Drive Utility Improvement: $3,000,000Airport West Side Runway Grant: $1,958Collaborative Summer Library Program: $118Alternative Fueling Facilities Program: $6,450Coronavirus Relief Fund from Denton County: $4,802,113TDEM-COVID 19-Public Assistance Grant: $47,422Texas Workforce Commission:$152,003Humanities Texas Relief Grant: $92City of Denton, Texas Grants DashboardNote: All figures presented are in millions of dollars.1This grant amount will be spent over several years and the fiscal year 2019-20 projections are estimated expenditures for one year. Remaining grant amounts will be spent in future fiscal year.175 Section 2 City of Denton Quarterly Financial Report September 2020 This report is designed for internal use and does not include all the funds and accounts included in the City of Denton’s operations. The information provided is unaudited; for a complete audited report, please refer to the City of Denton Comprehensive Annual Financial Report, available through the City’s Finance Department, City Secretary’s Office, or Denton Public Libraries. FINANCIAL SUMMARY 176 City of Denton General Fund Schedule of Revenues - Budget vs Actuals (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS REVENUE DESCRIPTION Y-T-D BUDGET ACTUALS ACTUALS Current Year - Ad Valorem 45,518,886$ 47,996,976$ 48,097,387$ 0% Delinquent - Ad Valorem 373,348 311,978 136,678 -56% Miscellaneous Penalties & Fees 402,957 320,775 397,145 24% Ad Valorem Taxes 46,295,191 48,629,729 48,631,210 0% Sales Tax 38,330,825 39,281,942 39,337,834 0% Franchise - Gas Utilities 341,345 384,313 320,976 -16% Franchise - Private Electric Utilities 121,054 117,980 120,020 2% Franchise - Cable 468,667 363,687 320,569 -12% Franchise - Telecom 229,722 53,301 76,929 44% Franchise - Denton Municipal Utilities 3,824,061 3,679,652 3,760,439 2% Franchise Fees 4,984,849 4,598,933 4,598,933 0% Other Taxes 523,268 501,870 304,294 -39% Ambulance Service Fees 3,057,598 3,679,000 3,817,135 4% Fire Department Fees 195,104 208,000 147,179 -29% Building Inspections Fees 594,962 597,476 574,529 -4% Park Department Fees 1,760,318 2,040,353 226,246 -89% Planning Department Fees 1,134,739 1,362,254 1,909,039 40% Reprographics Fees 324,216 97,603 85,380 -13% Miscellaneous Service Fees 153,224 182,471 88,325 -52% Service Fees 7,220,161 8,167,157 6,847,833 -16% Denton Municipal Fines 1,465,332 1,503,486 967,893 -36% Parking Fines 282,940 262,620 129,640 -51% Miscellaneous Fines and Fees 839,388 725,712 492,558 -32% Court Administrative and Service Fees 1,064,037 1,084,800 689,681 -36% Fines and Fees 3,651,697 3,576,618 2,279,772 -36% Demolition Permits 6,555 4,430 12,665 186% Building Permits 3,784,319 6,526,709 5,155,833 -21% Certificate of Occupancy 70,810 67,226 49,323 -27% Miscellaneous Licenses and Permits 28,136 28,087 7,307 -74% Licenses and Permits 3,889,820 6,626,452 5,225,128 -21% Investment Income 1,114,348 903,382 793,413 -12% Miscellaneous Revenues 1,791,483 2,409,191 1,492,274 -38% Miscellaneous Resources 2,905,831 3,312,573 2,285,687 -31% ROI - Denton Municipal Utilities 8,458,559 8,978,547 11,199,283 25% Transfers 10,631,697 12,662,121 16,154,076 28% Transfers 19,090,256 21,640,668 27,353,359 26% CRF Funding Total General Fund Revenues 126,891,898$ 136,335,942$ 136,864,050$ 0% 177 City of Denton General Fund Schedule of Expenditures - Budget vs Actuals (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS Y-T-D BUDGET ACTUALS ACTUALS NEIGHBORHOOD SERVICES Building Inspections 3,055,220$ 3,437,095$ 3,285,877$ -4% Community Improvement Services 1,443,258 1,620,557 1,238,232 -24% Libraries 5,847,381 6,195,023 5,894,641 -5% Parks and Recreation 10,291,254 12,114,271 9,495,161 -22% Planning 3,364,924 4,054,801 3,519,496 -13% Gas Well Review 332,675 422,398 399,706 -5% Social Services 637,046 1,716,712 1,198,940 -30% 24,971,758 29,560,857 25,032,053 -15% PUBLIC SAFETY Animal Services 2,014,949 2,293,869 2,270,464 -1% Fire 30,477,640 31,856,795 33,317,554 5% Municipal Court 1,094,975 1,182,784 1,418,427 20% Municipal Judge 422,835 564,530 540,696 -4% Police 34,929,226 39,933,339 39,101,488 -2% 68,939,625 75,831,317 76,648,629 1% TRANSPORTATION Traffic Operations 2,062,024 2,310,060 2,474,424 7% Transportation Operations 192,080 - - 0% Street Lighting 825,907 850,000 820,716 -3% 3,080,011 3,160,060 3,295,140 4% ADMINISTRATIVE & COMMUNITY SERVICES City Manager's Office 2,351,618 2,458,145 2,172,622 -12% Economic Development 4,759,609 4,962,803 4,075,220 -18% Facilities Management 4,696,820 - 212 212% Finance 3,327,966 3,965,753 3,680,300 -7% Human Resources 1,762,011 1,826,381 2,226,733 22% Internal Audit 444,879 643,519 466,929 -27% Legal Administration 2,547,530 2,883,241 2,834,145 -2% Public Affairs 1,950,990 2,413,173 1,941,978 -20% Non-Departmental 7,637,622 8,791,300 11,629,316 32% 29,479,045 27,944,315 29,027,455 4% TOTAL EXPENDITURES 126,470,439$ 136,496,549$ 134,003,277$ -2% Beginning FY 19-20, Transportation Operations and Facilities Management are no longer budgeted within the General Fund. 178 City of Denton Electric Fund Schedule of Revenues and Expenditures - Budget vs Actuals (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET1 ACTUALS ACTUALS Beginning Working Capital and Reserves as of 9/30/19 55,642,370$ 77,919,436$ REVENUES: Rate Revenues 147,838,341$ 146,489,831 145,211,390 -1% Transmission Revenues 44,607,697 46,700,670 48,494,644 4% Other Revenues 8,888,971 3,977,004 9,728,745 145% COVID-19 Revenue Impact - DEC Revenues 37,482,023 25,073,394 12,762,627 -49% Total Revenues 238,817,032 222,240,899 216,197,406 -3% EXPENDITURES: Purchased Power 90,120,153 74,298,356 60,164,760 -19% DEC Fuel 6,954,969 12,475,775 3,599,350 -71% Transmission of Power 16,997,292 18,616,102 16,767,829 -10% Personnel Services 17,795,822 22,747,359 19,662,169 -14% Materials and Supplies 679,912 1,283,850 751,158 -41% Maintenance and Repair 670,898 1,826,609 717,643 -61% Insurance 745,713 1,424,039 1,434,149 1% Return on Investment Return on Investment6,331,599 7,913,804 8,970,039 13% Franchise Fee Franchise Fee9,039,835 9,448,292 9,413,971 0% Miscellaneous 616,222 1,374,225 1,510,654 10% Operations 4,719,210 8,415,902 5,137,426 -39% Debt Service 50,649,750 54,728,969 54,568,897 0% Interfund Transfers 14,310,408 15,848,533 14,978,366 -5% Capital Outlay 16,312,335 1,826,394 5,992,053 228% Total Expenditures 235,944,118 232,228,209 203,668,464 -12% Net Income (Loss)2,872,914$ (9,987,310) 12,528,942 Ending Working Capital and Reserves 45,655,060$ 90,448,378$ 179 City of Denton Water Fund Schedule of Revenues and Expenditures - Budget vs Projections (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET2 ACTUALS ACTUALS Beginning Working Capital and Reserves as of 09/30/191 23,539,348$ 25,457,474$ REVENUES: Water Sales Residential 18,035,192$ 20,508,495 20,375,256 -1% Water Sales Commercial 16,203,789 17,661,792 17,090,211 -3% Water for Resale 1,113,851 1,184,134 1,612,230 36% Other Water 1,387,309 865,090 1,209,078 40% Transfers In 1,490,053 949,888 1,149,991 21% Investment Income 427,212 294,000 302,800 3% Impact Fee Revenue 5,700,000 6,605,000 6,605,000 0% Total Revenues 44,357,406 48,068,399 48,344,566 1% EXPENDITURES: Personal Service 7,654,405 8,902,207 8,139,916 -9% Purchased Power 1,277,220 1,410,789 1,342,855 -5% Purchase of Water 2,059 3,000 1,834 -39% Materials and Supplies 1,396,965 1,510,203 1,472,974 -2% Maintenance and Repairs 1,200,652 1,554,503 1,477,259 -5% Insurance 223,433 232,791 232,788 0% Miscellaneous 245,728 401,060 185,776 -54% Operations, Services 1,434,569 2,317,980 1,767,452 -24% Capital Outlay 15,105,245 13,686,219 13,838,194 1% Return on Investment 1,255,412 1,404,533 1,359,420 -3% Franchise Fee 1,793,445 1,991,812 1,942,028 -2% Debt Service 12,700,195 12,879,020 12,879,020 0% Transfers Out 3,686,482 4,767,646 4,896,659 3% Total Expenditures 47,975,810 51,061,763 49,536,175 -3% Net Income (Loss)(3,618,404)$ (2,993,364) (1,191,609) Ending Working Capital and Reserves 20,545,984$ 24,265,865$ 1 The Beginning Working Capital balance excludes $13,045,131 of Impact Fee Reserves and $750,000 for Development Plan Line Reserves. budget process. 2 Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019-20 180 City of Denton Wastewater Fund1 Schedule of Revenues and Expenditures - Budget vs Projections (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET2 ACTUALS ACTUALS Beginning Working Capital and Reserves as of 09/30/19 16,190,748$ 16,927,079$ REVENUES: Residential Fees 11,536,543$ 11,545,026 11,422,482 -1% Commercial Fees 11,807,867 12,784,519 11,730,567 -8% Effluent Irrigation Fees 113,177 60,424 119,237 97% Wholesale Fees 699,724 693,802 758,808 9% Other Wastewater Fees 1,513,552 1,580,878 1,916,430 21% Drainage Fees 4,880,196 4,959,200 5,089,545 3% Transfer In 651,795 587,895 587,895 0% Investment Income 297,875 234,858 218,830 -7% Impact Fee Reserves 2,000,000 4,270,000 4,270,000 0% Total Revenues 33,500,729 36,716,602 36,113,794 -2% EXPENDITURES: Personal Service 7,910,033 9,357,192 8,601,781 -8% Purchased Power 1,064,075 1,221,000 1,030,524 -16% Materials and Supplies 1,003,992 1,327,538 988,031 -26% Maintenance and Repairs 1,071,889 1,770,032 1,090,847 -38% Insurance 232,020 265,743 265,743 0% Miscellaneous 73,183 82,218 50,098 -39% Operations, Services 2,072,895 3,024,514 2,364,829 -22% Capital Outlay 10,963,806 6,810,067 8,041,230 18% Return on Investment 871,548 1,196,502 869,825 -27% Franchise Fee 1,245,069 1,334,082 1,242,607 -7% Debt Service 6,858,723 7,485,506 7,479,386 0% Transfers Out 3,695,404 4,450,481 4,872,533 9% Total Expenditures 37,062,637 38,324,875 36,897,434 -4% Net Income (Loss)(3,561,908)$ (1,608,273) (783,640) Ending Working Capital and Reserves 14,582,475$ 16,143,439$ 1 Includes Drainage. 2 The Beginning Working Capital balance excludes $6,766,815 of Impact Fee Reserves, $1,000,000 for Drainage Reserves, and $540,000 for Development Plan Line Reserves. Reserves of $135,000, and Drainage Reserves of $1,000,000. 3 Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019-20 budget process. 