Loading...
HomeMy WebLinkAbout102122 Friday Staff Report  City Manager’s Office (0F.LQQH\6W'HQWRQ7;     OUR CORE VALUES ,QFOXVLRQ&ROODERUDWLRQ4XDOLW\6HUYLFH6WUDWHJLF)RFXV)LVFDO5HVSRQVLELOLW\ MEMORANDUM  DATE:2FWREHU TO:7KH+RQRUDEOH0D\RU+XGVSHWKDQG&RXQFLO0HPEHUV FROM:6DUD+HQVOH\&LW\0DQDJHU SUBJECT:6WDII5HSRUW  Upcoming Meetings $ 3XEOLF8WLOLWLHV%RDUGRQMonday, October 24, 2022,DW9:00 a.m.LQWKH&LW\&RXQFLO :RUN6HVVLRQ5RRP % 'HYHORSPHQW&RGH5HYLHZ&RPPLWWHHRQMonday, October 24, 2022,DW10:00 a.m.DW WKH'HYHORSPHQW6HUYLFH&HQWHU & ,QWHUQDO$XGLW$GYLVRU\&RPPLWWHHRQMonday, October 24, 2022,DW5:30 p.m. LQWKH &LW\+DOO&RQIHUHQFH5RRP ' :RUN6HVVLRQRIWKH&LW\&RXQFLORQTuesday, October 25, 2022,DW2:00 p.m.LQWKH &LW\&RXQFLO:RUN6HVVLRQ5RRP  ( 0RELOLW\&RPPLWWHHRQWednesday, October 26, 2022,DW9:00 a.m.LQWKH&LW\&RXQFLO :RUN6HVVLRQ5RRP ) :RUN6HVVLRQRIWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQRQWednesday, October 26, 2022, DW5:00 p.m.LQWKH&LW\&RXQFLO:RUN6HVVLRQ5RRPIROORZHGE\D5HJXODU0HHWLQJDW 6:30 p.m.LQWKH&RXQFLO&KDPEHUV * %RQG 2YHUVLJKW &RPPLWWHHRQFriday, October 28, 2022,DW12:00 p.m.LQ WKH 'HYHORSPHQW6HUYLFH&HQWHU + 6XVWDLQDELOLW\)UDPHZRUN$GYLVRU\&RPPLWWHHRQFriday, October 28, 2022,DW1:00 p.m. LQWKH&LW\&RXQFLO:RUN6HVVLRQ5RRP General Information & Status Updates $ 8SGDWHG&RUH9DOXHV±'XULQJWKH(PSOR\HH)RUXPRQ:HGQHVGD\2FWREHU&LW\ 0DQDJHU 6DUD +HQVOH\ DQQRXQFHG D VHW RI XSGDWHG &LW\ &RUH 9DOXHV ,QFOXVLRQ &ROODERUDWLRQ4XDOLW\6HUYLFH6WUDWHJLF)RFXV DQG)LVFDO5HVSRQVLELOLW\7KHVHQHZFRUHYDOXHV ZHUHGHYHORSHGIURPH[WHQVLYHGLVFXVVLRQVZLWK WKH&LW\¶VOHDGHUVKLSWHDPDQGVXSSRUWFXUUHQW JRDOV DQG IXWXUH GLUHFWLRQ $GGLWLRQDOO\ WKH\ EXLOGRQRXUSUHYLRXVFRUHYDOXHVZKLFKUHPDLQ LQFUHGLEO\ LPSRUWDQW DWWULEXWHV IRU WKH RUJDQL]DWLRQ DVVXFFHVV LV EXLOW DURXQG WKHP 7KHQHZYDOXHVDUHPHDQWWRSURYLGHDURDGPDS WKDWJXLGHVXVIRUZDUGDQGWHDFKHVXVKRZWR DFFRPSOLVKRXUZRUN  Attached LV WKH HPDLO WKDW 6DUD VHQW WR DOO HPSOR\HHV HDUOLHU WKLV ZHHN GHVFULELQJ HDFK YDOXHDQGWKHWKRXJKWEHKLQGWKHPWKHSRVWHUto the rightZLOOEHGLVWULEXWHGWR&LW\IDFLOLWLHVDQG GHSDUWPHQWVQH[WZHHNDQGVWDIIUHOHDVHGD1HZ &RUH9DOXHVYLGHRWKDWZDVVKRZQGXULQJWKH (PSOR\HH)RUXPDQGHPDLOHGWRVWDIIODWHUWKDW GD\ 6WDII FRQWDFW 6WXDUW %LUGVH\H 0DUNHWLQJ DQG&RPPXQLFDWLRQV  % 6 3*OREDO 6 3 %RQG&UHGLW5DWLQJ±2Q6HSWHPEHUVWDIIDQGWKH&LW\¶VILQDQFLDO DGYLVRU+LOOWRS6HFXULWLHV,QFSDUWLFLSDWHGLQDFRQIHUHQFHFDOOZLWKDQDQDO\VWIURP6 3 WRGLVFXVVWKH8WLOLW\¶VILQDQFLDOVDQGSRVW6WRUP8ULDFWLRQV6WDIIDOVRSUHSDUHGVHYHUDO TXHVWLRQDQGDQVZHUFRUUHVSRQGHQFHVZLWK)LWFK¶VDQDO\VWLQWKHILUVWZHHNVRI2FWREHU SURYLGLQJ EXGJHW DQG FDSLWDO LPSURYHPHQW IRUHFDVWV $V D UHVXOW 6 3 DIILUPHG WKH 8WLOLW\¶VORQJWHUPUDWLQJRIµ$¶DQGUHYLVHGWKHRXWORRNWR6WDEOH,QDGGLWLRQ6 3 DIILUPHGWKHVKRUWWHUPUDWLQJRIµ$¶RQWKH8WLOLW\6\VWHPFRPPHUFLDOSDSHUQRWHV  6 3¶VRXWORRNUHYLVLRQWRVWDEOHUHIOHFWV'0(¶VLPSURYHGULVNPDQDJHPHQWFXOWXUHDQG RYHUVLJKWVLQFH6WRUP8ULDVZHOODVWKHLPSURYHGSURFHGXUHVSRZHUVXSSO\SODQQLQJDQG KHGJLQJSUDFWLFHVIRUERWKQDWXUDOJDVDQGSXUFKDVHGSRZHUZLWKYDULRXVLQFUHPHQWDO UHIRUPVPDGHLQWKH(5&27PDUNHWWKDWEHWWHULQVXODWH'0(IURPH[WUHPHZHDWKHUDQG KLJKPDUNHWSULFHVIRUSRZHUDQGJDVAttached LV6 3¶VIXOOUDWLQJUHSRUW6WDIIFRQWDFW 5DQGHH.OLQJHOH)LQDQFH  2 & 1HZ(OHFWULF9HKLFOH&KDUJHUV 'HQWRQ 0XQLFLSDO (OHFWULF '0( DGGHG WZRWZRSRUW /HYHOHOHFWULFYHKLFOHFKDUJHUV WR WKH 'HYHORSPHQW 6HUYLFHV %XLOGLQJ 1(OP6W 7KH FKDUJHUV DUHDYDLODEOHWRWKH SXEOLFDQGDUHSDLGIRUXVLQJWKH &KDUJH3RLQWDSSRUE\XVLQJWKH ³7DSWR3D\´PHWKRG7KHWZR QHZVWDWLRQVDUHLQ DGGLWLRQ WR IRXURWKHUORFDWLRQVZLWK'0( RZQHGFKDUJHUVDW1RUWK/DNHV 3DUN 1RUWK %UDQFK /LEUDU\ 6RXWK /DNHV 3DUN DQG 6RXWK %UDQFK /LEUDU\6WDII FRQWDFW 0HOLVVD'HOLUD'0(  ' 'HYHORSHU7RZQ+DOORQ5RDGZD\DQG:DWHU:DVWHZDWHU,PSDFW)HHV±2Q2FWREHU UHSUHVHQWDWLYHVIURP&DSLWDO3URMHFWV(QJLQHHULQJ:DWHU8WLOLWLHVDQG)LQDQFHZLOOKROG D'HYHORSHU7RZQ+DOOZLWKWKHFRQVXOWDQW.LPOH\+RUQWRGLVFXVV5RDGZD\,PSDFW)HH XSGDWHVDQGQH[WVWHSVDORQJZLWKWKHVFKHGXOHIRUWKH:DWHU:DVWHZDWHU,PSDFW)HHV7KH 7RZQ+DOOZLOOEHKHOGDWWKH'HYHORSPHQW6HUYLFHV&HQWHU 1(OP6W IURPDP WRDP6WDIIFRQWDFW5HEHFFD'LYLQH\&DSLWDO3URMHFWV(QJLQHHULQJ  ( 6:$1$,QWHUQDWLRQDO5RDG(2±7KH6ROLG:DVWH$VVRFLDWLRQRI1RUWK$PHULFD 6:$1$ KRVWHGLWV,QWHUQDWLRQDO5RDG(2RQ2FWREHULQ(O3DVR7;7KH 5RDG(2VKRZFDVHVSDUWLFLSDQWV¶VNLOOVDQGWDOHQWVLQRSHUDWLQJKHDY\HTXLSPHQWDQG ZDVWHFROOHFWLRQYHKLFOHVUHSDLULQJDOOPDQQHURIHTXLSPHQWZKLOHIRVWHULQJDVSLULWRI FRPSHWLWLRQDQGJRRGZLOODQGSURPRWLQJSURIHVVLRQDOLVPDQGVDIHW\DPRQJSDUWLFLSDQWV &RPSHWLWRUVLQWKH6:$1$,QWHUQDWLRQDO5RDG(2KDOHIURPERWKWKH8QLWHG6WDWHVDQG &DQDGDKDYHSDUWLFLSDWHGLQDQGZRQHYHQWVDWWKHLUVWDWHFKDSWHUVSRQVRUHGHYHQWVDQG UHSUHVHQWWKHLUVWDWHFKDSWHUVDQGHPSOR\HUV,QDGGLWLRQLWDIIRUGVSDUWLFLSDQWVWKHFKDQFH WRQHWZRUNZLWKSHHUVDFURVVWKHQDWLRQ  7KH&LW\RI'HQWRQ6ROLG:DVWHDQG5HF\FOLQJ'HSDUWPHQWKDGWKHRSSRUWXQLW\WRVHQG WZR HPSOR\HHV WR SDUWLFLSDWH DQG FRPSHWH 6ROLG :DVWH DQG 5HF\FOLQJ LV H[FLWHG WR DQQRXQFHWKDW2PDU5RGULJXH]ZLWKWKH+RPH&KHPLFDO&ROOHFWLRQVSURJUDPZRQWKLUG SODFHLQWKHWRQ$UWLFXODWLQJ'XPS7UXFNFRPSHWLWLRQ7KLVPDNHVKLPWKHUGEHVW RSHUDWRULQWKHQDWLRQ&RQJUDWXODWLRQVWR2PDURQWKLVJUHDWDFFRPSOLVKPHQWDQGIRU UHSUHVHQWLQJWKH&LW\RI'HQWRQ6WDIIFRQWDFW$UW*DUFLD6ROLG:DVWHDQG5HF\FOLQJ  ) 4XDNHUWRZQ&HQWHQQLDO0HPRULDO3URMHFW±7KH'HQWRQ3DUNVDQG5HFUHDWLRQ'HSDUWPHQW LQFRQMXQFWLRQZLWKPXOWLSOH&LW\GHSDUWPHQWVDQGFRPPXQLW\PHPEHUVZLWKUHOHYDQW LQVLJKW DQG H[SHUWLVHDUH MRLQLQJ WRJHWKHU WRKRQRUWKH FRPPXQLW\ RI 4XDNHUWRZQ LQFOXGLQJLWVKLVWRU\OHJDF\UHVLGHQWVDQGWKHLUGHVFHQGDQWV6WDIIDUHSODQQLQJVHYHUDO HQJDJHPHQWRSSRUWXQLWLHVWRUHFHLYHIHHGEDFNDQGLQSXWIURPWKHSXEOLFWRGHWHUPLQHWKH ILQDOFRQWHQWGHVLJQIRUWHPSRUDU\VLJQDJHKRQRULQJWKHWKDQQLYHUVDU\RI4XDNHUWRZQ 7KHILUVWRIWKHVHSXEOLFPHHWLQJVZLOOEHDQLQIRUPDWLYHSUHVHQWDWLRQDWWKH2FWREHU 6RXWKHDVW'HQWRQ1HLJKERUKRRG$VVRFLDWLRQ 6('1$ PHHWLQJ 3  7KH&HQWHQQLDO0HPRULDO3URMHFWDOVRRYHUODSVFRQFXUUHQWHIIRUWVWKDWZRXOGFUHDWHD SHUPDQHQWPHPRULDODW4XDNHUWRZQ3DUN7KHSHUPDQHQWPHPRULDOZLOOEHGHYHORSHGLQ FRRUGLQDWLRQZLWKERWKWKH4XDNHUWRZQ3DUNPDVWHUSODQDQGWKH'RZQWRZQ'HQWRQ$UHD PDVWHUSODQ7KHMRLQWPDVWHUSODQQLQJLQYROYHVKLJKOHYHOVRISXEOLFLQSXWDQGHQJDJHPHQW WR HQVXUH WKH ILQDO SURMHFW DOLJQV ZLWK UHVLGHQWV¶GHVLUHV DQGKRQRUVWKH KLVWRU\ DQG VLJQLILFDQFHRI4XDNHUWRZQ6WDIIFRQWDFW2PDU6LGGLTL3DUNVDQG5HFUHDWLRQ  * 'HQWRQ 3DUN )RXQGDWLRQ 8SGDWH±(DFK \HDU GXULQJ WKH EXGJHW SURFHVV WKH 3DUNV )RXQGDWLRQ SURYLGHV DQ XSGDWHRQLWV DFWLYLWLHV DQG SODQ IRU WKH XSFRPLQJ \HDU7KH )RXQGDWLRQ¶VDQQXDOXSGDWHZDVGHOD\HGGXHWRVWUXFWXUDODQGRUJDQL]DWLRQDOFKDOOHQJHV WKLV\HDU7KH)RXQGDWLRQZLOOEHHOHFWLQJQHZRIILFHUVRQ2FWREHUDQGRQFHWKH\DUHLQ SODFHDQDJUHHPHQWVXPPDU\UHSRUWDQGDQQXDOSODQZLOOEHVXEPLWWHGWRWKH&LW\&RXQFLO IRUUHYLHZIHHGEDFNDQGFRQVLGHUDWLRQ7KHGRFXPHQWVZLOOEHLQFOXGHGLQDIXWXUH)ULGD\ 5HSRUWIRUUHYLHZDQGDIRUPDOSUHVHQWDWLRQDQGGLVFXVVLRQZLOOEHVFKHGXOHGIRUDIXWXUH &LW\&RXQFLOPHHWLQJ6WDIIFRQWDFW*DU\3DFNDQ3DUNVDQG5HFUHDWLRQ  + $6$66RFFHU&KDPSLRQVKLSV±$VSDUWRIWKH$IWHU6FKRRO$FWLRQ6LWH3URJUDP $6$6  RSHUDWHG E\ WKH 3DUNV DQG 5HFUHDWLRQ 'HSDUWPHQW NLGVFDQSDUWLFLSDWH LQ LQWUDPXUDO DWKOHWLFVDQGFRPSHWHDJDLQVWRWKHUSURJUDPVLWHV7KHLQWUDPXUDOVRFFHUVHDVRQFRQFOXGHG RQ7KXUVGD\2FWREHUZLWK WKH$6$6 'HQWRQ&XS&KDPSLRQVKLSSOD\HGDW9HOD $WKOHWLF&RPSOH[,QWKHWKLUGILIWKJUDGHGLYLVLRQ0/.WULXPSKHGRYHU1RUWK/DNHVZLWK DVFRUHRI&RDFKHGE\0U%U\DQWKLVLVWKHILUVWWLPH0/.KDVZRQDQ\RIWKH$6$6 LQWUDPXUDOV LQVL[\HDUV,Q WKHNLQGHUJDUWHQVHFRQG GLYLVLRQ 0U (OLD¶V 'HQLD WHDP SUHYDLOHGRYHU1RUWK/DNHVZLWKDVFRUHRI7KHQH[WLQWUDPXUDORSSRUWXQLW\LQWKH $6$6 3URJUDP LV EDVNHWEDOO )RU PRUH LQIRUPDWLRQ DERXW WKH $6$6 3URJUDP YLVLW ZZZGHQWRQSDUNVFRP6WDIIFRQWDFW6DUD)DUULV3DUNVDQG5HFUHDWLRQ  , 6WUHDP&OHDQ±6WUHDP&OHDQZDVDJUHDWVXFFHVVZLWKRYHUYROXQWHHUV FROOHFWLQJPRUHWKDQEDJVRIWUDVKDQGKXQGUHGVRIODUJHRUKHDY\ORRVHLWHPVIURP QLQHVLWHVLQFOXGLQJWLUHVVKRSSLQJFDUWVPXOWLSOHELNHSDUWVSDOOHWVVOLGLQJJODVV GRRUVDQGDWRLOHW$GGLWLRQDOO\EDJVRIFOHDQUHF\FODEOHVZHUHFROOHFWHGDW&DPS &RSDVV$OWRJHWKHUPRUHWKDQDWRQRIZDVWHZDVFROOHFWHG9LGHRKLJKOLJKWVIURP&DPS &RSDVVFDQEHVHHQKHUH6WDIIFRQWDFW.DWKHULQH%DUQHWW(QYLURQPHQWDO6HUYLFHV  6XVWDLQDELOLW\  Responses to Council Member Requests for Information $ 6PRNLQJ5HVWULFWLRQ,QTXLU\±2Q2FWREHU0D\RU3UR7HP%HFNDVNHGKRZWKH&LW\¶V 6PRNLQJ2UGLQDQFH &KDSWHU$UWLFOH,9RIWKH&RGHRI2UGLQDQFHV ZKLFKSURKLELWV VPRNLQJZLWKLQIHHWRIDEDUUHVWDXUDQWHQWUDQFHLVHQIRUFHGZKHQWKHIDFLOLW\KDVD VHUYLFHDUHDSDWLRGHFNVXUURXQGLQJWKHHQWUDQFH7KH&RXQFLOPHPEHUDOVRDVNHGZKHWKHU WKH &LW\¶V 6PRNLQJ 2UGLQDQFH DSSOLHV WR PHGLFDO PDULMXDQD RU VPRNLQJ RI RWKHU VXEVWDQFHV6PRNLQJDVXEVWDQFHFRQWDLQLQJWREDFFRZHHGRWKHUSODQWSURGXFW PDULMXDQD LVGHULYHGIURPDSODQW RUWKHXVHRIDQHOHFWURQLFFLJDUHWWHRUVLPLODUGHYLFHLVSURKLELWHG LQVLGHUHVWDXUDQWVDQGEDUVSXUVXDQWWR6HFWLRQ)XUWKHUPRUHDSHUVRQPD\QRW VPRNHZLWKLQIHHWRIWKHPDLQHQWUDQFHRIWKHUHVWDXUDQWRUEDU$EXVLQHVVRZQHUKDV WKHULJKWWRDOORZVPRNLQJLQDQRSHQDLUHGRXWGRRUSDWLR,IWKHSDWLRLVORFDWHGDWWKHIURQW RI WKH EXVLQHVV DQG LI WKH RZQHU HOHFWV WR DOORZ VPRNLQJ RQ WKDW SDWLR WKH IRRW SURKLELWLRQGRHVQRWDSSO\+RZHYHULIWKHEXVLQHVVRZQHUSURKLELWVVPRNLQJLQWKHIURQW 4 SDWLRWKHIRRWSURKLELWLRQGRHVDSSO\DQGDSHUVRQPD\QRWVPRNHZLWKLQIHHWRIWKH ERXQGDULHVRIWKHSDWLR  $YLRODWLRQRIWKH6PRNLQJ2UGLQDQFHLVD&ODVV&PLVGHPHDQRUVXEMHFWWRDILQHQRWWR H[FHHG7KH'HQWRQ3ROLFH'HSDUWPHQWRU&LW\&RGH(QIRUFHPHQWPD\LVVXHD FLWDWLRQIRUDYLRODWLRQRIWKH2UGLQDQFHDQGLWPD\EHSURVHFXWHGLQ0XQLFLSDO&RXUW6WDII FRQWDFW0DFN5HLQZDQG&LW\$WWRUQH\ % 5REVRQ5DQFK'HFRPPLVVLRQLQJ3URMHFW±2Q2FWREHU0D\RU+XGVSHWKLQTXLUHG DERXW:DVWHZDWHU¶V)<&,3SURMHFWOLVW EHORZ VSHFLILFDOO\WKH5REVRQ5DQFK GHFRPPLVVLRQLQJSURMHFW7KH5REVRQ5DQFK:DVWHZDWHU5HFODPDWLRQ3ODQW :53 ZDV FRQVWUXFWHGWRVHUYLFHWKH5REVRQ5DQFKFRPPXQLW\DQGIXUWKHUH[SDQGHGLQDVWKH 5REVRQFRPPXQLW\JUHZ7KH:53LVFXUUHQWO\KDQGOLQJIORZVWKDWDUHFORVHWRWKH SHUPLWWHG7&(4DOORZDQFHVWKXVWKH&LW\RI'HQWRQHQWHUHGLQWRDQDJUHHPHQWZLWK 5REVRQ5DQFKWRGHFRPPLVVLRQWKH:53DQGURXWHIORZWRWKH&LW\¶VPDLQFROOHFWLRQ V\VWHP  7KLVSURMHFWLVDWZRSKDVHDSSURDFKWRUHOLHYHWKHDGGLWLRQDOIORZVFXUUHQWO\WUHDWHGE\WKH H[LVWLQJ:533KDVH,ZLOOVSOLWWKHIORZVWKDWDUHLQWKH5REVRQEDVLQV7KHHDVWIORZV ZLOOEHSXPSHGIURPWKHH[LVWLQJHDVWOLIWVWDWLRQLQWRDQHZO\FRQVWUXFWHGIRUFHPDLQ7KLV ZLOOEHUHFHLYHGE\WKH+LFNRU\&UHHN,QWHUFHSWRUUHVXOWLQJLQKDOIRIWKHFXUUHQW5REVRQ IORZVEHLQJWUHDWHGDWWKH3HFDQ&UHHN:535REVRQ:53ZLOOFRQWLQXHWRWUHDWWKHZHVW VLGHRI5REVRQ7KLVUHGLUHFWLRQRIIORZVZLOOUHGXFHWKHSUHVVXUHRQWKH5REVRQ:53,Q WKHVHFRQGSKDVHRIWKLVSURMHFWWKH:53ZLOOEHGHFRPPLVVLRQHGDVDWUHDWPHQWSODQWDQG FRQYHUWHGLQWRDSHDNVWRUDJHOLIWVWDWLRQ7KLVZLOOUHTXLUHWKDWH[LVWLQJIDFLOLWLHVUHPDLQLQ SODFHWKH\ZLOOPHUHO\RSHUDWHGLIIHUHQWO\7KLVZLOOHQVXUHWKDW5REVRQFDQFRQWLQXHWR JURZXQLPSHGHGE\OLPLWDWLRQVRIZDVWHZDWHULQIUDVWUXFWXUHDQGZLOODOLJQZLWKWKH&LW\¶V RYHUDOO :: 0DVWHU 3ODQ DQG FXUUHQW LQIUDVWUXFWXUH DYDLODEOH 6WDII FRQWDFW 5DQGHH .OLQJHOH)LQDQFHDQG6WHSKHQ*D\:DWHU8WLOLWLHV  & )R[FURIW&LUFOH&RQVWUXFWLRQ6WDWXV±2Q2FWREHU0D\RU3UR7HP%HFNFRQWDFWHGVWDII LQTXLULQJDERXWWKHFRQVWUXFWLRQVWDWXVRI)R[FURIW&LUFOH7KH)R[FURIW&LUFOHDQG$UFKHU 5 7ULDOVHJPHQWVDUHSDUWRIWKH'HQWRQ6WUHHW5HKDELOLWDWLRQSURMHFW7KHXWLOLW\GLWFKOLQH UHSDLURQ$UFKHU7UDLOLVVFKHGXOHGWREHFRPSOHWHGZLWKLQWKHQH[WWZRZHHNVZHDWKHU SHUPLWWLQJ)R[FURIW &LUFOH LV LQ WKH SXQFK OLVW SKDVH RI WKH SURMHFW ZLWK RQO\ WKH DGMXVWPHQWVRIWKHPDQKROHLQWKHILQDOSDYHPHQWZKLFKLVVHWWREHFRPSOHWHGSHQGLQJ GHOLYHU\RIWKHULQJDQGFRYHUV7KHFXUUHQWVFKHGXOHVKRZVWKHSURMHFWWREHFRPSOHWHGLQ WZR WR WKUHH ZHHNV ZHDWKHU SHUPLWWLQJ 6WDIIFRQWDFW 'XVWLQ 'UDSHU &DSLWDO 3URMHFWV(QJLQHHULQJ  ' &RQVWUXFWLRQDW/RQGRQGHUU\DQG6DP%DVV%RXOHYDUG±2Q2FWREHU0D\RU3UR7HP %HFN FRQWDFWHG VWDII LQTXLULQJ DERXW WKH FRQVWUXFWLRQ DW /RQGRQGHUU\ DQG 6DP %DVV %RXOHYDUGDQGUHTXHVWLQJWKDWVWDIIHYDOXDWHRSWLRQVWKH&LW\KDVDYDLODEOHWRKHOSUHGXFH FRQVWUXFWLRQLPSDFWVWRUHVLGHQWV7KLVFRQVWUXFWLRQLVUHODWHGWRWKHZDWHUDQGVDQLWDU\ VHZHU LPSURYHPHQWV EHLQJ SHUIRUPHG E\ 8UEDQ /RJLVWLFV ¶V SULYDWH GHYHORSPHQW SURMHFW'XHWRVDIHW\FRQFHUQVDIXOOURDGZD\FORVXUHZDVLQFOXGHGLQWKHSURMHFWDUHD 0DLOHUVWRWKHSXEOLFZHQWRXWRQ6HSWHPEHUSOHDVHVHHWKHattachedGRFXPHQW7KH FRQWUDFWRULVZRUNLQJZLWKWKHDSDUWPHQWFRPSOH[WRLGHQWLI\RSWLRQVWRKHOSPLWLJDWHWKH WUDIILFLQWKHSDUNLQJORW6WDIIZLOOFRQWLQXHWRPRQLWRUWKLVVLWXDWLRQDQGHQVXUHDOO UHVLGHQWV DUH DEOH WR VDIHO\ GHWRXU WKLV DUHD 6WDIIFRQWDFW:HVOH\ 0F%ULGH &DSLWDO 3URMHFWV(QJLQHHULQJ  Upcoming Community Events and Meetings $ (QHUJ\(IILFLHQF\7LSVDQG7ULFNV±-RLQXVRQ2FWREHUDWDPDW(PLO\)RZOHU /LEUDU\WROHDUQKRZWRVDYHHQHUJ\DQGVDYHPRQH\5693RQOLQHWROHDUQWKHEDVLFVRI HQHUJ\HIILFLHQF\HDV\DWKRPHXSJUDGHVDVZHOODVFLW\UHVRXUFHVDQGSURJUDPVWKDWFDQ KHOSWROLJKW\RXUZD\6WDIIFRQWDFW.DWKHULQH%DUQHWW6XVWDLQDELOLW\  % +RZO2:HHQ&DUQLYDO +DXQWHG+RXVH±2Q2FWREHUIURPDPXQWLOQRRQ 0DUWLQ/XWKHU.LQJ-U5HF&HQWHUZLOOKRVWDIUHHFRPPXQLW\FDUQLYDOZLWKJDPHVJRRGLH EDJVIDFHSDLQWLQJERXQFHKRXVHVDQGDFRVWXPHFRQWHVW&RQFHVVLRQVZLOOEHDYDLODEOH IRU SXUFKDVH 7KH 'HQWRQ $QLPDO 6KHOWHU ZLOO DOVR EH RQVLWH IRU D VSHFLDO DGRSWLRQ GULYH&RPHEDFNIURPWRSPWRUHOLYHFODVVLFKRUURUPRYLHVDWRXUKDXQWHGKRXVH JXDUDQWHHGWRKDYH\RXVFUHDPLQJZLWKIXQ(QWU\LVSHUSHUVRQ6WDIIFRQWDFW&KH\ORQ %URZQ3DUNVDQG5HFUHDWLRQ  & 'HQWRQ&RXQW\+RPHOHVV9HWHUDQV6WDQG'RZQ±7KH'HQWRQ&RXQW\9HWHUDQV&RDOLWLRQ LV KRVWLQJ LWV WK$QQXDO 'HQWRQ &RXQW\ +RPHOHVV 9HWHUDQV 6WDQG 'RZQ HYHQW RQ 7KXUVGD\ 2FWREHU  DW WKH 'HQWRQ &LYLF &HQWHU IURP  DP WR  SP 9HWHUDQV H[SHULHQFLQJKRPHOHVVQHVVZLOOKDYHWKHRSSRUWXQLW\WRFRQQHFWWRHPSOR\PHQWVHUYLFHV KRXVLQJSURJUDPVDQGRWKHUFRPPXQLW\RUJDQL]DWLRQVSURYLGLQJUHVRXUFHVDQGVXSSRUWLYH VHUYLFHV6WDIIFRQWDFW0HJDQ%DOO&RPPXQLW\6HUYLFHV  ' +DOORZHHQ7HQQLV)XQ±&RPHRXWWRWKH*ROGILHOG7HQQLV&HQWHU)ULGD\2FWREHU IURPWRSPDQGHQMR\DIXQILOOHGHYHQWIHDWXULQJDYDULHW\RIJDPHVLQFOXGLQJ 6FRRSLWXS0RQNH\VDQG%DQDQDVDQG7HQQLV6WURNH6SHOO2XW:LQQHUVZLOOEHVHOHFWHG IRUWKHEHVWRYHUDOOER\JLUODQGIDPLO\SDUWLFLSDQWV7KLVHYHQWUXQVIURPWRSP DWWKH*ROGILHOG7HQQLV&HQWHU::LQGVRU'UQH[WWRWKH1RUWK/DNHV5HFUHDWLRQ &HQWHU6WDIIFRQWDFW.HOVH\6WXDUW3DUNVDQG5HFUHDWLRQ ( 0RYLHLQWKH3DUN+RFXV3RFXV – 4XDNHUWRZQ3DUNLVKRVWLQJDVFUHHQLQJRIWKHRULJLQDO +RFXV3RFXVRQ)ULGD\2FWREHUIURPWRSPZLWKSUHVKRZIXQLQFOXGLQJSXPSNLQ 6 SDLQWLQJLQIODWDEOHVODZQJDPHVDQGDFRVWXPHFRQWHVWVWDUWLQJDWSPDQGWKHPRYLH DWSP6WDIIFRQWDFW$ULDQQD%HQFLG3DUNVDQG5HFUHDWLRQ  ) +DOORZHHQ+LNH2Q)ULGD\2FWREHUIURPWRSP'HQWRQ3DUNVDQG5HFZLOOKRVW DIDPLO\IULHQGO\IUHHQLJKWKLNHDW6RXWK/DNHV3DUN1DWXUH7UDLO6WDIIZLOOWDNHJURXSV HYHU\PLQXWHVWRVHHWKHP\VWHULRXVVLGHRIQDWXUHRQDPLOHKLNH6WDIIFRQWDFW &DULQ=HPDQ3DUNVDQG5HFUHDWLRQ  * 5HF\FOLQJ±-RLQ6XVWDLQDELOLW\IRU1DWLRQDO5HF\FOLQJ'D\RQ1RYHPEHUWRUHYLHZ ZKDW¶VDFFHSWHGLQFXUEVLGHUHF\FOLQJZKHUHWKHUHF\FOLQJJRHVZK\FHUWDLQLWHPVDUHQRW DFFHSWHG DQG ZKDW UHF\FOLQJ EHFRPHV7KH GLVFXVVLRQZLOO DOVR LQFOXGHVXVWDLQDEOH DOWHUQDWLYHVWRUHF\FOLQJ5693RQOLQHWRMRLQ5HF\FOLQJDWSPDW(PLO\)RZOHU /LEUDU\6WDIIFRQWDFW.DWKHULQH%DUQHWW6XVWDLQDELOLW\  + &UHDWLQJLQ$FU\OLFVDWWKH'HQWRQ6HQLRU&HQWHU±2Q2FWREHUWKHILUVW&UHDWLQJLQ $FU\OLFVFODVVZDVWDXJKW E\&DUPHQ/D[DW WKH'HQWRQ 6HQLRU&HQWHU1RYLFHDQG H[SHULHQFHGSDLQWHUVFDQOHDUQDQGJURZWKHLUSDLQWLQJVNLOOVDVHDFKVL[ZHHNVHVVLRQ IRFXVHVRQDGLIIHUHQWWHFKQLTXH7KLVVHVVLRQIRFXVHVRQSDLQWLQJVFHQHU\IXWXUHVHVVLRQV ZLOOLQFOXGHSDLQWLQJ6WLOO/LIHDQG3RUWUDLWV&ODVVHVDUHKHOG7XHVGD\VIURPWR SPDQGSUHUHJLVWUDWLRQLVUHTXLUHG5HJLVWUDWLRQLVDYDLODEOHRQOLQHLQSHUVRQRURYHU WKHSKRQHDW  6WDIIFRQWDFW1LFROH%UDVKHU3DUNVDQG5HFUHDWLRQ  Attachments $ &RUH9DOXHV(PDLO % 6 35DWLQJ5HSRUW & 8SGDWHRQ6DP%DVV%OYG /RQGRQGHUU\/Q7UDIILF,PSDFWV  Informal Staff Reports $ '0(1RWLFHWR'HYHORSHUV % 9LOODVRI3LQH\&UHHN+2$  Council Information  $ &RXQFLO5HTXHVWVIRU,QIRUPDWLRQ % 3XEOLF0HHWLQJ&DOHQGDU & 'UDIW$JHQGDIRU1RYHPEHU ' )XWXUH:RUN6HVVLRQ,WHPV ( 6WUHHW&RQVWUXFWLRQ5HSRUW 7 1 Birdseye, Stuart From:Hensley, Sara <Sara.Hensley@cityofdenton.com> Sent:Wednesday, October 19, 2022 2:53 PM Subject:Introducing our updated Core Values City of Denton Employees, One thing I have had the pleasure to experience throughout my time with the City of Denton is the ability of our employees to come together and achieve great things. As City Manager, I’ve begun working with the leadership and City Council to establish the direction for the coming years. These discussions naturally led to conversations regarding our core values and if they continue to best support our ongoing efforts as well as how we best serve the community Recognizing that we are in a different place now than we were five years ago, it was my pleasure to announce a new set of organizational core values at today’s employee forum. These new core values developed from extensive discussions with our leadership team, better supporting who we are now and where we want to point our compass for the future. Additionally, they build on our previous core values, which remain incredibly important attributes for our organization as we continue to build our success around them. Our new values are meant to provide a road map that guides us forward and teaches us how to accomplish our work. Going forward, we will:  strive to be INCLUSIVE by creating a sense of belonging for all. An environment where individuals and groups are valued, respected, and supported. From the top down and the bottom up.  pursue being COLLABORATIVE by listening, being open-minded, and forward-thinking while working together towards a collective goal.  commit to being SERVICE-ORIENTED by anticipating, recognizing, and proactively addressing the needs of those we serve.  strive to be STRATEGICALLY FOCUSED by always thinking with the future in mind.  value being FISCALLY RESPONSIBLE by ensuring financial sustainability through the responsible use of City resources. I look forward to working with you as we move our organization forward together. Thank you for the work you do, day- in and day-out, to make our community a place to live, work, learn and play. Sara Hensley 8 Denton, Texas; CP; Combined Utility; Retail Electric Primary Credit Analyst: Paul J Dyson, Austin + 1 (415) 371 5079; paul.dyson@spglobal.com Secondary Contact: Alexandra Rozgonyi, Centennial + 1 (303) 721 4824; alexandra.rozgonyi@spglobal.com Table Of Contents Credit Highlights Outlook Credit Opinion Related Research WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 19 Denton, Texas; CP; Combined Utility; Retail Electric Credit Profile Denton comb util Long Term Rating A+/Stable Outlook Revised Denton retail elec (AGM) Unenhanced Rating A+(SPUR)/Stable Outlook Revised Denton util sys rev extendable cml pap nts prog ser A due 01/12/2031 Short Term Rating A-1 Affirmed Many issues are enhanced by bond insurance. Credit Highlights • S&P Global Ratings revised the outlook to stable from negative and affirmed its 'A+' long-term rating and underlying rating (SPUR) on the City of Denton, Texas' utility system debt outstanding. • At the same time, we affirmed our 'A-1' short-term rating on Denton's commercial paper (CP) notes. • The outlook revision reflects our view of Denton's improved risk management, culture, and oversight since Texas' February 2021 winter storm, including improved weatherization internally at Denton and also by external state agencies that reduces outage risk for Denton's gas-fired generating facility, which is critical not only as backup generation given Denton's heavy reliance on intermittent renewable energy, but also given the plant's importance to the overall reliability of the Electric Reliability Council of Texas (ERCOT) grid. • The outlook revision further reflects Denton's improved resource adequacy, procedures, power supply planning, and hedging practices for both natural gas and purchased power, and various incremental reforms made in the ERCOT market over the past year or so that better insulate electric utilities such as Denton from extreme weather and high market prices for power and gas. Security A first lien on net revenue of Denton's combined electric, water, and wastewater systems secures the bonds, with approximately $333 million in utility revenue bonds debt outstanding as of fiscal year-end 2022 (Sept. 30). In addition, more than $614 million of general obligation bonds and other tax-secured debt was issued on behalf of the utility and is outstanding; by practice, the combined utility fully self-supports the entirety of its allocable tax-backed debt and our financial analysis and fixed-charge coverage (FCC) calculations incorporate the capacity of the combined utilities' net revenue to service both the revenue debt and the general obligation/tax-secured debt. The short-term, or CP, rating is linked to the long-term rating based on the application of our "Methodology For Linking Long-Term And Short-Term Ratings," published April 7, 2017, on RatingsDirect. In fiscal 2021, as in prior years, compared with the contributions of the water and sewer systems to net revenue available for debt service, the net revenue of the electric system provided more than two-thirds of net revenue WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 210 available for debt service, making it the focus of our analysis. Credit overview As a result of the February 2021 winter storm event, Denton paid $210 million in storm-related charges to