181 City of Denton Drainage Operations Schedule of Revenues and Expenditures - Budget vs Projections (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET ACTUALS ACTUALS REVENUES: Residential Drainage Fees 1,882,655$ 1,897,150$ 1,949,739$ 3% Nonresidential Drainage Fees 2,997,541 3,062,050 3,139,806 3% Wastewater Resources - 35,000 - -100% Investment Interest Income - - - 0% General Fund Transfer 316,795 352,895 352,895 0% Total Revenues 5,196,991 5,347,095 5,442,440 2% EXPENDITURES: Personal Service 1,696,084 2,304,775 2,036,843 -12% Materials and Supplies 56,702 80,425 52,585 -35% Maintenance and Repairs 128,623 127,500 113,186 -11% Insurance 35,767 41,459 41,459 0% Miscellaneous 14,342 17,200 6,375 -63% Operations, Services 447,521 677,047 468,067 -31% Capital Outlay 1,874,843 1,144,236 1,625,318 42% Debt Service 477,433 477,893 473,464 -1% Transfer Out 465,676 476,560 625,143 31% Total Expenditures 5,196,991 5,347,095 5,442,440 2% Net Income (Loss)-$ -$ -$ 182 City of Denton Solid Waste Fund Schedule of Revenues and Expenditures - Budget vs Projection (Unaudited) For the Period Ended Sepember 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET2 ACTUALS ACTUALS Beginning Working Capital and Reserves as of 09/30/19 1 10,355,478$ 9,205,597$ REVENUES: Refuse Fees - Residential 5,797,050$ 5,797,663 5,082,472 -12% Refuse Fees - Commercial 15,202,835 15,432,175 14,045,123 -9% Residential Recycling 5,318,817 5,331,694 5,448,328 2% Commercial Recycling 1,409,972 1,705,012 1,288,420 -24% Landfill Gate and Material Sales 6,553,633 5,854,458 9,382,403 60% Recycled Material Sales 67,342 61,000 67,343 10% Asset Sales and Interest Income 161,264 688,486 1,007,520 46% Other Revenue 243,748 520,925 559,851 7% Total Revenues 34,754,661 35,391,413 36,881,460 4% EXPENDITURES: Personal Service 9,828,170 11,104,627 10,443,976 -6% Materials and Supplies 224,971 379,463 182,559 -52% Maintenance and Repairs 238,423 327,192 208,421 -36% Insurance 269,506 257,942 259,650 1% Miscellaneous 77,954 102,120 68,433 -33% Operations, Services 6,060,704 6,999,814 5,676,246 -19% Capital Outlay 1,327,649 3,810,010 4,410,619 16% Debt Service 8,995,454 8,451,027 8,449,966 0% Franchise Fee 1,733,559 1,755,737 1,781,445 1% Transfers for Landfill Closure 1,089,201 609,985 - -100% Admin Transfers Out 3,449,699 4,652,484 4,371,889 -6% Total Expenditures 33,295,290 38,450,401 35,853,204 -7% Net Income (Loss)1,459,371$ (3,058,988) 1,028,256 Ending Working Capital and Reserves 7,296,490$ 10,233,853$ 1 The Beginning Working Capital Reserve excludes $11,057,545 Landfill Closure/Post Closure Reserves. 2 Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019- 20 budget process. 183 City of Denton Airport Fund Schedule of Revenues and Expenditures - Budget vs Actuals (Unaudited) For the Period Ended September 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET1 ACTUALS ACTUALS Beginning Working Capital and Reserves as of 09/30/19 2,814,692$ 2,878,940$ OPERATING REVENUES: Airport Ground Leases 738,820$ 768,051 788,994 3% FBO Commissions 209,927 211,552 180,955 -14% Miscellaneous 135,897 135,437 124,354 -8% Total Operating Revenues 1,084,644 1,115,040 1,094,304 -2% OPERATING EXPENDITURES: Personal Service 501,861 518,930 431,399 -17% Materials and Supplies 17,554 44,794 15,436 -66% Maintenance and Repairs 31,657 72,400 27,231 -62% Insurance 43,792 24,376 24,376 0% Miscellaneous - 100 - -100% Operations 226,056 250,565 131,787 -47% Transfers Out - Operating 521,547 383,487 381,355 -1% Total Operating Expenses 1,342,467 1,294,652 1,011,584 -22% Operating (Loss)(257,823) (179,612) 82,720 NON-OPERATING REVENUES: Investment Income 101,244 22,263 79,729 258% Gas Well Royalties 313,325 358,900 192,175 -46% Other Non-Operating Revenue - - 5,049 - Total Non-Operating Revenues 414,569 381,163 276,953 -27% NON-OPERATING EXPENDITURES: Transfers Out - Capital 250,000 250,000 300,000 20% Total Non-Operating Expenses 250,000 250,000 300,000 20% Non-Operating Income (Loss)164,569 131,163 (23,047) Net Income (Loss)(93,254)$ (48,449)59,673 Ending Working Capital 2,766,243$ 2,938,613$ 1 Annual adopted budget as amended or modified. Beginning Working Capital and Reserves represents the amount which was estimated in the FY 2019-20 budget process. 184 City of Denton Street Improvement Fund Schedule of Expenditures - Budget vs Actuals (Unaudited) For the Period Ended Sept 30, 2020 PRIOR ANNUAL PRELIMINARY BUDGET VS DESCRIPTION Y-T-D BUDGET1 ACTUALS ACTUALS Beginning Fund Balance as of 9/30/2019 2,348,270$ 3,441,732$ RESOURCES: Franchise Fees 12,717,231$ 13,087,053 12,974,273 -1% Street Cuts 192,014 371,423 369,549 -1% Investment Income 50,522 10,000 69,958 600% Transfers In 1,034,582 1,184,582 1,323,205 12% Total Resources 13,994,349 14,653,058 14,736,985 1% EXPENDITURES: Personal Service 3,282,814 3,505,267 3,250,039 -7% Materials and Supplies 108,903 87,150 75,507 -13% Maintenance and Repairs 6,776,684 7,358,459 5,781,284 -21% Insurance 72,727 94,312 94,312 0% Miscellaneous 5,062 5,000 3,023 -40% Operations, Services 837,101 710,302 656,012 -8% Transfer Out 1,092,753 3,970,626 4,147,213 4% Total Expenditures 12,176,044 15,731,116 14,007,390 -11% Net Income (Loss)1,818,305$ (1,078,058) 729,595 Ending Fund Balance 1,270,212$ 4,171,327$ 1Annual adopted budget as amended or modified. Beginning Fund Balance represents the amount which was estimated in the FY 2019-20 budget process. 185 City of Denton Grants Schedule of Expenditures - Budget vs Projection (Unaudited) For the Period Ended September 30, 2020 GRANT DESCRIPTION EXPENDITURES AS OF 9/30/20192 ANNUAL BUDGET PRELIMINIARY ACTUALS BUDGET VS ACTUALS FY 2019-20 Budget US Dept of HUD - Community Development Block Grant(CDBG)4,274,427$ 2,314,276$ 1,032,271$ -55% US Dept of HUD - HOME Investment Partnership Program 3,725,784 1,458,845 589,150 -60% Community Development1 8,000,211 3,773,121 1,621,421 -57% TxDot STEP Comprehensive Grant - 97,315 50,422 -48% Victim Assistance Coordinator Grant - 89,040 82,011 -8% 2019 UASI-Specialized Regional Response Teams Sustainment - 144,137 139,908 -3% Emergency Management Performance Grant - 40,977 37,677 -8% Staffing for Adequate Fire & Emergency Response (SAFER) Grant 736,068 260,913 252,415 -3% Public Safety 736,068 632,382 562,433 -11% Airport Maintenance (RAMP) Grant - 50,000 50,000 0% TxDot-RTR-Mayhill Rd-IH35 E to US 380 39,389,775 9,624,580 7,146,583 -26% TxDot-RTR-Bonnie Brae Rd-IH35 E to US 377 17,236,196 29,630,282 5,548,492 -81% TxDot-IH35E at Loop 288/Lillian Miller Pkwy - 53,865 - -100% TxDot-RTR-McKinney (Formerly FM426) 3,834,606 16,410,716 7,992,872 -51% TxDot-RTR-Hickory Creek FM2181-FM2499 224,556 2,204,917 589,414 -73% TxDot-RTR-North Texas Boulevard Roundabout 67,518 1,946,267 26,541 -99% TxDot-RTR-ITS COMM Trunk Line 1,379,761 375,417 191,839 -49% Bicycle & Pedestrian Projects Grant - 1,500,000 - -100% Transportation1 62,132,412 61,796,044 21,545,741 -65% Interlibrary Loan Program (ILL) - 25,000 18,648 -25% TexTreasures Grant - 24,820 24,820 TIFMAS Training Tuition Grant - 9,000 - -100% Miscellaneous New Grants - 300,000 - -100% Other - 358,820 43,468 -88% Total FY 2019-20 Budget 70,868,691 66,560,367 23,773,064 -64% 186 City of Denton Grants Schedule of Expenditures - Budget vs Projection (Unaudited) For the Period Ended September 30, 2020 GRANT DESCRIPTION EXPENDITURES AS OF 9/30/20192 ANNUAL BUDGET PRELIMINIARY ACTUALS BUDGET VS ACTUALS New Awards Federal Equitable Sharing - 243,254 243,254 0% Chapter 59 Asset Forfeitures - 26,105 26,105 0% U.S. Marshals Violent Offenders Task Force - 78,223 78,223 0% Organized Crime Drug Enforcement Task Force - 18,148 18,148 0% USSS' North Texas Financial Crimes Task Force - 5,000 5,000 0% PD-Law Enforcement Officer Standards & Education - 9,600 9,600 0% Sexual Assault Nurse Examiners (SANE) Reimbursement - 1,779 1,779 0% National Sexual Assault Kit Initiative Grant - 27,417 27,417 0% North Texas Organized Crime Task Force (NTOCTF)- 8,857 8,857 0% Ambulance Services-Uncompensated Care Cost - 923,869 923,869 0% Urban Search & Rescue Response System (TEEX)- 323,143 323,143 0% Texas Intrastate Fire Mutual Aid System- Emergency Response 38,156 38,156 0% Texas Department of Public Safety's Texas Division of Emergency Management (TDEM)- Hurricane Laura - 16,725 16,725 0% Coronavirus Emergency Supplemental Funding Program 82,398 1,080 -99% Public Safety - 1,802,674 1,721,356 -5% TxDot-IH35 E FR & Brinker Signal - 204,937 204,937 0% Improvement - 3,000,000 3,000,000 0% Airport West Side Runway Grant-Porter Land Survey - 1,958 1,958 0% Transportation - 3,206,895 3,206,895 0% Coronavirus Relief Fund (CRF) from Denton County - 7,619,755 4,802,113 -37% Coronavirus Relief Fund (CRF)- 7,619,755 4,802,113 -37% Collaborative Summer Library Program Scholarship Award - 118 118 0% Alternative Fueling Facilities Program - 6,450 6,450 0% Texas Department of Public Safety's Texas Division of Emergency Management (TDEM)- COVID 19-Public Assistance Grant 47,422 47,422 0% Texas Workforce Commission-50% Chargeback Credit 152,003 152,003 0% Humanities Texas Relief Grant 2,860 92 -97% Others - 208,853 206,085 -1% Total New Awards - 12,838,177 9,936,449 -23% TOTALS 70,868,691$ 79,398,544$ 33,709,513$ -58% 1 This grant amount will be spent over several years and the fiscal year 2019-20 projections are just estimated expenditure in the one year. Remaining grant amounts will be spent in future fiscal year. 2 A portion of the grants presented cover multiple years. 187 Section 3 City of Denton Quarterly Financial Report September 2020 REVENUE & ECONOMIC ANALYSIS 188 Revenue & Economic Analysis Summary The data included in this section provides information on local, state and national trends impacting the City’s financial position. The following notes are provided to facilitate this section’s readability. 1. Positive Outlook – Represents favorable conditions for the local economy. Color code – Green. 2. Cautious Outlook – Represents changing conditions that require close monitoring. Color code – Yellow. 3. Negative Outlook – Represents unfavorable conditions for the local economy. Color code – Red. The data included in this section have been obtained from a variety of sources. Sales tax and construction related data ha ve been obtained from internal city departments. Economic data for the State ha ve been obtained from the Federal Reserve Bank of Dallas and may be subject to availability. National economic data were compiled with assistance from the City’s investment advisor, First Southwest Asset Management. 189 National Economic Trends Period Ending September 30, 2020 Gross Domestic Product (GDP) The quarter-over-quarter seasonally- adjusted, annualized GDP increase was an eye-popping +33.1%, slightly over the Bloomberg median forecast of +32%, and a sharp rebound from the historical -31.4% second quarter plunge. The third quarter gain was the largest in the post-WWII era. The previous post-war record had been +16.7% in 1950. Personal consumption, the largest component of economic growth, rose +40.7% in the third quarter following a -33.2% drop in Q2. Residential spending (housing) surged +59.3% after a -35.6% drop. Gross private investment climbed +83% after falling -46.6%. Virtually all categories followed a similar plunge/rocket pattern. However, economic growth remains -3.5% below where it was a year ago. Employment The headline unemployment rate fell from 8.4% to 7.9% in September, but much of this decline results from a drop in the labor force participation rate, which unexpectedly retreated from 61.7% to 61.2%. According to the Bureau of Labor Statistics (BLS), the number of Americans not in the labor force but currently wanting a job, was little changed in September at 7.3 million. Because these people are not actively looking for work, they are not counted among the unemployed. In total, 19.4 million Americans reported being unable to work because their employer closed or lost business during the pandemic. On the positive side, jobs are returning (albeit at a slower pace) and the headline unemployment rate is already well below even the more optimistic forecasts. 