ERCOT for electric power, and $28 million in fuel and power purchase agreement expenses. Concurrent with those expenses, Denton received approximately $97 million of ERCOT payments and credits for power that it generated and then sold into the ERCOT market, for a net storm cost of $140 million. The costs were extreme when compared with the $64 million in purchased power expenses for the entirety of fiscal 2020. The cost to Denton was significant primarily because its 225-megawatt (MW) natural-gas-fired, quick-start combustion engine power plant, the Denton Energy Center (DEC), was unable to source natural gas during the storm. While idle, because of the lack of heat from burning natural gas, the plant experienced frozen pipes and could not operate for two days, which curtailed its opportunity to make market sales at the prevailing high prices. The plant's reduced capacity as a result of system freezes during the balance of the storm event led to additional expenses and forgone offsetting revenue. Such sales might have tempered or offset some of the unbudgeted expenses it incurred. In addition, Denton's demand was 30% above forecast peak load, which exacerbated the situation. Denton funded the costs through the issuance of commercial paper (CP) that has since been refinanced into long-term debt. Over the course of a year, the city contracts for renewable resources at levels commensurate with annual retail sales or higher, but the output of the renewable resources does not always align with native load customers' energy demand. Therefore, the city sells surpluses during some hours and purchases shortfalls from the market in other hours. The city will also rely on the dispatch of its DEC gas-fired units to help meet customer demand during hours when renewable resources are dormant or when doing so is otherwise economic. Peak demand during summer 2022 was 392 MW, a record, and was 6% above forecast. Firm resources to meet peak demand include the 225 MW DEC. Denton also has two power purchase agreements (PPAs) through which it receives liquidated damages in the event minimum capacity is not attained: a wind PPA of 30 MW and a solar/wind PPA of an additional 25 MW. Unit-contingent renewable energy resources provide an additional 355 MW of capacity, both wind (150 MW) and solar (205 MW) PPAs. Inclusive of intermittent resources, Denton has 635 MW of capacity to meet recent summer peak demand of 392 MW, with the DEC accounting for 35% of total resources and 57% of recent peak demand. An additional 75 MW of solar generation is pending operation but has been delayed as a result of supply chain issues, and Denton has a request for proposal out for another 250 MW of solar or wind generation, with wind generation likely to be coastal (not offshore) because such a location better matches with Denton's load patterns. Denton is adding more resources to serve its growing load and to limit exposure to more costly market purchases. Because of the potential for a shortfall between Denton's available energy resources and load during certain hours, and because of periodic high market prices for power in ERCOT during peak demand, we believe the various tools, practices, and procedures Denton maintains to shield itself from spikes in power and natural gas prices are critical from a credit standpoint. We also focus on how Denton has remediated its owned generation assets from extreme weather events, and the extent to which external developments within ERCOT limit these exposures. We view recent developments along these lines as positive and materially reducing Denton's exposure to high power prices and natural gas disruptions. S&P Global Ratings has also conducted a stress test that assumes heightened demand, diminished resources, and exposure to the scarcity pricing cap under various scenarios. In our view, the potential WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 3 Denton, Texas; CP; Combined Utility; Retail Electric 11 increase in power costs would be manageable at the rating largely as a result of the credit-supportive role and value of Denton's liquidity. The 'A+' rating further reflects our view of the system's: • Deep and diverse service area just north of the Dallas-Fort Worth metroplex, with a growing, primarily residential customer base that lacks significant concentration, and exhibits income levels near the national average; • Primarily non-carbon-emitting power supply to meet retail load during many hours, which reduces longer-term regulatory risks with regard to carbon emissions; • Good FCC that has averaged 1.3x over the past three fiscal years and that, according to projections that we deem reasonable, we calculate at a solid 1.3x to 1.6x during fiscal years 2022 through 2026; and • Ample liquidity totaling about $172 million, or near 200 days' operating expenses, in fiscal 2021 that we believe partly offsets risks associated with power and natural gas price volatility. Partly offsetting the above strengths, in our view, are the system's: • Potentially short resource position during certain periods given much heavier reliance on intermittent resources than that of peers and periodic peak demand above forecast, which could increase costs significantly and reduce liquidity; • Some remaining vulnerability related to its non-firm natural gas supply, although we recognize additional remediation measures are underway or under consideration to reduce gas supply disruption risks; and • Above-average electric rates versus the state average although we view water and wastewater rates as very competitive. Peak demand figures exclude data center Core Scientific, a relatively new customer in the city with 22 MW of demand in fiscal 2022 (accelerating to 300 MW in fiscal 2023). According to the PPA between Denton and Core Scientific, Denton's other customers assume no price risk associated with this customer. Environmental, social, and governance We view environmental risks as moderately credit negative given Denton's location in a region subject to extreme weather events combined with the inherent limitations of the ERCOT market, although market conditions have improved over the past year. In our view, these risks require more sophisticated financial planning and hedging and lead to higher power costs given the need for a long position. With regard to emissions, however, the combined utility has taken significant steps in recent years to reduce its carbon footprint and meet potential greenhouse gas emission regulations, given that its power supply centers on renewables and natural-gas-fired peaking generation and has shifted away from coal. In February 2018, the city council adopted the Denton Renewable Resource Plan, which set a goal to have under contract 100% of the city's annual electricity from renewables by 2020. Management reports that 100% of net energy resources for retail load in fiscal 2021 consisted of renewable energy on an overall basis, and is backed up by the DEC, when needed. Nonetheless, the output of renewable energy resources doesn't necessarily align with consumption patterns during many hours, alternately creating surpluses and shortfalls, both of which expose the utility to volatile prices in the competitive ERCOT market. WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 4 Denton, Texas; CP; Combined Utility; Retail Electric 12 Social factors are credit neutral, in our view, given rates that we believe are generally competitive and income levels that are near the national average. However, to the extent that power costs rise over time or capital needs grow considerably for the electric, water or wastewater system, social risks could increase as a result of reduced rate affordability. In addition, two other transmission/distribution utilities can serve almost half of its potential service territory, undeveloped, with one utility offering retail choice. The city has not opted into customer choice, so current customers cannot switch. Overall, we have not seen competition manifest as a material credit risk to Denton. In our view, governance risks have eased over the past year given risk management improvements internally at Denton, steps taken externally by ERCOT, the Public Utility Commission of Texas (PUCT), and the Texas Railroad Commission (TRRC) to improve resource adequacy and power supply reliability, and measures taken to reduce power supply cost volatility. Nonetheless, as with other utilities operating in ERCOT, governance risk is heightened and moderately credit negative given that the environment in which Denton operates requires stronger liquidity, proactive planning, hedging, and financial flexibility, which come at a cost, versus utilities in regions where these risks are lower. Outlook The stable outlook reflects our view that at the rating, Denton's power supply resources, refined power and natural gas hedging procedures, weatherization, and robust liquidity are sufficient to mitigate exposure to demand and power cost volatility that we view as endemic to utilities operating in ERCOT. Downside scenario We could lower the rating if Denton's portfolio of renewable resources creates surpluses and short positions attributable to mismatches among the production and dormancy hours of renewable resources, and if native customers' load requirements expose the utility to significant unbudgeted expenses. ' Upside scenario We could raise the rating over the next two years to the extent Denton's financial metrics materially exceed forecast and we believe they can be sustained at such levels. In making this evaluation, we will also take into account management's ongoing risk management activities related to its operation within ERCOT and in a region subject to extreme weather, including any additional measures taken to shield itself from power supply spikes and natural gas supply disruptions. Credit Opinion The rating reflects our view of Denton's strong enterprise risk profile, with a diverse and primarily residential customer base, slightly below-average income indicators, above-average electric rates, and mostly renewable power portfolio, although Denton's heavy reliance on intermittent power to meet peak load and recent challenges related to gas supply resiliency partly offset this. Our assessment of Denton's strong financial risk profile reflects our forward-looking view of strong FCC and liquidity, and manageable debt burden. We have applied a one-notch positive adjustment from the initial indicative rating to arrive at the final rating given the amalgam of Denton's strong financial metrics, which temper operational exposures that persist but are not as prominent as they were before the February 2021 winter WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 5 Denton, Texas; CP; Combined Utility; Retail Electric 13 storm, coupled with a strategic plan to reduce the probability of gas supply disruptions and exposure to high prices for power and gas. We believe these factors to be supportive of the 'A+' rating. Denton's combined utility provides electric, water, wastewater, and drainage services to the city. Median household effective buying income was 96% of the national average and weighted average electric system rates were 9% above the state average, both as of 2021. These factors somewhat limit Denton's financial flexibility, although we understand that no rate increases are planned until 2024 and water and wastewater rates are very competitive. Water and wastewater operations are stable with ample system capacity, in our view. Despite widespread drought conditions throughout Texas, Denton's water supply has been resilient. According to management's financial forecast, we calculate that FCC will range from 1.3x to 1.6x over the next five years, versus about 1.3x on average in fiscal years 2019 to 2021. In our view, the financial forecast and related assumptions are reasonable. System liquidity is robust with about $172 million in cash, or 193 days' operating expenses, as of fiscal 2021, with estimated liquidity balances for fiscal 2022 at $192 million, or 236 days' cash. We view such liquidity as a significant credit positive given the various operating risks facing Denton in the ERCOT market and given exposure to extreme weather and volatile market prices for power in the event that generation does not perform as expected (and in the event of another gas supply interruption). In our view, Denton's debt to capitalization is manageable at about 51%. The five-year capital plan for the combined utilities totals $688 million, with management anticipating funding $520 million with additional debt. We believe the size of the capital plan and borrowing needs could constrain future FCC and lead to higher rates. Some recent measures reduce but don't eliminate risk Denton's engineering consultant has provided alternative fuel and weatherization options for the DEC. The DEC is a critical asset, not only for Denton but also for the ERCOT grid as a whole, given that it backs up Denton's significant, intermittent renewable energy portfolio. In the event ERCOT's grid fails--as it almost did in February 2021--the DEC is an important asset to the grid and can start without grid support, enabling the grid to recover from a true blackout condition. One weatherization project underway involves the addition of a separate and higher concentration blend of glycol and water storage that will be seasonally adjusted with the normal and lower concentration blend. This new equipment will enable the DEC to sustain off-line operations down to negative 5 degrees Fahrenheit, improved from the prior