190 Inflation Although there’s a lot of noise in the numbers, year-over-year core CPI has climbed from a +1.2% pace in May to +1.7% in both August and September, while year-over-year core PPI has climbed from +0.1% to +1.2%. Neither of these levels are particularly concerning, but the quick turnaround suggests to some people that prices are suddenly an issue. What’s happening is that there wasn’t much spending going on in the spring, so prices fell and demand built-up. Later, when everyone was flush with government support and were able to get out and about, demand exceeded supply and prices rose. This isn’t a long-term trend, but it does manifest itself in higher inflation readings. Early indications suggest October prices have retreated. Retail Sales The retail sales advanced by a better-than- expected +1.9% in September, the fastest pace in three months. The category breakdown suggests there were significant dollars spent on back-to-school clothes and supplies. Clothing and accessory stores (+11%), department stores (+9.7%) and sporting goods and bookstores (+5.7%) all posted outsized gains. Almost all major categories showed increases last month, with auto dealers (+4.0%) and restaurant and bars (+2.1%) also making notable contributions. On a year-over-year basis, overall retail sales are now up a remarkable +7.1%, although some sectors have thrived (online sales +27%, building materials +23.4%, auto dealers +14.4%), while others continue to struggle (eating and drinking establishments -13.7%, clothing stores -12.0%). It should be noted that total outlays, which include services in addition to goods, are still below pre-pandemic levels. 191 Denton County and Texas Home Sales Texas home sales rose +29.6% in the third quarter, and +18.1% over the same three-month period a year ago. The average Texas home price in September $325.6k, down slightly from the record high set in July. The available inventory was just 2.3 months, easily the lowest level since the data series began in 1990. In Denton County, unit home sales rose +29.4% during the third quarter and +21.4% over the same three-month period a year ago. The average home price in September was $388.5k, after reaching a record high of $391k in August. On a year-over-year basis, home prices were up +10.3% in Denton County. Home listings totaled 2,315 in September, a -41.7% decline over last year. The available inventory was just 1.7 months, compared to 3.1 months a year ago, and matching the lowest month’s supply in a decade of history. The paper was prepared by Hilltop Securities Asset Management, is intended for educational and informational purposes only and does not constitute legal or investment advice, nor is it an offer or a solicitation of an offer to buy or sell any investment or other specific product. Information provided in this paper was obtained from sources that are believed to be reliable; however, it is not guaranteed to be correct, complete, or current, and is not intended to imply or establish standards of care applicable to any attorney or advisor in any particular circumstances. The statements within constitute the views of Hilltop Securities Asset Management as of the date of the report and may differ from the views of other divisions/departments of Hilltop Securities. In addition, the views are subject to change without notice. This paper represents historical information only and is not an indication of future performance. 192 Fuel Prices Outlook Cautious Description: Quarterly fuel trends for the United States and Texas. Analysis:Fuel prices are a major commodity source in the economy. Studies have shown a positive effect on disposable income levels when fuel prices decrease.It is estimated that for every penny decrease in the price of fuel,$1.3 billion is available to the consumer for disposable income. Therefore, the price of fuel is likely to be a key predictor of sales tax collections. Fuel prices showed a 13.9%increase from the prior quarter at the national level and a 14.4% increase at the state level. Staff has rated this outlook as Cautious. Source: U.S. Department of Energy $0 $2 $4 $6 $8 $10 $12 $0.00 $0.50 $1.00 $1.50 $2.00 $2.50 $3.00 4Q '16 2Q '17 4Q '17 2Q '18 4Q '18 2Q '19 4Q '19 2Q '20 4Q '20 MillionsDollarsFuel Prices Sales Tax Texas Fuel Prices US Fuel Prices 193 Municipal Cost Index Outlook Negative Description:The Municipal Cost Index was developed to show the rate of inflation for the cost of goods purchased frequently by local governments. The MCI draws on the monthly statistical data collected by the U.S. Departments of Commerce and Labor as well as independently compiled data to project a composite cost picture for the municipal budget officer or operating department manager. Costs of labor, materials and contract services are all factored into the composite MCI. Major indicators of these items used for the MCI include the Consumer Price Index, the Wholesale Price Index for Industrial Commodities (now known as the Producer Price Index) and the construction cost indexes published by the U.S. Department of Commerce, respectively. Analysis:The Municipal Cost Index (MCI) pulls a variety of prices for frequently purchased commodities for local governments. The cost for labor, materials and contract services are factored for the MCI.An increase in MCI means the overall price mix for these types of commodities will cost local governments more to do routine business. The 4th Quarter of 2019-20 shows an increase of 3.0 for a 1.2% increase over the prior quarter and an increase of 1.7 for a 0.67% increase over the 4th Quarter of 2018-19. Staff has rated this indicator as Negative. Note: The Municipal Cost Index is designed to show the effects of inflation on the cost of providing municipal services. State and local government officials rely on American City & County's Municipal Cost Index to stay on top of price trends, help control price increases for commodities, make informed government contract decisions and intelligent budget planning. Since 1978,readers have loyally referred to the Municipal Cost Index to determine the cost of inflation and, hence, the rising cost of doing business as a local government. Source: American City and County Magazine 247.00 248.00 249.00 250.00 251.00 252.00 253.00 254.00 255.00 256.00 4Q '18 1Q '19 2Q '19 3Q '19 4Q '19 1Q '20 2Q '20 3Q '20 4Q '20 Municipal Cost Index 194 Hotel Occupancy Tax Analysis Outlook Positive 4th Quarter FY 2019-20 Actual Y-T-D Occupancy Tax Revenue:477,013$ 2,142,483$ FY 2019-20 Budget 862,973$ 3,375,164$ Over (Under) Budget (385,960)$ (1,232,681)$ Hotel Occupancy Tax Budget:3,375,164$ End of Year Projection:2,072,776$ End of Year Actual:2,142,483$ (1,232,681)$ Variance - Actual to Projection 69,707$ Description:Tax imposed on a person who, under a lease, concession, permit, right of access, license, contract,or agreement, pays for the use of a room that is in a hotel. A hotel includes: any building in which the public may obtain sleeping accommodations; motels; a tourist home, house or court; lodging house; inn; rooming house;or bed and breakfast. The tax rate levied by the City is 7% of the price paid for a room. The State also levies a tax equal to 6%. Analysis:While the use of this revenue source is restricted by state law,it is an essential revenue source for various tourist related activities within the community and an important indicator of local economic activity. Hotel Occupancy tax revenue through the 4th Quarter of FY 2020 was 44.7% less than budget and 70.5% less than prior year's actual. This quarter illustrated a slight increase in hotel activity since the initial COVID-19 Pandemic impact last quarter. Staff has rated the outlook for this economic indicator as Positive. FISCAL YEAR FORECAST Variance - Actual to Budget $0 $100,000 $200,000 $300,000 $400,000 $500,000 $600,000 $700,000 $800,000 $900,000 1st Qtr 2nd Qtr 3rd Qtr 4th Qtr Hotel Occupancy Tax Collections FY 2016-17 FY 2017-18 FY 2018-19 FY 2019-20 195 Sales and Use Tax Analysis Outlook Positive 4th Quarter FY 2019-20 Actual Y-T-D Revenue: Gross Sales Tax Municipal Operations 622,887$ 1,939,605$ General Retail & Others 10,276,533 38,909,675 Comptroller Fees (201,640) (763,358) Amount Retained (197,606) (748,090) Total Revenue 10,500,174$ 39,337,832$ Expenses: Economic Incentives* Economic Incentives1 609,716$ 2,776,590$ Net Total 9,890,458 36,561,242 FY 2019-20 Budget 9,586,330 36,270,852 Over(Under) Budget 304,128$ 290,390$ Sales Tax Budget:39,281,942$ Year End Projection:39,337,832 39,337,832 Variance to Original Budget:55,890$ Variance to Year End Projection:-$ Economic Development Expenditure Budget:3,011,090$ Year End Projection:2,776,590 Year End Actual:2,776,590 Variance to Original Budget:234,500$ Variance to Year End Projection:-$ Description:Tax imposed on all retail sales, leases, and rentals of most goods,as well as taxable services. The total tax rate levied within the City is 8.25% (State, 6.25%; City, 1.5%; DCTA, 0.5%). Analysis:As the second largest revenue source to the City's General Fund, sales and use taxes are essential to the delivery of services to the community. Sales tax revenues through the 4th Quarter of FY 2020 compared to revenues from the prior year 4th Quarter shows a 3.24% Increase, and compared to the budget shows a 1.14% increase. Staff has rated this indicator as Positive. Year End Actual: $0.0 $2.0 $4.0 $6.0 $8.0 $10.0 $12.0 1st Qtr 2nd Qtr 3rd Qtr 4th Qtr Gross Sales Tax Collections (Millions) FY 2015-16 Actual FY 2016-17 Actual FY 2017-18 Actual FY 2018-19 Actual FY 2019-20 Actual 196 Certificates of Occupancy Outlook Cautious Source: City of Denton's Development Services Department. Description:Certificates of Occupancy (CO) are permits issued in compliance with the 2009 International Building Code (IBC)and applicable City ordinances. The IBC states, "that no building shall be used or occupied,and no change in the existing occupancy classification of a building or structure or portion thereof shall be made, until the building official has issued a certificate of occupancy." Certificates of Occupancy ensure that applicable building, fire and consumer health codes are met. Analysis:Certificates of Occupancy are an economic indicator that provides a framework for the overall condition of the local economy. Certificates of Occupancy decreased 40.19%from the prior quarter and decreased 24.37% from the 4th Quarter of 2019. Staff has rated the outlook for this revenue indicator as Cautious. 0.0 20.0 40.0 60.0 80.0 100.0 120.0 140.0 4Q '15 1Q '16 2Q '16 3Q '16 4Q '16 1Q '17 2Q '17 3Q '17 4Q '17 1Q '18 2Q '18 3Q '18 4Q '18 1Q '19 2Q '19 3Q '19 4Q '19 1Q '20 2Q '20 3Q '20 4Q '20 Certificates of Occupancy 197 Residential Permits Outlook Cautious Source: City of Denton's Development Services Department. Description:Residential Permits are issued in compliance with the 2009 International Residential Code (IRC)and applicable City ordinances. The data presented in this analysis only include new permits issued and not remodels/alterations. Analysis:Residential Permits are an economic indicator that provides a framework for the overall condition of the local economy.In particular, residential permits have a direct correlation with building inspection fees and appraised values. Residential permits decreased 2.33%from the prior quarter and decreased 29.29%from the 4th Quarter of 2019. Staff has rated the outlook for this revenue indicator as Cautious. 0.0 50.0 100.0 150.0 200.0 250.0 300.0 350.0 4Q '15 1Q '16 2Q '16 3Q '16 4Q '16 1Q '17 2Q '17 3Q '17 4Q '17 1Q '18 2Q '18 3Q '18 4Q '18 1Q '19 2Q '19 3Q '19 4Q '19 1Q '20 2Q '20 3Q '20 4Q '20 Residential Permits 198 Texas Leading Indicators Index Outlook Cautious Source: Federal Reserve Bank of Dallas Description:The Texas Leading Indicators Index is a single weighted summary statistic that sheds light on the future of the state's economy. The index is designed to signal movements and changes in the state's rate of growth. The index includes the following leading indicators: Texas Value of the Dollar, U.S. Leading Index, Real Oil Prices, Well Permits, Initial Claims for Unemployment Insurance, Texas Stock Index, Help-Wanted Advertising,and Average Weekly Hours Worked in Manufacturing. Analysis:Texas Leading Indicators provide a framework for the overall condition of the local economy. Data for this quarter shows a decrease in the state's rate of growth. The index increased 7.27%from the prior quarter and decreased 13.08% from the 4th Quarter of 2018-19. Staff has rated this indicator as Cautious. 100.0 105.0 110.0 115.0 120.0 125.0 130.0 135.0 140.0 4Q '13 2Q '14 4Q '14 2Q '15 4Q '15 2Q '16 4Q '16 2Q '17 4Q '17 2Q '18 4Q '18 2Q '19 4Q '19 2Q '20 4Q '20 Texas Leading Indicators Index 199 Unemployment Rate Index Outlook Positive Description:Unemployment is defined as the number or proportion of people looking for work at the prevailing wage who are unable to find employment. Analysis: Unemployment is an economic indicator that provides a framework for the overall condition of the national, state and local economies. The unemployment rate for the City of Denton is at 6.6%for the 4th Quarter. As a result of the downward unemployment trend, staff has rated the outlook indicator as Positive. Note:U6 unemployment includes marginally attached workers who currently are neither working nor looking for work but indicate that they want and are available for a job and have looked for work sometime in the recent past. Discouraged workers, a subset of the marginally attached, have given a job-market related reason for not looking currently for a job. Persons employed part-time for economic reasons are those who want and are available for full-time work but have had to settle for a part-time schedule. Source: Federal Reserve Bank of Dallas, U.S. Bureau of Labor Statistics, and Texas Workforce Commission 2.0 4.0 6.0 8.0 10.0 12.0 14.0 16.0 18.0 20.0 4Q '14 2Q '15 4Q '15 2Q '16 4Q '16 2Q '17 4Q '17 2Q '18 4Q '18 2Q '19 4Q '19 2Q '20 4Q '20 Unemployment Rate Index Dallas-Plano-Irving MD Denton Texas U6 Unemployment United States 200 Section 4 City of Denton Quarterly Financial Report September 2020 INVESTMENT REPORT 201 4th Fiscal Quarter 2020- September 30, 2020 Page 1 INVESTMENT POOL 3ROLF\ 3DU 0DUNHW %RRN 8QUHDOL]HG 0D[%HQFKPDUN 3RUWIROLR9DOXH 9DOXH 9DOXH *DLQ/RVV:$0 :$0 <70 <LHOG ,QYHVWPHQW3RRO *Twelve month moving average of a one year U.S. T-bill yield RI7RWDO 3DU 0DUNHW %RRN 8QUHDOL]HG 3RUWIROLR 3ROLF\ 6HFXULWLHV%\,QYHVWPHQW7\SH9DOXH 9DOXH 9DOXH *DLQ/RVV:$0 <70 %RRN9DOXH0D[ 867UHDVXULHV 86)HGHUDO$JHQFLHV 0XQLFLSDO%RQGV &HUWLILFDWHVRI'HSRVLW &RPPHUFLDO3DSHU /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO3RUWIROLR &XUUHQW 0RQWKV$JR 0RQWK <HDU$JR ,QYHVWPHQW3RRO&RPSDULVRQV 'LIIHUHQFH 3DU9DOXH 0DUNHW9DOXH %RRN9DOXH 8QUHDOL]HG*DLQ/RVV :HLJKWHG$YHUDJH0DWXULW\ <LHOGWR0DWXULW\ 3RUWIROLR&RPSRVLWLRQ 867UHDVXULHV 86)HGHUDO$JHQFLHV 0XQLFLSDO%RQGV &HUWLILFDWHVRI'HSRVLW &RPPHUFLDO3DSHU /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV %DQN&ROODWHUDO5HYLHZ ,QVWLWXWLRQ &ROODWHUDO7\SH 0DUNHW9DOXH &ROOHFWHG%DODQFH &ROODWHUDO5DWLR :HOOV)DUJR'HPDQG'HSRVLWV %1<0HOORQ 86$JHQF\0%6 ! **Does not include FDIC insurance 'HSRVLWRU\/HGJHU%DODQFH5HYLHZ ,QVWLWXWLRQ $FFRXQW7\SH %HJLQQLQJ%DO 'HSRVLWV (QGLQJ%DO :HOOV)DUJR%DQN &KHFNLQJ :HOOV)DUJR%DQN &KHFNLQJ &RPSOLDQFH6WDWHPHQW 5HYLHZ CITY OF DENTON : QUARTERLY INVESTMENT REPORT <HDU$JR 'LIIHUHQFH 8QUHDOL]HG JDLQORVV LV WKH GLIIHUHQFH EHWZHHQ WKH PDUNHW DQG ERRN YDOXH DQG GRHV QRW UHSUHVHQW DQ DFWXDO JDLQ RU ORVV *DLQV DQG ORVVHV DUH UHDOL]HGRQO\ ZKHQ D VHFXULW\ LV VROG SULRU WR PDWXULW\ 6LQFH LW LV WKH &LW\ V SUDFWLFH WR KROG LQYHVWPHQWV XQWLO WKH\ PDWXUH WKH WHPSRUDU\ JDLQV DQG ORVVHV DUH XQOLNHO\ WR EH UHDOL]HG :LWKGUDZDOV 7KH 4XDUWHUO\ ,QYHVWPHQW 5HSRUW LV LQ IXOO FRPSOLDQFH ZLWK WKH REMHFWLYHV UHVWULFWLRQV DQG VWUDWHJLHV DV VHW IRUWK LQ WKH &LW\ RI 'HQWRQ V ,QYHVWPHQW 3ROLF\ DQG WKH 3XEOLF)XQGV,QYHVWPHQW$FW7H[DV*RYHUQPHQW&RGH&KDSWHU $SSURYHU'DYLG*DLQHV 3OHGJH5HTXLUHG Assistant Director of Finance 5HYLHZHU1LFKRODV9LQFHQW Chief Financial Officer Director of Finance $SSURYHU&DVVDQGUD2JGHQ 5HYLHZHU5DQGHH.OLQJHOH Treasury Manager 3UHSDUHU0DWW+DPLOWRQ Treasury Analyst 202 4th Fiscal Quarter 2020- September 30, 2020 Page 2 INVESTMENT POOL &XUUHQW 0RQWKV$JR 0RQWK <HDU$JR <HDU 'LIIHUHQFH 'LIIHUHQFH 3DU9DOXH867UHDVXULHV 3DU9DOXH86)HGHUDO$JHQFLHV 3DU9DOXH0XQLFLSDO%RQGV &HUWLILFDWHVRI'HSRVLW 3DU9DOXH&RPPHUFLDO3DSHU /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO3DU9DOXH 0DUNHW9DOXH867UHDVXULHV 0DUNHW9DOXH86)HGHUDO$JHQFLHV 0DUNHW9DOXH0XQLFLSDO%RQGV &HUWLILFDWHVRI'HSRVLW 0DUNHW9DOXH&RPPHUFLDO3DSHU /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO0DUNHW9DOXH %RRN9DOXH867UHDVXULHV %RRN9DOXH86)HGHUDO$JHQFLHV %RRN9DOXH0XQLFLSDO%RQGV &HUWLILFDWHVRI'HSRVLW %RRN9DOXH&RPPHUFLDO3DSHU /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO%RRN9DOXH $FFUXHG,QWHUHVW &DVK9DOXH 7RWDO0DUNHW9DOXH$FFUXHG,QWHUHVW 8QUHDOL]HG*DLQ/RVV &KDQJHLQ)DLU9DOXHIRUWKH4XDUWHU *$6% 6WUDWHJ\6WDWHPHQW CITY OF DENTON : QUARTERLY INVESTMENT REPORT 7KH LQYHVWPHQW SRRO LV DQ DJJUHJDWLRQ RI WKH PDMRULW\ RI &LW\ IXQGV ZKLFK PD\ LQFOXGH WD[ UHFHLSWV HQWHUSULVH IXQG UHYHQXHV ILQH DQG IHH LQFRPH DV ZHOO DV VRPH EXW QRW QHFHVVDULO\ DOO ERQG SURFHHGV JUDQWV JLIWV DQG HQGRZPHQWV 7KLV SRUWIROLR LV PDLQWDLQHG WR PHHW DQWLFLSDWHG GDLO\ FDVK QHHGV IRU WKH &LW\ V RSHUDWLRQV FDSLWDO SURMHFWV DQG GHEW VHUYLFH ,Q RUGHU WR PHHW WKHVH REOLJDWLRQV DQG WR PLQLPL]H SRWHQWLDO OLTXLGDWLRQ ORVVHVWKH GROODUZHLJKWHG VWDWHG DYHUDJH PDWXULW\ RI WKH LQYHVWPHQW SRRO VKDOO QRW H[FHHG \HDUV RU GD\V 7KH REMHFWLYHV RI WKLV SRUWIROLR DUH WR HQVXUHVDIHW\RISULQFLSDOE\LQYHVWLQJLQRQO\KLJKTXDOLW\VHFXULWLHVIRUZKLFKDVWURQJVHFRQGDU\PDUNHWH[LVWVHQVXUHWKDWDQWLFLSDWHGFDVKIORZ QHHGV DUH PDWFKHG ZLWK DGHTXDWH LQYHVWPHQW OLTXLGLW\ OLPLW PDUNHW DQG FUHGLW ULVN WKURXJK GLYHUVLILFDWLRQ DQG DWWDLQ WKH EHVW IHDVLEOH \LHOG FRPPHQVXUDWH ZLWK WKH REMHFWLYHV DQG UHVWULFWLRQV VHW IRUWK LQ WKH ,QYHVWPHQW 3ROLF\ E\ DFWLYHO\ PDQDJLQJ WKH SRUWIROLR WR PHHW RU H[FHHG WKH WZHOYH PRQWKPRYLQJDYHUDJH\LHOGRIDRQH\HDU867UHDVXU\ELOODVGHULYHGIURPWKH)HGHUDO5HVHUYH6WDWLVWLFDO5HOHDVH+IRUFRQVWDQWPDWXULWLHV 203 4th Fiscal Quarter 2020- September 30, 2020 Page 3 INVESTMENT POOL (Based on Book Value) &XUUHQW 0RQWKV$JR <HDU$JR 6XPPDU\%\6HFXULW\7\SH 867UHDVXULHV&RXSRQ 86)HGHUDO$JHQFLHV$PRUW 86)HGHUDO$JHQFLHV&RXSRQ 86)HGHUDO$JHQFLHV&DOODEOH 0XQLFLSDO%RQGV&RXSRQ &HUWLILFDWHVRI'HSRVLW&'$56 &HUWLILFDWHVRI'HSRVLW6/2& &RPPHUFLDO3DSHU'LVFRXQW /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO%RRN9DOXH 2EMHFWLYH &XUUHQW 0RQWKV$JR <HDU$JR 6XPPDU\%\6HFXULW\7\SH 867UHDVXULHV&RXSRQ 86)HGHUDO$JHQFLHV$PRUW 86)HGHUDO$JHQFLHV&RXSRQ 86)HGHUDO$JHQFLHV&DOODEOH 0XQLFLSDO%RQGV&RXSRQ &HUWLILFDWHVRI'HSRVLW&'$56 &HUWLILFDWHVRI'HSRVLW6/2& &RPPHUFLDO3DSHU'LVFRXQW /RFDO*RYHUQPHQW,QYHVWPHQW3RROV 'HPDQG'HSRVLWV 7RWDO CITY OF DENTON : QUARTERLY INVESTMENT REPORT 7KH SRUWIROLR LV UHVWULFWHG WR 86 7UHDVXULHV DQG DJHQF\ VHFXULWLHV PDWXULQJ LQ OHVV WKDQ ILYH \HDUV VWDWH DQG ORFDOO\ LVVXHG 7H[DV PXQLFLSDO ERQGV UDWHG $$ RU EHWWHU PDWXULQJ LQ OHVV WKDQ WKUHH \HDUV LQVXUHG FROODWHUDOL]HG RU VWDQGE\ OHWWHU RI FUHGLW EDFNHG FHUWLILFDWHV RI GHSRVLW PDWXULQJ LQ OHVVWKDQWKUHH \HDUV FROODWHUDOL]HG UHSXUFKDVH DJUHHPHQWV PDWXULQJ LQ OHVV WKDQ WKLUW\ GD\V FRPPHUFLDO SDSHU UDWHG $3 RU EHWWHU PDWXULQJ LQ OHVV WKDQ GD\V DQGORFDOJRYHUQPHQWSRROV 6(&UHJLVWHUHGJRYHUQPHQWPRQH\PDUNHWPXWXDOIXQGVZHLJKWHGDYHUDJHPDWXULW\RIOHVVWKDQGD\V h͘^͘dƌĞĂƐƵƌŝĞƐͲ ŽƵƉŽŶ Ϯϭ͘Ϯϲй h͘^͘&ĞĚĞƌĂůŐĞŶĐŝĞƐͲ ŽƵƉŽŶ ϯϭ͘ϲϯй h͘^͘&ĞĚĞƌĂůŐĞŶĐŝĞƐͲ ĂůůĂďůĞ Ϭ͘ϬϬй ŽŵŵĞƌĐŝĂůWĂƉĞƌͲ ŝƐĐŽƵŶ ϳ͘ϰϬй >ŽĐĂů'ŽǀĞƌŶŵĞŶƚ/ŶǀĞƐƚŵĞŶƚWŽŽůƐ ϯϱ͘ϰϮй DƵŶŝĐŝƉĂůŽŶĚƐͲ ŽƵƉŽŶ Ϯ͘ϯϳй ĞŵĂŶĚĞƉŽƐŝƚƐ ϭ͘ϵϮй &XUUHQW 204 4th Fiscal Quarter 2020- September 30, 2020 Page 4 INVESTMENT POOL (Based on Book Value) &XUUHQW 0RQWKV$JR <HDU$JR 6XPPDU\%\,VVXHU %$</256&277 '$//$67;:75 6:55(9%'6 ))&% )+/% )+/0& )10$ ,1'(3(1'(17%$1.&'V -3025*$16(&85,7,(6//& .$,6(5 1(67/(),1$1&(,17//7' 1257+:(67(5181,9(56,7< 3/$12,6'%/'* 5%& 67$7(2)&$/,)251,$ 67$7(2)7(;$6 7(;322/ 7(;67$5 72<27$02725&5(',7&253 8675($685< 81,9(56,7<2)1257+&$52/,1$ :(//6)$5*2'(0$1''(326,76 7RWDO%RRN9DOXH 2EMHFWLYH &XUUHQW0RQWKV$JR <HDU$JR 6XPPDU\%\,VVXHU %$</256&277 '$//$67;:75 6:55(9%'6 ))&% )+/% )+/0& )10$ ,1'(3(1'(17%$1.&'V -3025*$16(&85,7,(6//& .$,6(5 1(67/(),1$1&(,17//7' 1257+:(67(5181,9(56,7< 3/$12,6'%/'* 5%& 67$7(2)&$/,)251,$ 67$7(2)7(;$6 7(;322/ 7(;67$5 72<27$02725&5(',7&253 8675($685< 81,9(56,7<2)1257+&$52/,1$ :(//6)$5*2'(0$1''(326,76 7RWDO *Formerly, ViewPoint Bank CITY OF DENTON : QUARTERLY INVESTMENT REPORT ,WLVWKHSROLF\RIWKH&LW\WRGLYHUVLI\LWVLQYHVWPHQWSRUWIROLRE\UHVWULFWLQJLQYHVWPHQWVLQDVLQJOHLVVXHULQVWLWXWLRQWRQRPRUHWKDQSHUFHQWRIWKHSRUWIROLR VWRWDOERRNYDOXHDQG WRWKRVHRIIHULQJUHSXUFKDVHDJUHHPHQWVFROODWHUDOL]HG&'VLQFOXGLQJVWDQGE\OHWWHUVRIFUHGLWDQGORFDORUVWDWHRI7H[DVPXQLFLSDOVHFXULWLHVWRQRJUHDWHUWKDQSHUFHQW 7KHSXUSRVHRIWKLVUHTXLUHPHQWLVWROLPLWPDUNHWDQGFUHGLWULVN&RPPHUFLDOSDSHULVVXHUVDUHIXUWKHUUHVWULFWHGE\DSHUFHQWWRWDOSRUWIROLROLPLWDWLRQ7KHUHDUHQRLVVXHU OLPLWDWLRQVRQ867UHDVXULHVRU)',&LQVXUHGSURGXFWVH[FHSWDVWKH\SHUWDLQWRWKHRYHUDOOFHUWLILFDWHVRIGHSRVLWDQGVDYLQJVGHSRVLWUHVWULFWLRQV6RPHLQYHVWPHQW W\SHVPD\EHIXUWKHUOLPLWHG ϭ͘ϲϰй ϭϰ͘ϰϬй ϵ͘ϳϳй Ϯ͘ϰϴй ϰ͘ϵϴйϬ͘ϲϳйϬ͘ϴϮйϬ͘ϴϮй ϭ͘ϳϬй ϰ͘ϭϭй ϯϭ͘ϯϭй Ϯ͘ϰϳй Ϯϭ͘Ϯϲй ϭ͘ϲϱй ϭ͘ϵϮй ƵƌƌĞŶƚ ϬϵͬϯϬͬϮϬϮϬ z>KZ^Kdd && &,> &,>D &ED W>EK/^Ͳ>' Z ^ddK&>/&KZE/ ^ddK&dy^ dyWKK> dy^dZ dKzKdDKdKZZ/dKZW h͘^͘dZ^hZz hE/sZ^/dzK&EKZd,ZK>/E t>>^&Z'KDEWK^/d^ 205 4th Fiscal Quarter 2020- September 30, 2020 Page 5 INVESTMENT POOL (Based on Par Value) &XUUHQW 0RQWKV$JR <HDU$JR 0DWXULW\7LPH)UDPH 0RQWKV 0RQWKV 0RQWKV 0RQWKV 0RQWKV 2YHU 7RWDO3DU9DOXH 2EMHFWLYH &XUUHQW 0RQWKV$JR <HDU$JR 0DWXULW\7LPH)UDPH 0RQWKV 0RQWKV 0RQWKV 0RQWKV 0RQWKV 2YHU 7RWDO CITY OF DENTON : QUARTERLY INVESTMENT REPORT 7KH ULVN RI PDUNHW SULFH YRODWLOLW\ LV PLQLPL]HG WKURXJK PDWXULW\ GLYHUVLILFDWLRQ ,QYHVWPHQW PDWXULWLHV DUH VWDJJHUHG WR SURYLGH FDVK IORZV EDVHGRQ WKH DQWLFLSDWHG QHHGV RI WKH &LW\ /LTXLGLW\ LV DFKLHYHG E\ PDWFKLQJ LQYHVWPHQW PDWXULWLHV ZLWK IRUHFDVWHG FDVK GLVEXUVHPHQWV DQG E\ LQYHVWLQJ LQ VHFXULWLHV ZLWK DFWLYH VHFRQGDU\ PDUNHWV 6KRUWWHUP ORFDO JRYHUQPHQW LQYHVWPHQW SRROV DQG JRYHUQPHQW PRQH\ PDUNHW PXWXDO IXQGV KHOS WR SURYLGHGDLO\OLTXLGLW\DQGPD\EHXWLOL]HGDVDFRPSHWLWLYHDOWHUQDWLYHWRRWKHUIL[HGLQFRPHLQYHVWPHQWV &XUUHQW 0RQWKV$JR <HDU$JR 0RQWKV 0RQWKV 0RQWKV 0RQWKV 2YHU 206 4th Fiscal Quarter 2020- September 30, 2020 Page 6 ECONOMIC SUMMARY Interest Rate History 6RXUFH86)HGHUDO5HVHUYH6WDWLVWLFDO 5HOHDVH+ 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 