design point of 19 degrees Fahrenheit. The project will be complete by winter 2023-24. Management is also investigating additional gas pipelines and options to add compression to lines to required usable pressure. A new standard operating procedure is in place to quickly drain fluid if natural gas pressure is lost, to prevent freeze-ups. Management also plans to manage power supply and hedge positions six to 10 days and up to one month ahead of predicted extreme temperatures, rather than one to five days in advance under its policy before the February 2021 winter storm. Regarding the use of alternative fuels at the DEC, we understand engineering and capital cost estimates have been completed and financial analysis is ongoing. The DEC is able to run on liquefied natural gas and propane, but we understand burning fuel oil would require a major change in its permit. Evolving U.S. Environmental Protection Agency rules on ozone emissions could also limit Denton's ability to burn alternative fuels. Denton is also evaluating its options to participate in ERCOT's future Firm Fuel Reliability Service, a new program focusing on grid reliability WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 6 Denton, Texas; CP; Combined Utility; Retail Electric 14 under which Denton can get compensated for its generation resources that meet a higher resiliency standard, with the overall goal of maintaining resource availability in the event of a natural gas curtailment or other fuel supply disruption within ERCOT. We understand the lateral line that supplies gas (non-firm) to the DEC has passed inspection by the TRRC. Since the February 2021 winter storm, pursuant to Senate Bill 3, ERCOT and the PUCT have identified all of the critical natural gas infrastructure within ERCOT, and the TRRC has adopted weatherization rules. By Dec. 1, 2022, and each Dec. 1 thereafter, operators deemed critical must implement (and attest to the completion of) weather emergency preparation measures that promote the sustained operation of facilities. These operators must also rectify any known issues related to major weather-related forced stoppages that disrupted operations during previous weather emergencies. Inspections by the TRRC will begin this winter with possible $1 million penalties for violations. We believe these measures reduce the risk of gas supply interruptions, not only for Denton's plant but for other critical infrastructure statewide. Denton engages in natural gas hedging through a combination of term financial hedges based on expected annual and seasonal operating hours and three-month hedges optimized based on weather forecasts and overall market conditions. Denton hedges gas one quarter or one year in advance of needs, depending on market conditions. If gas prices rise, Denton will hedge a higher quantity and earlier. Denton plans to hedge 100% of gas supply needs by Nov 15 for December, January, and February (winter) months. Nonetheless, an interruptible fuel supply tempers the benefits of hedging. We also note that rising natural gas prices have resulted in higher power prices in both the spot and term markets. Denton reports that hedging natural gas in this higher price environment involves the sales of heat rates and the purchase of fixed-price power; heat rate transactions provide a highly correlated hedge to natural gas price volatility. Other ERCOT-related developments that limit Denton's exposure to peak pricing include improved ERCOT reserve margins, which means fewer hours subject to peak or "scarcity" pricing. In addition, in December 2021 the PUCT announced a reduction in the price cap for power to $5,000 per MW-hours from $9,000 per MW-hours. In addition, ancillary services are no longer uncapped. We also understand that ERCOT power plant inspections were completed in 2021 with only a few plants failing inspection. Given these various developments, and the improved risk management practices internally at Denton, we believe Denton is materially less exposed to high prices for power, disruptions in natural gas deliveries, and DEC unplanned outages. Denton also maintains ample liquidity, totaling $172 million as of fiscal 2021, which we view as a substantial but necessary buffer against operating risks. Related Research Through The ESG Lens 3.0: The Intersection Of ESG Credit Factors And U.S. Public Finance Credit Factors, March 2, 2022 WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 7 Denton, Texas; CP; Combined Utility; Retail Electric 15 WWW.STANDARDANDPOORS.COM/RATINGSDIRECT OCTOBER 17, 2022 8 STANDARD & POOR’S, S&P and RATINGSDIRECT are registered trademarks of Standard & Poor’s Financial Services LLC. S&P may receive compensation for its ratings and certain analyses, normally from issuers or underwriters of securities or from obligors. S&P reserves the right to disseminate its opinions and analyses. S&P's public ratings and analyses are made available on its Web sites, www.standardandpoors.com (free of charge), and www.ratingsdirect.com (subscription), and may be distributed through other means, including via S&P publications and third-party redistributors. Additional information about our ratings fees is available at www.standardandpoors.com/usratingsfees. S&P keeps certain activities of its business units separate from each other in order to preserve the independence and objectivity of their respective activities. As a result, certain business units of S&P may have information that is not available to other S&P business units. S&P has established policies and procedures to maintain the confidentiality of certain non-public information received in connection with each analytical process. To the extent that regulatory authorities allow a rating agency to acknowledge in one jurisdiction a rating issued in another jurisdiction for certain regulatory purposes, S&P reserves the right to assign, withdraw or suspend such acknowledgment at any time and in its sole discretion. S&P Parties disclaim any duty whatsoever arising out of the assignment, withdrawal or suspension of an acknowledgment as well as any liability for any damage alleged to have been suffered on account thereof. Credit-related and other analyses, including ratings, and statements in the Content are statements of opinion as of the date they are expressed and not statements of fact. S&P’s opinions, analyses and rating acknowledgment decisions (described below) are not recommendations to purchase, hold, or sell any securities or to make any investment decisions, and do not address the suitability of any security. S&P assumes no obligation to update the Content following publication in any form or format. The Content should not be relied on and is not a substitute for the skill, judgment and experience of the user, its management, employees, advisors and/or clients when making investment and other business decisions. S&P does not act as a fiduciary or an investment advisor except where registered as such. While S&P has obtained information from sources it believes to be reliable, S&P does not perform an audit and undertakes no duty of due diligence or independent verification of any information it receives. Rating- related publications may be published for a variety of reasons that are not necessarily dependent on action by rating committees, including, but not limited to, the publication of a periodic update on a credit rating and related analyses. No content (including ratings, credit-related analyses and data, valuations, model, software or other application or output therefrom) or any part thereof (Content) may be modified, reverse engineered, reproduced or distributed in any form by any means, or stored in a database or retrieval system, without the prior written permission of Standard & Poor’s Financial Services LLC or its affiliates (collectively, S&P). The Content shall not be used for any unlawful or unauthorized purposes. S&P and any third-party providers, as well as their directors, officers, shareholders, employees or agents (collectively S&P Parties) do not guarantee the accuracy, completeness, timeliness or availability of the Content. S&P Parties are not responsible for any errors or omissions (negligent or otherwise), regardless of the cause, for the results obtained from the use of the Content, or for the security or maintenance of any data input by the user. The Content is provided on an “as is” basis. S&P PARTIES DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR USE, FREEDOM FROM BUGS, SOFTWARE ERRORS OR DEFECTS, THAT THE CONTENT’S FUNCTIONING WILL BE UNINTERRUPTED OR THAT THE CONTENT WILL OPERATE WITH ANY SOFTWARE OR HARDWARE CONFIGURATION. In no event shall S&P Parties be liable to any party for any direct, indirect, incidental, exemplary, compensatory, punitive, special or consequential damages, costs, expenses, legal fees, or losses (including, without limitation, lost income or lost profits and opportunity costs or losses caused by negligence) in connection with any use of the Content even if advised of the possibility of such damages. Copyright © 2022 by Standard & Poor’s Financial Services LLC. All rights reserved. 16 17 2FWREHU5HSRUW1R 1 INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: '0( 1RWLFH WR 'HYHORSHUV GXH WR 6XSSO\ &KDLQ ,PSDFWVWR (OHFWULF 6\VWHP 'HYHORSPHQW BACKGROUND: 6XSSO\FKDLQLVVXHVIDFHGE\'0(IRUWKHHTXLSPHQWQHHGHGWRFRQQHFWQHZFXVWRPHUVDQGWR LPSOHPHQWXSJUDGHVWRWKH'0(GLVWULEXWLRQV\VWHPDUHVWDUWLQJWRLPSDFW'0(¶VDELOLW\WRPHHW WKHGHPDQGVRIWKHGHYHORSPHQWFRPPXQLW\7KHHTXLSPHQWDQGGHYLFHVLQFOXGHEXWQRWOLPLWHG WRPDQ\RIWKHUDZPDWHULDOVDQGFRPSRQHQWVIRUWUDQVIRUPHUV39&SLSLQJXQGHUJURXQGFDEOH FRSSHUDQGDOXPLQXP RYHUKHDGFRQGXFWRU DOXPLQXP +LJK9ROWDJHFRQQHFWRUVDQGSHGHVWDO VW\OHWHUPLQDWLRQFDELQHWV 'HVSLWHWKHVXSSO\FKDLQLVVXHVIDFHGE\DOOHOHFWULFXWLOLWLHVGHYHORSPHQWLQ'HQWRQFRQWLQXHVDW DQHYHULQFUHDVLQJSDFHDVVKRZQLQ)LJXUH Figure 1 – DME Customer Growth '0(FXUUHQWO\KDVFXVWRPHUV6LQFH \HDUV '0(KDVVHHQDLQFUHDVH LQFXVWRPHUV%HVLGHVWKHQHHGWRSURYLGHWKHQHFHVVDU\PDWHULDOVDQGHTXLSPHQWWRPHHWWKLV JURZWK'0(PXVWDVVXUHLWKDVVXIILFLHQWPDWHULDOVWRFNVWRUHVSRQGWRGDLO\VHUYLFHLVVXHVDV ZHOODVLWVDELOLW\WRUHVSRQGWRDPRUHZLGHVSUHDGHYHQWRQWKHV\VWHP$VDGLUHFWUHVXOWRI VHUYLQJPRUHFXVWRPHUVWKHQXPEHURISLHFHVRIHOHFWULFDOHTXLSPHQWDQGPDWHULDOVQHFHVVDU\WR 0 10000 20000 30000 40000 50000 60000 70000 2017 2018 2019 2020 2021 2022 Customer Growth Residential Government Commercial Industrial 18 2FWREHU5HSRUW1R 2 PDLQWDLQWKHV\VWHPGXHWRURXWLQHRXWDJHVKDVLQFUHDVHGDQGJHWWLQJWKDWHTXLSPHQWGXULQJWKLV VXSSO\FKDLQLQWHUUXSWLRQKDVIXUWKHUH[DFHUEDWHGWKHODFNRILQYHQWRU\DYDLODEOHWRPHHW GHYHORSHUQHHGV '0((QJLQHHULQJWUDFNVDOOGHYHORSPHQWVWKDWZHKDYHWKHSHQLWHQWLDOWRVHUYHDQGDOOWKDWZH DUHREOLJDWHGWRVHUYH7DEOHSURYLGHVDTXDQWLW\EUHDNGRZQRISURMHFWFODVVLILFDWLRQDQGVWDWXV RIWKHGDWDEDVHXVHG)LJXUHGHSLFWVWKHQXPEHURIKLVWRULFDOUHVLGHQWLDODQGPXOWLIDPLO\XQLWV WKDWKDYHEHHQLQWHUFRQQHFWHGWRWKH'0(V\VWHPDQGIRUHFDVWVWKHXQLWVEDVHGXSRQ WKHSURMHFWVWKDWKDYHHQWHUHGWKHGHYHORSPHQWVHUYLFHVTXHXH Table 1 - Project Class and Status Residential Multifamily Commercial Improvement Total In Design 17 24 29 57 127 Active 10 9 7 6 32 Totals 27 33 36 63 159 Figure 2 – Historical and Known Developments 414 1,080 502 739 1,272 2,409 108 1,862 743 1,495 1,225 5,151 - 1,000 2,000 3,000 4,000 5,000 6,000 - 500 1,000 1,500 2,000 2,500 3,000 FY17-18 FY18-19 FY19-20 FY20-21 FY21-22 FY22-23 MultifamilyResidentialResidential & Multifamily Residential Multifamily 19 2FWREHU5HSRUW1R 3 'XULQJWKH&29,'\HDUV'0(¶VH[SHULHQFHZLWKHDFKUHYHQXHUDWHFODVVHVZHUHPL[HG 5HVLGHQWLDOGHYHORSPHQWGLGQRWVORZEXWLQFUHDVHGGUDPDWLFDOO\WKLVSDVWILVFDO\HDUZLWKD KLJKHUSURMHFWHGJURZWKRIRYHUQHZUHVLGHQWLDOORWVDGGHGWRWKHV\VWHPIRU)< &RQVWUXFWLRQRIPXOWLIDPLO\XQLWVGLSSHGVOLJKWO\EHWZHHQ)<DQG)<EXW SURMHFWLRQVVKRZH[SHFWHGJURZWKLQ)<RIRYHUQHZPXOWLIDPLO\XQLWV $GGLWLRQDOO\FRPPHUFLDOFXVWRPHUJURZWKKDVEHHQKLJKDVGHSLFWHGRQ)LJXUH Figure 3 – Commercial Rate Base Growth (square feet) &RPPHUFLDOGHYHORSPHQWZLWKLQWKH&LW\RI'HQWRQGLGQRWVORZGXULQJ&29,'DQGLQIDFW '0(H[SHFWVDQH[SRQHQWLDOJURZWKLQQHZFRPPHUFLDOVTXDUHIRRWDJH7KHFKDUWVKRZV'0( FDQH[SHFWDQDGGLWLRQDOVTXDUHIHHWRIFRPPHUFLDOVSDFHLQ)<0RVW FRPPHUFLDOGHYHORSPHQWLVVHUYHGWKURXJKXVHRIWKUHHSKDVHWUDQVIRUPHUV Critical Path Equipment and Materials '0((QJLQHHULQJLGHQWLILHGIRXU  PDWHULDOLWHPVZKLFKDUHFULWLFDOWRWKHGHOLYHU\RIHOHFWULF VHUYLFHIRUIXUWKHUGLVFXVVLRQ7KHFRPSUHKHQVLYHOLVWRIPDWHULDOVLVRYHULWHPVEXW'0( (QJLQHHULQJLVKLJKOLJKWLQJWKHVHIRULOOXVWUDWLYHSXUSRVHV7DEOHLVDOLVWLQJRIWKHVHLWHPV EURNHQGRZQLQWRWKHminimumUHTXLUHPHQWV WKHOHYHO'0(QHHGVWRKDYHRQKDQGWRKDQGOH GDLO\DQGHPHUJHQF\VLWXDWLRQV WKHQXPEHUWKDWKDVEHHQcommittedWRSURMHFWVWKDWDUH ³DFWLYH´ UHOHDVHGRUFDQEHUHOHDVHGWRILHOGRSHUDWLRQVIRUFRQVWUXFWLRQ WKHQXPEHURIHDFK LWHPon-handDQGFXUUHQWO\LQVWRFNWKHFDOFXODWHGshortfall,purchase order dates of the material along with the quantity orderedDQGILQDOO\WKHFXUUHQWlead time - 572,877 141,493 285,767 2,073,536 6,254,518 - 1,000,000 2,000,000 3,000,000 4,000,000 5,000,000 6,000,000 7,000,000 FY17-18 FY18-19 FY19-20 FY20-21 FY21-22 FY22-23 Commercial 20 2FWREHU5HSRUW1R 4 Table 2 – Warehoused Items Status )RULOOXVWUDWLYHSXUSRVHV)LJXUHGHSLFWVWKHSURMHFWHGWLPHOLQH(OERZVWKHLWHPWKDWZH DQWLFLSDWHVKRUWDJHVRILQWKHYHU\QHDUIXWXUH6LPLODUJUDSKVDUHSURYLGHGIRUHDFKLWHPLQ 7DEOHLQWKH$SSHQGL[ Figure 4 - #2 Elbows Supply vs Demand Minimum Committed Total On Hand Shortfall On Order Leadtime 50 kVA (OH)35 8 43 8 35 40: 9/28/2021 50: 4/27/2022 60 Weeks 50 kVA (UG)25 190 215 3 212 60: 6/7/2021 45: 9/28/2021 180: 4/24/2022 30: 7/25/2022 50: 8/24/2022 60 weeks Pedestals 70 545 615 121 494 353: 5/12/2022 200: 7/20/2022 252: 8/12/2022 21-9/14/2022 6 months St Light Pole 24 171 195 0 195 