0DUNHW6HFWRU$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ )HG)XQGVHIIHFWLYH 0RQWK867%LOO <HDU8671RWH 3RUWIROLR%HQFKPDUN 3RUWIROLR<LHOG 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 0DUNHW6HFWRU$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ$YJ )HG)XQGVHIIHFWLYH 0RQWK867%LOO <HDU8671RWH 3RUWIROLR%HQFKPDUN 3RUWIROLR<LHOG *Twelve month moving average of a one year U.S. T-bill yield )LVFDO<HDU QUARTERLY COMMENTARY 09/30/2020 QG4XDUWHU UG4XDUWHU WK4XDUWHU 6RXUFH+LOOWRS6HFXULWLHV$VVHW 0DQDJHPHQW(FRQRPLF6XPPDU\ CITY OF DENTON : QUARTERLY INVESTMENT REPORT )LVFDO<HDU)LVFDO<HDU)LVFDO<HDU )LVFDO<HDUWR'DWH(DUQLQJV 0RQWKV 0RQWKV 0RQWKV 0RQWKV 7KHSRUWIROLRZDVLQFRPSOLDQFHZLWKWKH&LW\ V,QYHVWPHQW3ROLF\GXULQJWKHIRXUWKTXDUWHU,Q-XO\WKHUHZHUHIRXUPDWXULWLHV WRWDOLQJPLOOLRQDORQJZLWKPLOOLRQLQSXUFKDVHV,Q$XJXVWWKHUHZHUHILYHPDWXULWLHVWRWDOLQJPLOOLRQZLWK SXUFKDVHVWRWDOLQJPLOOLRQ'XULQJ6HSWHPEHUWKUHHLQYHVWPHQWVPDWXUHGWRWDOLQJPLOOLRQDQGWZRQHZLQYHVWPHQWV ZHUHSXUFKDVHGWRWDOLQJPLOOLRQ7KHSRUWIROLR VZHLJKWHGDYHUDJH\LHOGUHPDLQVKLJKHUWKDQWKHEHQFKPDUNPRQWK 7UHDVXU\ELOOLQGH[E\EDVLVSRLQWV,QYHVWPHQWVDQGGHSRVLWVZLWKGDLO\OLTXLGLW\ZDV)HGRIILFLDOVDVH[SHFWHGOHIW WKHLUPRQHWDU\SROLF\XQFKDQJHGDWWKH6HSWHPEHU)20&PHHWLQJ7KHFRPPLWWHHSOHGJHGWRVHHNPD[LPXPHPSOR\PHQWDQG PDLQWDLQLWVDFFRPPRGDWLYHSROLF\VWDQFHXQWLOLQIODWLRQLVDYHUDJLQJPRGHUDWHO\DERYHLWVWDUJHWIRUVRPHWLPH6WDIIZLOO FRQWLQXHWRPRQLWRUWKHLQYHVWPHQWSRUWIROLRDQGHQVXUHFRPSOLDQFHZLWKWKH&LW\ V,QYHVWPHQW3ROLF\DQGWKH3XEOLF)XQGV ,QYHVWPHQW$FW )LVFDO<HDU VW4XDUWHU )LVFDO<HDU)LVFDO<HDU 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS 'HF 0DU -XQ 6HS )HG)XQGV 0RQWK7%LOO <HDU71RWH 3RUWIROLR<LHOG 3RUWIROLR%HQFKPDUN )<)<)< )<)<)< 207 Days to Maturity Page 1 Par Value Book Value Maturity Date Stated RateMarket Value September 30, 2020 Portfolio Details - Investments Average BalanceIssuer Portfolio Management Monthly Reports YTM 365CUSIPInvestment # Purchase Date Treasury Securities - Coupon 106U.S. TREASURY4011 5,000,000.00 4,992,720.42 01/15/20212.00002/04/2019 5,027,345.00 2.5179128283Q1 122U.S. TREASURY4016 15,000,000.00 15,006,478.95 01/31/20212.50004/10/2019 15,118,365.00 2.3669128285X4 75U.S. TREASURY4022 5,000,000.00 4,997,013.17 12/15/20201.87505/31/2019 5,017,970.00 2.1739128283L2 137U.S. TREASURY4024 10,000,000.00 10,003,761.48 02/15/20212.25005/31/2019 10,079,300.00 2.1469128283X6 272U.S. TREASURY4026 10,000,000.00 9,949,017.14 06/30/20211.12506/17/2019 10,075,000.00 1.826912828S27 137U.S. TREASURY4033 10,000,000.00 10,012,029.18 02/15/20212.25007/31/2019 10,079,300.00 1.9229128283X6 137U.S. TREASURY4039 10,000,000.00 10,017,428.46 02/15/20212.25009/12/2019 10,079,300.00 1.7759128283X6 287U.S. TREASURY4040 10,000,000.00 10,070,068.36 07/15/20212.62509/12/2019 10,196,880.00 1.715912828Y20 137U.S. TREASURY4042 10,000,000.00 10,014,698.68 02/15/20212.25009/17/2019 10,079,300.00 1.8499128283X6 318U.S. TREASURY4043 10,000,000.00 10,028,652.18 08/15/20212.12509/17/2019 10,174,220.00 1.788912828RC6 122U.S. TREASURY4046 5,000,000.00 5,007,716.77 01/31/20212.12511/01/2019 5,033,205.00 1.654912828B58 287U.S. TREASURY4047 5,000,000.00 5,036,651.14 07/15/20212.62511/25/2019 5,098,440.00 1.675912828Y20 334U.S. TREASURY4048 5,000,000.00 4,975,827.88 08/31/20211.12511/25/2019 5,044,920.00 1.6649128282F6 379U.S. TREASURY4049 4,000,000.00 4,049,692.26 10/15/20212.87511/25/2019 4,113,436.00 1.6539128285F3 349U.S. TREASURY4053 5,000,000.00 5,054,774.69 09/15/20212.75001/08/2020 5,124,610.00 1.5819128285A4 137U.S. TREASURY4064 10,000,000.00 10,041,436.39 02/15/20212.25003/02/2020 10,079,300.00 1.1339128283X6 129,257,967.15 1.860130,420,891.00129,000,000.00129,274,646.18Subtotal and Average 197 Federal Agency Issues - Coupon 410FFCB40067,500,000.00 7,516,804.56 11/15/20213.05012/12/2018 7,744,577.40 2.8403133EJT74 102FFCB40095,000,000.00 4,999,827.83 01/11/20212.55002/04/2019 5,033,548.10 2.5623133EJ4Q9 1,054FFCB401310,000,000.00 9,999,422.22 08/21/20232.57002/21/2019 10,674,111.20 2.5723133EKAU0 516FFCB401510,000,000.00 9,999,303.21 03/01/20222.55003/01/2019 10,337,048.00 2.5553133EKBV7 186FFCB401915,000,000.00 15,015,484.88 04/05/20212.54005/07/2019 15,182,785.20 2.3323133EJJD2 76FFCB40235,000,000.00 5,002,202.70 12/16/20202.40005/31/2019 5,023,913.15 2.1843133EKHA7 438FFCB405410,000,000.00 10,000,870.22 12/13/20211.58001/08/2020 10,171,325.60 1.5723133ELDU5 477FFCB405610,000,000.00 10,020,256.34 01/21/20221.60001/31/2020 10,187,819.80 1.4423133ELHR8 315FFCB407210,000,000.00 9,999,375.22 08/12/20210.16005/14/2020 9,999,901.60 0.1673133ELZE7 594FFCB40765,000,000.00 4,991,443.03 05/18/20220.16005/28/2020 4,999,437.35 0.2653133ELZN7 130FHLB40293,945,000.00 3,946,823.48 02/08/20212.10007/12/2019 3,972,935.14 1.966313376XN0 162FHLB403010,000,000.00 9,990,769.33 03/12/20211.75007/12/2019 10,072,743.60 1.960313382K69 0FHLB404110,000,000.00 10,000,000.00 10/01/20202.62509/12/2019 10,000,000.00 1.8193130AEWA4 253FHLB406310,000,000.00 10,085,239.65 06/11/20212.25003/02/2020 10,146,740.60 1.0113130A1W95 642FHLB406710,000,000.00 10,221,249.94 07/05/20221.95503/16/2020 10,312,914.80 0.0693130ABCY0 365FHLB40685,000,000.00 5,000,000.00 10/01/20210.32004/02/2020 5,009,967.65 0.3203130AJGL7 445FHLB407010,000,000.00 10,157,720.20 12/20/20211.62504/16/2020 10,182,894.60 0.3273130AHSR5 228FHLMC402710,080,000.00 10,058,275.70 05/17/20211.57006/17/2019 10,171,610.67 1.9213134G9HB6 615FHLMC40785,000,000.00 4,998,382.47 06/08/20220.25006/15/2020 5,006,903.70 0.2693134GVJ66 Portfolio CITY APData Updated: SET_MO: 10/29/2020 18:05 Run Date: 10/29/2020 - 18:08 PM (PRF_PM2) 7.3.0 Report Ver. 7.3.6.1 208 Days to Maturity Page 2 Par Value Book Value Maturity Date Stated RateMarket Value September 30, 2020 Portfolio Details - Investments Average BalanceIssuer Portfolio Management Monthly Reports YTM 365CUSIPInvestment # Purchase Date Federal Agency Issues - Coupon 29FNMA400110,000,000.00 10,000,117.68 10/30/20202.87511/30/2018 10,022,481.20 2.8593135G0U84 461FNMA406610,000,000.00 10,163,551.93 01/05/20222.00003/16/2020 10,238,385.40 0.6933135G0S38 194FNMA407110,000,000.00 10,125,062.61 04/13/20212.50005/14/2020 10,124,737.00 0.1523135G0U27 192,292,183.20 1.476194,616,781.76191,525,000.00195,659,234.96Subtotal and Average 352 Municipal Bonds - Coupon 137PLANO ISD-BLDG4074 4,000,000.00 4,070,902.81 02/15/20215.00005/22/2020 4,071,920.00 0.231727199XZ9 329TEXAS STATE GENERAL OBLIGATION4083 10,000,000.00 10,340,855.03 08/26/20214.00009/02/2020 10,342,600.00 0.211882724SY4 14,411,757.84 0.21714,414,520.0014,000,000.0014,088,755.98Subtotal and Average 275 Commercial Paper Disc. - Amortizing 61BAYLOR SCOTT4086 10,000,000.00 9,997,288.89 12/01/20200.16009/22/2020 9,997,870.00 0.16207287CM17 48State of California4084 5,000,000.00 5,000,000.00 11/18/202008/20/2020 4,999,950.00 0.00013068BGB7 36RBC40585,000,000.00 4,992,150.00 11/06/20201.57002/13/2020 4,998,625.00 1.63178009AL69 97TOYOTA MOTOR CREDIT4079 5,000,000.00 4,996,093.06 01/06/20210.29007/10/2020 4,993,840.00 0.29489233GN69 117TOYOTA MOTOR CREDIT4080 10,000,000.00 9,989,925.00 01/26/20210.31007/29/2020 9,985,130.00 0.31589233GNS1 60University of North Carolina4085 10,000,000.00 10,000,000.00 11/30/202008/31/2020 9,999,700.00 0.00009657TJF1 44,975,456.95 0.32044,975,115.0045,000,000.0049,637,189.26Subtotal and Average 73 Local Govt Investment Pools 1LOCAL GOVT INV POOL - TEXPOOL3996 25,000,000.00 25,000,000.00 0.15325,000,000.00 0.153SYS3996 1LOCAL GOVT INV POOL - TEXSTAR3641 190,372,945.78 190,372,945.78 0.116190,372,945.78 0.116SYS3641 215,372,945.78 0.120215,372,945.78215,372,945.78171,918,264.17Subtotal and Average 1 Demand Deposits 1DEMAND DEPOSITS - WELLS FARGO3706 4,082,691.29 4,082,691.29 0.2504,082,691.29 0.250SYS3706 1DEMAND DEPOSITS - WELLS FARGO4082 7,620,136.03 7,620,136.0307/23/2020 7,620,136.03 0.000SYS4082 11,702,827.32 0.08711,702,827.3211,702,827.3210,811,377.83Subtotal and Average 1 0.935571,389,468.38 606,600,773.10 165611,503,080.86 608,013,138.24Total and Average Portfolio CITY APData Updated: SET_MO: 10/29/2020 18:05 Run Date: 10/29/2020 - 18:08 PM (PRF_PM2) 7.3.0209 Days to Maturity Page 3 Par Value Book Value Stated RateMarket Value September 30, 2020 Portfolio Details - Cash Average BalanceIssuer Portfolio Management Monthly Reports YTM 365CUSIPInvestment # Purchase Date 0.00 0.935571,389,468.38 606,600,773.10 165 0Average Balance 611,503,080.86 608,013,138.24Total Cash and Investments Portfolio CITY APData Updated: SET_MO: 10/29/2020 18:05 Run Date: 10/29/2020 - 18:08 PM (PRF_PM2) 7.3.0210 211 Council Requests for InformationCouncil Member Requestor DateSummary of RequestStaff AssignedDepartmentComments1Council Member Meltzer01/03/21Can staff look into a concern with a business parking a vehicle advertising on the Square?Stephanie BerryLegalInformation will be provided in a future Friday Report2Mayor Pro Tem Davis01/07/21Do we know when Georgetown Dr. will be repaired after the recent utility work there?Antonio PuenteWastewaterInformation will be provided in the January 15 Friday Report3Council Member Armintor01/08/21What would it take for the City to become an Bird City Texas?Katherine BarnettEnvironmental ServicesInformation will be provided in a future Friday Report4Council Member Armintor01/10/21Can staff clarify when building permits are needed for the properties included in the NAA?Scott McDonaldDevelopment ServicesInformation will be provided in a future Friday Report5Council Member Meltzer01/11/21Can staff provide information regarding the COVID-19 wastewater testing that is included in anemail from residentAntonio PuenteWastewaterInformation will be provided in the January 15 Friday Report6Council Member Armintor01/11/21Can staff provide information regarding the COVID-19 wastewater testing that is included in anemail from residentAntonio PuenteWastewaterInformation will be provided in the January 15 Friday Report7Council Member Armintor01/11/21Was the MLK, Jr. Rec Center closed on Sunday during the cold weather?Gary PackanPublic Works -ParksInformation will be provided in a future Friday Report8Mayor Pro Tem Davis01/12/21Can we look at ways to make the center turn lane on Malone more safe? Specifically how to keepfolks from using it as a passing lane?Brian JahnPublic Works-TrafficInformation will be provided in a future Friday Report9Mayor Hudspeth01/14/21Would staff support and are there funds for a protected bike lane - from the Katy trail to Teasleystreet? I believe the street is wide enough to support this modification. This would move the citytowards the plan to connect to the South lakes park & move towards connecting Township II to theRail Trail.Gary PackanPublic Works -ParksInformation will be provided in a future Friday Report10Council Member Meltzer01/15/21Does staff feel there would be merit to requiring asbestos surveys in residential demolitions and whyor why notScott McDonaldDevelopment ServicesInformation will be provided in a future Friday Report212 January 2021 Sun Mon Tue Wed Thu Fri Sat 1 New Year’s Day Holiday 2 3 4 9:00 am COE Cancelled 12:00 pm Council Luncheon 5 3:00 pm CC Work Session 6:30 pm CC Regular Session 6 No ‐ 2:30pm Agenda Committee 5:00pm P&Z Work Session 6:30pm P&Z Regular Session 7 8 9 10 11 9:00 am PUB Cancelled – Traffic Safety 12pm HLC 3pm 12 Special Called Council 3:00 pm 13 TIRZ2 11am Cancelled - 11:30 a.m. EDPB Cancelled ‐ 2:30pm Agenda Committee Cancelled - 5:30 pm - AAB 14 11:00 pm - AAB 15 16 17 18 MLK Day Holiday 19 No Council Meeting Civil Service Comm 3:30pm 20 9:00 am Mobility Committee Meeting – Canceled Cancelled ‐ 2:30pm Agenda committee 4:30pm P&Z Work Session 6:30pm P&Z Regular Session 21 3:00 pm CoPwD 22 23 24 25 9:00 am PUB 26 10:00 am - CAC 2:00 pm 4th Tuesday Session 27 12:00 p.m. TIRZ No.1 28 3:00 pm Board of Ethics Mtg 29 30 31 213 February 2021 Mon Tue Wed Thu Fri Sat 1 9:00 am COE 11:30 am Council Luncheon 2 10:00 am Community Engagement Meeting 2:00 pm CC Work Session 6:30 pm CC Regular Session 3 4 8:30 a.m. DEDC 12:00 pm Bond Committee 5 6 7 8 9:00 am PUB 9 2:00 pm 2nd Tuesday Session 10 11:00 a.m. EDPB 2:30 pm Audit/Finance 5:30 pm - AAB 11 3:30 p.m. Library Board 12 13 14 15 16 2:00 pm CC Work Session 6:30 pm CC Regular Session 17 9:00 am Mobility Committee Meeting Animal Shelter Advisory 2pm 18 19 20 21 22 9:00 am PUB 23 10:00 am - CAC 2:00 pm 4th Tuesday Session 24 25 3:00 pm Board of Ethics 26 27 28 214 March 2021 Sun Mon Tue Wed Thu Fri Sat 1 9:00 am COE 11:30 am Council Luncheon 2 2:00 pm CC Work Session 6:30 pm CC Regular Session 10:00 am Community Engagement 3 11:30 am Traffic Safety Commission 4 8:30 a.m. DEDC 5 6 7 8 9:00 am PUB 9 No Council Meeting 10 11:00 a.m. EDPB 5:30 pm - AAB 11 3:30 p.m. Library Board 12 13 14 15 16 2:00 pm CC Work Session 6:30 pm CC Regular Session 17 9:00 am Mobility Committee Meeting 18 3:00 pm CoPwD 9:00 Community Partnership Committee 19 20 21 22 9:00 am PUB 23 10:00 am - CAC 2:00 pm 4th Tuesday Session 24 12:00 p.m. TIRZ No.1 25 26 27 28 29 30 No Council Meeting 31 215 City Council City of Denton Meeting Agenda City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com Council Work Session Room2:00 PMTuesday, January 26, 2021 Special Called Meeting WORK SESSION BEGINS AT 2:00 P.M. IN THE COUNCIL WORK SESSION ROOM CITY COUNCIL CONSIDERATION OF THE CONSENT AGENDA AND ITEMS FOR INDIVIDUAL CONSIDERATION WILL BEGIN IMMEDIATELY FOLLOWING THE WORK SESSION IN THE COUNCIL WORK SESSION ROOM Note: Mayor Gerard Hudspeth and Council Members Birdia Johnson, Connie Baker, Jesse Davis, John Ryan, Deb Armintor and Paul Meltzer will be participating in the work session, closed meeting and the meeting via video/teleconference. REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL Due to COVID-19 precautions, members of the public will not be able to attend the January 26, 2021, City Council meeting in-person. To accommodate and receive input on agenda items, citizens will be able to participate in one of the following ways (NOTE: Other than public hearings, citizens are only able to comment one time per agenda item; citizens cannot use both methods to comment on a single agenda item. Public comments are not held for work session reports.): • Virtual White Card – On January 22, the agenda was posted online at www.cityofdenton.com/publicmeetings. Once the agenda is posted, a link to the Virtual White Card, an online form, will be made available under the main heading on the webpage. Within this form, citizens may indicate support or opposition and submit a brief comment about a specific agenda item. Comments may be submitted up until the start of the meeting, at which time, the Virtual White Card form will be closed. Similar to when a citizen submits a white card to indicate their position on the item, these comment forms will be sent directly to City Council members and recorded by the City Secretary. City Council Members review comments received in advance of the meeting and take that public input into consideration prior to voting on an agenda item. The Mayor will announce the number of Comment Cards submitted in support or opposition to an item during the public comment period. Comments will not be read during the meeting. The City Secretary will reflect the number of comments submitted in favor/opposition to an item, the registrant’s name, address, and (summary of) comments within the Minutes of the Meeting, as applicable. OR Page 1 Printed on 1/15/2021 216 January 26, 2021City Council Meeting Agenda • By phone – Citizens wishing to speak over the phone during this Council meeting, may call (940) 349-7800 beginning 30 minutes prior to the meeting start time. Comments by phone will be accepted until the item is opened for discussion by the Council. When the call is initially received, a staff member will receive the caller’s information and either: 1) offer to call the citizen back when it is time for them to speak, or 2) record the caller’s information, support or opposition, and comment. If the caller chooses to record their support or opposition, rather than speaking during the meeting, the Mayor will announce the number of comments submitted in support or opposition to the item. If the caller wishes to receive a call back, the voice of each caller will be broadcast into the meeting during the public commenting time of their desired agenda item. Individuals will be able to comment once per agenda item, no matter the method. • At regular meetings only, citizens can speak on any topic that is not on the agenda (Open Microphone). Alert the call taker if you wish to speak under the Open Microphone category. If you would like to give a public report, see the information below. After determining that a quorum is present, the City Council of the City of Denton, Texas will convene in a Work Session on Tuesday, January 26, 2021, at 2:00 p.m. in the Council Work Session Room at City Hall, 215 E. McKinney Street, Denton, Texas at which the following items will be considered: WORK SESSION 1. Citizen Comments on Consent Agenda Items This section of the agenda allows citizens to speak on any item listed on the Consent Agenda prior to its consideration. Each speaker will be given a total of three (3) minutes to address any item(s). Any person who wishes to address the City Council regarding these items may do so by utilizing the "By Phone" registration process as referenced under the REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL detailed at the beginning of this agenda. Registration is required prior to the time the City Council considers this item. Registrants may call in and remain on hold or receive a call back at the time the Work Session is called to Order and are encouraged to ensure they remain accessible to accept the call. 2. Requests for clarification of agenda items listed on this agenda. 3. Work Session Reports Receive a report, hold a discussion, and give staff direction regarding an update to the City of Denton’s COVID-19 response. ID 20-2117A. Receive a report, hold a discussion, and give staff direction on plat review in the Extraterritorial Jurisdiction (ETJ) and possible updates to the Interlocal Agreement with Denton County. ID 20-1668B. Receive a report, hold a discussion, and give staff direction regarding the 2021 May General and June Runoff elections (if any) including locations, dates, and times. ID 20-2399C. Receive a report, hold a discussion, and give staff direction regarding a proposed plan for the annual City Council retreat. ID 21-122D. Receive a report, hold a discussion, and give staff direction on pending City Council requests for information. ID 20-2095E. Page 2 Printed on 1/15/2021 217 January 26, 2021City Council Meeting Agenda Following the completion of the Work Session, the City Council will convene in a Closed Meeting to consider specific item(s) when these items are listed below under the Closed Meeting section of this agenda. The City Council reserves the right to adjourn into a Closed Meeting on any item on its Open Meeting agenda consistent with Chapter 551 of the Texas Government Code, as amended, or as otherwise allowed by law. 1. Closed Meeting: Deliberations regarding Real Property - Under Texas Government Code, Section 551.072; and Consultation with Attorneys Under Texas Government Code, Section 551.071. Receive information from staff, discuss, deliberate, and provide staff with direction pertaining to the potential disposal, exchange, sale, or acquisition of certain real property interests located in the David Hough Survey, Abstract Number 646, generally located in the 2100 block of South Mayhill Road, in the City of Denton, Denton County, Texas. Consultation with the City's attorneys regarding legal issues associated with the potential disposal, exchange, sale, or acquisition involving the real property described above where a public discussion of these legal matters would conflict with the duty of the City's attorneys to the City of Denton and the Denton City Council under the Texas Disciplinary Rules of Professional Conduct of the State Bar of Texas, or would jeopardize the City’s legal position in any negotiation, administrative proceeding, or potential litigation. ID 21-006A. Deliberations regarding Real Property Under Texas Government Code Section 551.072; Consultation with Attorneys Under Texas Government Code Section 551.071. Receive information from staff, discuss, deliberate, and provide staff with direction pertaining to the potential acquisition of certain real property interests located in and around the J. Rogers Survey, Abstract Number 1084; the J. Withers Survey, Abstract 1343; the M. Rogers Survey, Abstract 1080; and the N. Britton Survey, Abstract Number 051, each in the City of Denton, Denton County, Texas where a public deliberation of such potential acquisitions would have a detrimental effect on the City’s position in negotiations with third parties. Consultation with the City's attorneys regarding legal issues associated with the potential acquisitions involving the real property described above where a public discussion of these legal matters would conflict with the duty of the City's attorneys to the City of Denton and the Denton City Council under the Texas Disciplinary Rules of Professional Conduct of the State Bar of Texas, or would jeopardize the City’s legal position in any negotiation, potential administrative proceeding, or potential litigation. ID 21-027B. Deliberations regarding Personnel Matters - Under Texas Government Code Section 551.074. Deliberate and discuss the evaluation, duties, discipline, dismissal, compensation, and/or contract of the Municipal Judge. ID 21-108C. Page 3 Printed on 1/15/2021 218 January 26, 2021City Council Meeting Agenda Any final action, decision, or vote on a matter deliberated in a Closed Meeting will only be taken in an Open Meeting that is held in compliance with Texas Government Code, Chapter 551, except to the extent such final decision, or vote is taken in the Closed Meeting in accordance with the provisions of Section 551.086 of the Texas Government Code (the ‘Public Power Exception’). The City Council reserves the right to adjourn into a Closed Meeting or Executive Session as authorized by Texas Government Code, Section 551.001, et seq. (The Texas Open Meetings Act) on any item on its open meeting agenda or to reconvene in a continuation of the Closed Meeting on the Closed Meeting items noted above, in accordance with the Texas Open Meetings Act, including, without limitation Sections 551.071-551.086 of the Texas Open Meetings Act. NOTE: Any item for which a formal action at the Special Called Meeting has been taken by Council may be subject to a request for a motion for reconsideration at any time during the meeting, at the Concluding Items Section, or after the meeting. In order to comply with the Texas Open Meetings Act, a request for a motion for reconsideration made during, at the end of, or after a Council meeting will be placed on the agenda and considered at the next official meeting of the City Council. Following the completion of the Closed Meeting, the City Council will convene in a Special Called Meeting to consider the following items: 1. CONSENT AGENDA Each of these items is recommended by Staff and approval thereof will be strictly on the basis of the Staff recommendations. Approval of the Consent Agenda authorizes the City Manager or his designee to implement each item in accordance with the Staff recommendations. The City Council has received background information and has had an opportunity to raise questions regarding these items prior to consideration. Listed below are bids, purchase orders, contracts, and other items to be approved under the Consent Agenda (Agenda Items A – F). This listing is provided on the Consent Agenda to allow Council Members to discuss or withdraw an item prior to approval of the Consent Agenda. If no items are pulled, the Consent Agenda Items will be approved with one motion. If items are pulled for separate discussion, they may be considered as the first items following approval of the Consent Agenda. Consider approval of the minutes of January 4, January 5, and January 12, 2021.ID 21-101A. Consider adoption of an ordinance of the City of Denton releasing, abandoning, and vacating a 715.20 square foot electric utility easement granted to the City of Denton by James H. Jones, H.M. Burgess, Billy R. Jones, and J. Dan Harvey, recorded as Instrument No. 1978-2348 in the Deed Records, Denton County, Texas; providing for severability and an effective date. (Park 7 Addition, electric easement abandonment - Mark Laird) ID 21-009B. Consider adoption of an ordinance approving an encroachment agreement by and between the City of Denton and the Oncor Electric Delivery Company relating to the location of a city street “Taylor Park Boulevard” crossing, ten (10) foot wide sidewalk crossing, four (4) by two (2) foot RCB crossing, twenty-one (21) inch RCP crossing, eighteen (18) inch RCP crossing, eight (8) inch waterline crossing, eight (8) inch sanitary sewer crossing, and a Denton Municipal Electric line bore crossing within the Oncor Easement recorded in Volume 559, Page 570, Deed Records, Denton County, Texas; authorizing the City Manager to execute the agreement; authorizing the expenditure of funds; and providing an effective date. “Cambridge Brook Oncor Encroachment ID 21-011C. Page 4 Printed on 1/15/2021 219 January 26, 2021City Council Meeting Agenda Agreement - Mark Laird” Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or his designee, to execute an Interlocal Cooperative Purchasing Agreement with the City of Midlothian, under the Texas Government Code, Section 791.001, to authorize City of Denton contracts for the purchase of various goods and services; authorizing the expenditure of funds therefor; and declaring an effective date (File 7590 - award an Interlocal Cooperative Purchasing Agreement with the City of Midlothian). ID 21-091D. Consider adoption of an ordinance of the City of Denton authorizing the City Manager, or his designee, to accept the TSLAC CARES Grant Program-Cycle 2 (Grant CAR2-21007) for State Fiscal Year 2021 (Federal Award Identification #LS-246561-OLS-20) from the Texas State Library and Archives Commission through the Institute of Museum and Library Services, in the amount of $20,929.00 for the period of April 1, 2020, through August 31, 2021; authorizing the City Manager to carry out all duties of the City pursuant to the grant; providing a savings clause; and providing an effective date. ID 21-092E. Consider adoption of a resolution of the City Council of the City of Denton revising the City’s Cash Disbursements policy; and providing an effective date. ID 21-119F. 2. ITEMS FOR INDIVIDUAL CONSIDERATION Consider adoption of an ordinance adopted concurrently with the cities of Garland, Greenville, Bryan and Denton, approving the execution by the Texas Municipal Power Agency (“Agency”) of an asset purchase agreement for the sale of the Agency’s Gibbons Creek Steam Electric Station and related assets in Grimes County, Texas; approving an associated decommissioning budget amendment; and providing an effective date. ID 20-2507A. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager, or his designee, to execute a contract with Reliable Commercial Services LLC, for the construction of the Denton Street Rehabilitation Project for the City of Denton; providing for the expenditure of funds therefor; and providing an effective date (IFB 7495 - awarded to Reliable Commercial Services LLC, in the not-to-exceed amount of $10,933,808.55). ID 21-090B. Consider approval of a resolution of the City Council of the City of Denton, Texas, approving the Economic Development Strategic Plan; and providing an effective date. ID 20-1635C. Consider nominations and appointments to the Downtown Denton Tax Increment Financing Reinvestment Zone No. One Board (Downtown TIRZ), including appointment of a Board Chair. ID 20-1898D. Consider nominations/appointments to the City’s Economic Development Partnership Board. ID 20-2550E. Consider nominations/appointments to the City’s Boards, Commissions, and Committees: Animal Shelter Advisory Committee, Community Development Advisory Committee, Health & Building Standards Commission, Human Services Advisory Committee, Traffic ID 21-029F. Page 5 Printed on 1/15/2021 220 January 26, 2021City Council Meeting Agenda Safety Commission, and Zoning Board of Adjustment. 3. CONCLUDING ITEMS A. Under Section 551.042 of the Texas Open Meetings Act, respond to inquiries from the City Council or the public with specific factual information or recitation of policy, or accept a proposal to place the matter on the agenda for an upcoming meeting AND Under Section 551.0415 of the Texas Open Meetings Act, provide reports about items of community interest regarding which no action will be taken, to include: expressions of thanks, congratulations, or condolence; information regarding holiday schedules; an honorary or salutary recognition of a public official, public employee, or other citizen; a reminder about an upcoming event organized or sponsored by the governing body; information regarding a social, ceremonial, or community event organized or sponsored by an entity other than the governing body that was attended or is scheduled to be attended by a member of the governing body or an official or employee of the municipality; or an announcement involving an imminent threat to the public health and safety of people in the municipality that has arisen after the posting of the agenda. B. Possible Continuation of Closed Meeting topics, above posted. C E R T I F I C A T E I certify that the above notice of meeting was posted on the bulletin board at the City Hall of the City of Denton, Texas, on the 22nd day of January, 2021 at ___________________ __________________________________________ CITY SECRETARY NOTE: THE CITY OF DENTON'S DESIGNATED PUBLIC MEETING FACILITIES ARE ACCESSIBLE IN ACCORDANCE WITH THE AMERICANS WITH DISABILITIES ACT. THE CITY WILL PROVIDE ACCOMMODATION, SUCH AS SIGN LANGUAGE INTERPRETERS FOR THE HEARING IMPAIRED, IF REQUESTED AT LEAST 48 HOURS IN ADVANCE OF THE SCHEDULED MEETING. PLEASE CALL THE CITY SECRETARY'S OFFICE AT 940-349-8309 OR USE TELECOMMUNICATIONS DEVICES FOR THE DEAF (TDD) BY CALLING 1-800-RELAY-TX SO THAT REASONABLE ACCOMMODATION CAN BE ARRANGED. Page 6 Printed on 1/15/2021 221 Meeting Date1-Dec COVID-19 Update Overview of Construction 17 - Dec 2021 4 - Jan 2021 City Council 2020 Committees 12 - Jan 2021 Internal Audit - Utility Meter Reading Council Requests 19 - Jan 2021 No Meeting 26 - Jan 2021 COVID-19 Update 20-2117 ETJ Update 20-1668 2021 May General & June Runoff elections - locations, dates, and times 20-2399 Council Retreat 21-122 Council Requests 20-2095 1 - Feb 2021 Luncheon Police Department Overview 20-2354 Policy for Naming of Parks 20-2320 Council Requests 20-2271 Feb 1 2 - Feb 2021 Affordable Housing Assessment Report 20-1844 Tax Housing Credit 21-093 Council Requests 20-2272 Feb 2 9 - Feb 2021 Stormwater Master 20-1661 TIRZ Study 20-2182 Economic Development Strategic Plan and Funding Options 21-124 Council Requests 20-2273 Feb 9 16 - Feb 2021 Loop 288 Building Agreement 21-056 Delegated Authority TBD 20-21 Utilities Budget and Rates 20-2261 Fund Balance Policy (General Fund, Internal Service Fund, Utilities 20-2394 Council Requests 20-2274 Feb 16 23 - Feb 2021 Capital Project CIP Update 20-2531 Internal Audit - Utility Payment Assistance Program 20-2554 Legislative Update 21-080 Council Requests 20-2275 Feb 23 1-March 2021 Luncheon Joint DISD Meeting TBD Council Requests 20-2385 Mar 1 2-March 2021 COVID-19 Update Mar. 2 20-1886 Mosquito Abatement Policy TBD Council Requests 20-2386 Mar 2 9-March 2021 No Meeting 16-March 2021 Parkland Dedication & Development Ordinance 21-109 Council Requests 20-2387 Mar 16 23- March 2021 Council Requests 20-2388 Mar 23 30 -March 2021 No Meeting Accessory Dwelling Units, and Screening DCA19-0011 Construction Code Review (TBD) Economic Development Incentive 20-2529 July 27 Public Art Right-of-Way Ordinance Follow-up DME Solar Programs Redistricting Update June/July 2021 Hartlee Field PID 20-1789 Group Home Code Amendment Work Sessions Planned - Date TBDFUTURE WORK SESSION ITEMS MATRIX As of January 15, 2021 Currently Slated Work Session Items Canvass Runoff Election Results & 222 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Bell Ave at Mckinney St 07/08/21 09/04/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bell Ave at Mingo Rd 06/22/21 07/07/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bell Ave Withers St Mingo Rd 05/10/21 06/21/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bell Ave Texas St Withers St 04/15/21 05/07/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bell Ave Administratio n Dr Texas St 03/18/21 04/14/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Carmel St Hobson El Paseo 02/08/21 04/09/21 Curb and Gutter Repair. The process starts with Barricading the failed sections of, Curb and Gutter remove and install Curbs. Streets N/A (940) 349-7146 Highland Park Bonnie Brae Jasmine 01/25/21 02/03/21 Laying new waterline to the along Highland Park towards Bonnie Brae Engineering NextDoor (940) 268-8946 Precision Dr Airport Rd 1500' north 01/20/21 02/15/21 Wastewater Collections will be installing a new wastewater main and services. Wastewater Total 7 Street Closure Report Upcoming Closures Week of January 18, 2021 - January 24, 2021 Upcoming Closures 223 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Amherst Dr Georgetown Dr Hinkle Dr 09/28/20 01/19/21 Wastewater Collections will be installing a new wastewater main line and services. Wastewater N/A (940) 349-8909 Bell Ave Chapel Dr Administratio n Dr 02/01/21 03/18/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bell St University Dr Chapel Dr 12/14/20 01/29/21 Water Distribution will be installing a new water main line and services. Water Email Notification, Direct business contact, N/A (940) 349-7278 Bonnie Brae IH 35E Scripture 06/15/20 03/01/21 North South Water Main Phase 3 Engineering, Water Temporary Flagging in all lanes for pipe delivery. Direct business contact (940) 349-8938 Brinker Colorado Blvd. I-35 Service Rd 01/19/21 01/29/21 Concrete Street Panel Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Creekdale Dr Raintree Way Riverchase Trl 12/09/20 02/20/21 Wastewater Collections will be installing a new wastewater main and services. Waste Water N/A (940) 349-8909 Elm Hickory Prairie 05/11/20 02/26/21 PEC 4 Utility Project Engineering Direct business contact (940) 349-8938 Fannin St Welch St Bernard St 12/21/20 01/28/21 Water Distribution will be installing a new water main line and services. Water N/A (940) 349-7278 Ft. Worth Dr. (US 377)IH 35E FM1830 10/17/19 02/01/21 Infrastructure Safety Upgrades & New Sewer Main Install (temporary closures) TxDOT (940) 349-8938 Hickory CreeK Road Teasely FM 2499 10/06/20 02/16/21 Widening of Hickory Creek road from Teasley to FM 2499 with an acceleration lane being constructed on FM 2499. Project also included drainage upgrades. Engineering NextDoor, Email Notification (940) 349-7426 Street Closure Report Week of January 18, 2021 - January 24, 2021 Current Closures Current Closures 224 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Johnson Street Daugherty Street Smith Street 10/26/20 01/25/21 Install new curb and gutter. Mill off old pavement and install new asphalt to match the grade of the new inlets. Streets Scheduling conflict with concrete contractor so we move the start date to 10-26-20. 80% complete the surface course still needs to be installed. Door hangers (940) 349-7146 March Rail Cat Tail Heron Pond 01/11/21 02/12/21 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Mistywood Lane Woodhaven Jamestown 10/01/20 02/12/21 Street Reconstruction Remove and replace curb and gutter as needed. Remove old asphalt and stabilize subgrade. Install asphalt pavement Streets N/A (940) 349-7146 Prairie Elm Pierce 06/01/20 03/26/21 PEC 4 Utilities Engineering NextDoor, Direct business contact (940) 349-8938 Prairie St.Locust St.Elm St.03/23/20 03/26/21 Storm drain improvements, as part of Pec-4 Ph 1&2 Project. Street closed to thru traffic. Engineering Direct business contact (940) 349-8938 Purdue Drexel Syracuse 01/11/21 02/12/21 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Riverchase Trl Stoneway Dr Waterside Pl 12/09/20 02/20/21 Wastewater Collections will be installing a new wastewater main and services. Waste Water N/A (940) 349-8909 Ryan Rd Roxbury St FM 2181 01/04/21 02/05/21 Contractor will be demoing the existing drainage and roadway and then installing drainage improvements across Ryan RD at the Hunter's Creek area. They will also be installing a new water line to the property and then repaving this section of road. Message boards to be put out on December 14th 2020. Public Works Inspections, Private Development NextDoor, Email Notification (940) 268-9842 Current Closures 225 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Spencer Road Bridges St.Mayhill Road 12/07/20 02/08/21 Greystar will be placing their sanitary line along Spencer Rd for the Elan Denton project. Waste Water, Public Works Inspections, Private Development Pushed back 2 weeks due to a delay with the Sanitary Sewer install. Email Notification (940) 391-6299 W Windsor Dr I-35 Frontage Rd Winddosr Farms Dr 01/18/21 01/20/21 Stripping all lanes with new signs. Public Works Inspections NextDoor, Email Notification (940) 231-9965 Welch St.Eagle Highland 01/19/21 01/19/21 water tap for 811 S. Welch Water NextDoor, Email Notification (940) 349-7278 West Hickory Street Welch Carroll 08/31/20 05/29/21 Construction is set to begin on West Hickory Street between N. Welch Street and Carroll Blvd in September of 2020 and continue through May of 2021. Detailed lane closure information is forthcoming pending approval of the contractor's phasing and traffic control plans. Atmos, Streets, Drainage, Water, Waste Water 8-20-20: Atmos Energy is currently relocating gas line on the South side of W. Hickory between Welch and Bernard. Once Atmos finishes, the contractor will mobilize into that same area to begin construction. Email Notification, Direct business contact (940) 349-8425 Western Blvd Airport Rd Jim Chrystal 12/21/20 03/31/21 Westpark Warehouse Phase 2 Public Works Inspections, Private Development Direct business contact (940) 205-9230 Windsor Hanover Branch Crossing 08/24/20 08/16/21 Install utilities and road reconstruction Engineering NextDoor, Email Notification (940) 349-7426 Current Closures 226 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Windsor Stuart Longfellow 08/24/20 08/23/21 Installation of utilities and street reconstruction Engineering NextDoor, Email Notification (940) 349-7426 Total 25 Current Closures 227 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Avenue C Chestnut Street Highland Street 12/14/20 12/18/20 Unite Private Networks, and sub-contractor Verticom, temporarily closing street to install fiber optic service. Public Works Inspections, Unite Private Networks Direct business contact (940) 205-3779 Barrel Strap Road North of Hickory Creek Road Ocean Drive 09/07/20 01/04/21 This project is to add drainage upgrades and widen Hickory Creek Road. It is also adding an acceleration lane to Barrel Strap Road. Engineering NextDoor, Email Notification (940) 349-7426 Bell Ave Texas St Withers St 11/19/20 12/08/20 Wastewater Collections will be installing a new wastewater main and services. Wastewater Email Notification (940) 349-8909 Club House at Sombrero 11/30/20 12/23/20 Concrete Sidewalk and ADA Ramps Repair. The process starts with Barricading the failed sections of concrete Sidewalk, remove, and install new concrete Streets N/A (940) 349-7146 Clydesdale Weeler Ridge Spainsh Lane 12/07/20 01/15/21 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Collins Dallas Dr.Johnson St 07/20/20 11/30/20 Haven at Daugherty: Pavement Public Works Inspections, Private Development N/A (940) 205-9230 Como Lake Windriver Loon Lake 10/05/20 11/13/20 Concrete Street Panel . The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Crow St Panhandle St Gober St 12/21/20 01/08/21 New Sewer Line & Water Services will be installed. Public Works Inspections NextDoor, Email Notification, Direct business contact (940) 231-9965 Street Closure Report Week of January 18, 2021 - January 24, 2021 Completed Closures Completed Closures228 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Diamond Poinsettia Cyrus Way 11/16/20 12/04/20 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Doris McKamy Tripp Tr 10/26/20 11/20/20 Concrete Panel and Sidewalk repair Streets FM 2181 City of Denton/Cori nth City limits Lillian Miller 11/18/19 11/30/20 Street Widening TxDOT (940) 349-8425 Foxcroft Cir Emerson Ln Emerson Ln 03/09/20 12/11/20 Water Distribution will be replacing the water main and water services. Water Intermittent closures N/A (940) 349-7278 Hercules N. Locust Stuart 08/01/20 11/01/20 The road will be closed as a part of the 2019 Street construction bundle Project. Hercules is set to have reconstruction of the curbs, gutters and the street. Engineering NextDoor, Email Notification, Mail outs (940) 349-7426 Hidden Meadows Trail Intersection with Vintage Blvd back of Vintage blvd right of way 03/16/20 01/01/21 Intermittent closures of this intersection for construction activities Engineering NextDoor, Email Notification (940) 349-8938 Highland Park Jasmine st Bonnie Brae 12/03/20 12/17/20 boring a new water and sewer line under the KCS Railroad. Public Works Inspections NextDoor, Email Notification (940) 268-8946 Kings Row Marrianne 288 10/22/20 11/20/20 Perform full depth base repairs on Kings Rows.Streets Completed about 90% of the work. Equipment issues so I'm extending the project to the end of the week. N/A (940) 349-7146 Locust St.Prairie Highland 03/09/20 01/01/21 Storm drain improvements as part of Pec-4 Ph 1&2 Project. East Side ln Closure Engineering Direct business contact (940) 349-8938 Merlot Riesing Pinot 10/26/20 11/06/20 Concrete Sidewalk Repair. The process starts with Barricading the failed sections of concrete Sidewalk, remove, and install new concrete Streets N/A (940) 349-7146 Mills Road N. Mayhill Road S. Trinity 11/30/20 12/11/20 Perform Asphalt Base Repairs at various locations.Streets Equipment issues so and weather delays .Message Boards (940) 349-7146 Completed Closures229 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Mockernut Rd. Intersection with Vintage Blvd. back of Vintage Blvd. right of way 03/16/20 01/01/21 Intermittent closures of this intersection for construction activities. Engineering NextDoor, Email Notification (940) 349-8938 Northcrest Rd Foxcroft Cir Emerson Ln 03/06/20 12/11/20 Water Distribution will be replacing the water main and water services. Water N/A (940) 349-7278 Paddock Lipizzan English Saddle 12/14/20 01/07/21 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Precision Airport Rd 1500ft north 10/12/20 12/18/20 Water Distribution will be installing a new water main and services Water N/A (940) 349-7278 Roberts N. Bell Brown 10/19/20 11/20/20 Curb and Gutter Repair . The process starts with Barricading the failed sections of, Curb and Gutter remove and install Curbs. Streets N/A (940) 349-7146 Roselawn Bonnie Brae Bernard 05/12/20 11/20/20 Bonnie Brae Phase 1 Engineering North Side lane closure NextDoor (940) 349-8938 Shagbark Dr intersection with Vintage Blvd back of Vintage Blvd right of way 03/16/20 12/03/20 Intermittent closure of the intersection for construction activities. Engineering NextDoor, Email Notification (940) 349-8938 Spring Creek Creek Bend Beechwood 10/05/20 12/18/20 Concrete Street Panel and Sidewalk Repair. The process starts with Barricading the failed sections of concrete pavement, remove the pavement, and install new concrete. Streets N/A (940) 349-7146 Stuart Road North of Windsor South of windsor 09/07/20 11/16/20 Street repairs Engineering NextDoor, Email Notification (940) 349-7426 Underwood McCormick Ave. B 11/09/20 01/04/21 Road will be closed for paving and sidewalk construction for the new Fire Station #3 Public Works Inspections N/A (210) 563-1599 Vintage Blvd US377 Hidden Meadows Trl 10/23/20 11/20/20 Bonnie Brae Phase 2 Engineering 10/14/20 NextDoor, Public Meeting(s)(940) 349-8938 Windsor Stuart E. Sherman 09/07/20 12/22/20 This closure is to reconstruct Windsor Drive Engineering NextDoor, Email Notification (940) 349-7426 Completed Closures230 Street/Intersection From To Closure Start Date Closure End Date Description Department Upcoming Info/Notes Public Meeting Other Communication Department Contact Total 30 Completed Closures231