125: 9/29/2021 125: 12/21/2021 150: 5/20/2022 52 weeks #2 Elbows 24 772 796 133 663 136: 3/23/2022 290: 5/04/2022 495: 5/24/2022 Allocation 21 2FWREHU5HSRUW1R 5 7HUPLQDWLRQRIXQGHUJURXQGFDEOHWRDSDGPRXQWHGWUDQVIRUPHULV DFFRPSOLVKHGZLWKDQHOERZ$QHOERZLVFRPSRVHGRIPHWDOSDUWVDQG ILWWLQJVWKDWVOLGHLQWRWKHUHFHLYLQJSRUWRIDWUDQVIRUPHU7KHHOERZLV LQVXODWHGZLWKDUXEEHUFRYHULQJWKDWSURWHFWVLWVHQHUJL]HGSDUWVIURPUHDG\ DFFHVV$PLQLPXPRIWZRHOERZVDUHQHHGHGIRUHYHU\WUDQVIRUPHULQVWDOOHG 2XUFXUUHQWVXSSOLHU7HFKOLQHKDVQRWLILHGXVWKHYHQGRUKDVWKHPRQDQ ³DOORWPHQW´IRURUGHUV,WLVWKHXQGHUVWDQGLQJWKLVPHDQV7HFKOLQHUHFHLYHVD OLPLWHGDPRXQWRIWKHVHLWHPVPRQWKO\±QRPDWWHUKRZPDQ\7HFKOLQHPD\KDYHRQRUGHU 7HFKOLQHGLYYLHVWKHVHRXWWRWKHLUPXOWLSOHFXVWRPHUVRIZKLFK'0(LVRQH'0(PD\RQO\JHW WZR  DPRQWK7KHORZVXSSOLHGYDOXHIRUWKHVHFULWLFDOLWHPVLVH[WUHPHO\SUREOHPDWLFDQG FHUWDLQO\FDQGHOD\PXOWLSOHDFWLYHDQGSURMHFWVLQGHVLJQLIPRUHDUHQRWUHFHLYHG 7KHOHDGWLPHIRUHOERZVLVRQDOORFDWLRQ&XUUHQWO\WKH&R'ZDUHKRXVHKDVRQHKXQGUHG WKLUW\WKUHH  LQVWRFNFRPSDUHGWRWKHVHYHQKXQGUHGQLQHW\VL[  QHHGHGDVPLQLPXP DQGFRPPLWWHGVWRFNSURYLGLQJDVL[KXQGUHGXQLWGHILFLW7KHUHDUHRQRUGHUZLWKDQ DOORFDWHGOHDGWLPH%DVHGRQFXUUHQWLQYHQWRU\OHYHOH[SHFWHGGHOLYHULHVDQGNQRZQDQGDFWLYH SURMHFWV'0(H[SHFWVWKDWZHZLOOQREHDEOHWRVXSSRUWGHYHORSPHQWDFWLYLWLHVDIWHU-DQXDU\ DQGGHSHQGLQJRQGHOLYHU\VFKHGXOHVIRUWKLVLWHPWKHUHDIWHURXUDELOLW\WRVXSSRUW GHYHORSPHQWZLOOEHOLPLWHGE\DYDLODEOHLQYHQWRU\ Mitigation Measures :KLOH'0(KDVEHHQZRUNLQJFRQVFLHQWLRXVO\WRPLWLJDWHWKHLPSDFWVRIWKHVHVXSSO\FKDLQ LVVXHVZHDUHQRZDWDSRLQWWKDWZHEHOLHYHRXUDELOLW\WRVXSSRUWGHYHORSPHQWDFWLYLWLHVZLOO VRRQEHLPSDFWHG1HYHUWKHOHVV'0(¶VSURMHFWSODQQLQJDQGORJLVWLFVSHUVRQQHODUHZRUNLQJ FORVHO\ZLWKWKH&LW\RI'HQWRQ &R' :DUHKRXVHWHDPPHPEHUVWRLGHQWLI\DQ\DFWLYLWLHVRU PHWKRGVWKDWFDQEHXVHGWRPLQLPL]HWKHLPSDFWVRIWKHVHH[WHUQDOLWLHV7KHVHPHDVXUHV LQFOXGH • '0(¶VSURMHFWSODQQLQJDQGORJLVWLFVSHUVRQQHOZRUNFORVHO\ZLWKWKH&LW\RI'HQWRQ &R'  :DUHKRXVHWRLGHQWLI\LWHPV7REHWWHUHVWDEOLVKXSFRPLQJQHHGV'0(3URMHFW3ODQQLQJ DQG/RJLVWLFVVWDIIPHHWRQDZHHNO\EDVLVZLWK&R':DUHKRXVHOHDGHUVKLSWRUHYLHZWKH VWDWXVRIPDWHULDOVQHHGHGIRUDOOXSFRPLQJSURMHFWV7RDVVXUHWKHLWHPVPDQDJHGE\WKH &R':DUHKRXVHDUHRUGHUHGLQDWLPHO\IDVKLRQ'0(3URMHFW3ODQQLQJWDNHVWKHOHDGDQG QRWLILHV&R':DUHKRXVHZKHQWRRUGHUPDWHULDOV • '0(3URMHFW3ODQQLQJSURYLGHV&R':DUHKRXVHDOLVWRIPDWHULDOVQHHGHGZLWKDQLQH   PRQWKRXWORRN • :LWKWKHLQFUHDVHLQOHDGWLPHV'0(LVPDNLQJEXONRUGHUVWRDWWHPSWWRVWD\LQIURQWRIRXU PDWHULDOUHTXLUHPHQWVIRUPDLQWHQDQFHDQGQHZGHYHORSPHQWSURMHFWV • 6SDFHDWWKH&R':DUHKRXVHKDVEHHQDFRQFHUQWRKRXVHODUJHTXDQWLWLHVRISHGHVWDOV +RZHYHU'0(LVPRUHWKDQZLOOLQJWRPDNHDYDLODEOHVSDFHDWWKH6SHQFHUZDUHKRXVHDQG 22 2FWREHU5HSRUW1R 6 DWWKHVXEVWDWLRQVWRKRXVHWKHSHGHVWDOTXDQWLWLHVDVZHOODVDQ\RWKHULWHPVWKDWVSDFHLV QHHGHGIRU • ,IWKHSURSHUWUDQVIRUPHUVL]HLVQRWDYDLODEOH'0(ZLOOXWLOL]HODUJHUN9$WUDQVIRUPHUVWR PHHWVHUYLFHQHHGV7KLVDFWLRQGRHVKDYHDQLPSDFWVLQFHWKHODUJHUN9$WUDQVIRUPHU XVXDOO\LVDWDKLJKHUFRVWUHGXFHVWKHLQYHQWRU\OHYHORIDSLHFHRIHTXLSPHQWWKDWFRXOGEH XVHGHOVHZKHUHKDVDJUHDWHUDPRXQWRIHOHFWULFDOORVVHVDQGLVDQXQGHUXWLOL]DWLRQIRULWV FDSDFLW\%XWWKLVSURYLGHVVHUYLFHWRWKHFXVWRPHU • 8SRQSURMHFWUHOHDVH'0(3URMHFW3ODQQLQJFRQWLQXDOO\UHYLHZVDFWXDODQGDQWLFLSDWHGVWRFN OHYHOVRIPDWHULDOVDQGLQIRUPV&R':DUHKRXVHTXDQWLW\RIPDWHULDOVWKDWZLOOEHQHHGHGIRU SURMHFWV • '0(¶V6WDQGDUGVDQG3URMHFW3ODQQLQJVWDIIUHVHDUFKDQGDSSURYHDOWHUQDWLYHVXSSOLHUVIRU PDWHULDOVZKHQFRQWUDFWHGVXSSOLHUVFDQQRWVXSSO\GHPDQG • '0(¶VFXUUHQWWUDQVIRUPHUFRQWUDFWZDVDSSURYHGIRUDQDPHQGPHQWRIZKLFKKDV DOUHDG\EHHQH[SHQGHG'0(LVSUHSDULQJDQHZFRQWUDFWIRU&RXQFLODSSURYDOLQWKH DPRXQWRI0 • '0(KDVIXOO\H[SHQGHGWKHDSSURYHGVSHQGRIDQH[LVWLQJ&R':DUHKRXVH¶V/&5$ FRQWUDFWDSSURYHGE\&RXQFLOLQ0D\'0(JDLQHGDSSURYDOIRUDQHZ&R' :DUHKRXVH/&5$FRQWUDFWLQWKHDPRXQWRI0 • '0(¶V3URMHFW3ODQQLQJSURDFWLYHO\UHDFKRXWWRWKHYHQGRUVWRWU\WRJHWGHOLYHULHV H[SHGLWHG • '0(LVORRNLQJLQWRZD\VWRH[SHGLWHSURFHVVHVWRDOORZIRUDUHGXFHGSXUFKDVLQJSURFHVV WLPHOLQH • '0(LVSUHSDULQJD'HOHJDWLRQRI$XWKRULW\RUGLQDQFHWRH[SHGLWHSXUFKDVLQJSURFHVVHV • '0(LVORRNLQJLQWRWKHSRVVLELOLW\WRSXUFKDVHXVHGRUUHEXLOWWUDQVIRUPHUV Conclusion '0(VXUYH\HGRWKHUFLWLHVWRXQGHUVWDQGZKDWDSSURDFKWKH\DUHWDNLQJUHJDUGLQJPDWHULDO VKRUWDJHVDQGOHDGWLPHV7KHILQGLQJVDUHDVIROORZV *DUODQG3RZHU /LJKW*DUODQG • ([SHULHQFLQJVKRUWDJHVRQWUDQVIRUPHUVDQGORDGEUHDNHOERZV • +DYHQRWLILHG&LW\&RXQFLODQGKDOWHGDOOQHZFRQVWUXFWLRQZLWKLQWKHSDVWPRQWK &366DQ$QWRQLR • 'HYHORSHUVLQVWDOOFLYLOZRUNWRWKHSRLQWZKHUHWUDQVIRUPHUSDGVDUHLQVWDOOHG&36ZLOO SODFHWKHSURMHFWRQKROGDWWKDWWLPH • 3URMHFWSULRULWL]DWLRQLVPDGHRQZKHQWKHGHYHORSHULVUHDG\DQGKRZORQJWKH\KDYH EHHQZDLWLQJRQWUDQVIRUPHUV • +DVQRWLILHGGHYHORSHUVWKURXJKWKHLUZHEVLWHSRUWDOV\VWHPRIPDWHULDOVKRUWDJHVDQG LQFUHDVHGOHDGWLPHV 23 2FWREHU5HSRUW1R 7 • 6HQWDQ(PDLOEODVWWRDOOFXUUHQWGHYHORSHUVDERXWVKRUWDJHLVVXHV %U\DQ7H[DV8WLOLWLHV%U\DQ • $IWHUFLYLOZRUNLQVWDOOHGGHYHORSHUVDUHWROGXSIURQWLWPD\EHZHHNVEHIRUH HTXLSPHQWFDQEHLQVWDOOHG • 3URMHFWVPDWHULDOQHHGVDQGRUGHULQJPRQWKVLQDGYDQFH • 8WLOL]LQJIHHGWKURXJKFDELQHWVZKHUHWUDQVIRUPHUVDUHQRWQHHGHGLPPHGLDWHO\ • ,QYHVWLJDWHGXVHRIUHEXLOWWUDQVIRUPHUV $XVWLQ(QHUJ\ • +DVQRWIRUPDOO\VWRSSHGFRQVWUXFWLRQEXWLVH[SHULHQFLQJGHOD\VIRUPDQ\RIWKHLU FRQVWUXFWLRQPDWHULDOV • /RRNLQJIRUDOWHUQDWLYHVXSSOLHUV '0(GRHVDQGKDVGRQHPDQ\RIWKHVDPHWDFWLFVXVHGE\WKHRWKHUXWLOLWLHV6XSSO\DQGOHDG WLPHVDUHDQLVVXHDIIHFWLQJWKHHQWLUHHOHFWULFXWLOLW\LQGXVWU\'0(¶VDELOLW\WRPHHW GHYHORSPHQWGHPDQGLVOLNHO\WREHJLQWREHLPSDFWHGE\-DQXDU\7KHVXSSO\FKDLQ LVVXHVKDYHFUHDWHGWKHFXUUHQWPDWHULDOVKRUWDJHLVVXHVEHLQJH[SHULHQFHG,QUHYLHZLQJWKH FLUFXPVWDQFHV'0(KDVFRQFOXGHGWKDWWKHVHH[WHUQDOLWLHVFRXOGQRWEHFRQWUROOHGE\&R' :DUHKRXVHRU'0(VWDII'0(EHOLHYHVLWLVDUHVSRQVLEOHDFWLRQWREHSURDFWLYHZLWKWKH GHYHORSPHQWFRPPXQLW\LQ'HQWRQDQGSURYLGHWKHPDSURDFWLYHQRWLFHRISRWHQWLDOVHUYLFH GHOD\V7KHSURSRVHGODQJXDJHIRUWKLVQRWLFHLVIROORZV "Notice to Developers: As a result of nation-wide supply chain issues, Denton Municipal Electric (DME) is experiencing extended lead times, up to two years in some cases, on various electrical equipment. As such, DME is prioritizing it’s on-hand inventory for new development on a first come, first serve basis. DME is committed to working diligently with developers to understand development timelines and will do everything that is commercially reasonable to provide electrical equipment to support those schedules. DME will endeavor to keep you informed of expected delivery dates and our ability to construct and energize your project." STAFF CONTACT:-HUU\)LHOGHU3((QJLQHHULQJ'LYLVLRQ0DQDJHU  REQUESTOR: 6WDII,QLWLDWHG'0(  STAFF TIME TO COMPLETE REPORT:7RWDOVWDIIDQGFRQWUDFWRUWLPHRQWKLVSURMHFW H[FHHGVKRXUV 24 2FWREHU5HSRUW1R 8 APPENDIX (DFKIRFXVHGLWHPGLVFXVVLRQLQFOXGHVDFKDUWZKLFKVKRZVWKDWPDWHULDOLWHP¶VTXDQWLW\QHHGV IRUDFWLYHDQGSURMHFWVLQGHVLJQIRUWKLVDQGWKHIXWXUHILVFDO\HDU RUDQJH DORQJZLWKWKH FRUUHVSRQGLQJGHFOLQHLQTXDQWLWLHVEDVHGRQSURMHFWQHHGVDVVXPLQJDOORIWKHTXDQWLWLHV FXUUHQWO\RQSXUFKDVHRUGHUVDUHDFWXDOO\LQVWRFNDQGDYDLODEOH±ZKLFKLVQRWWKHFDVH7KH UHDOLW\LVHYHQWKRXJKVXIILFLHQWTXDQWLWLHVDUHRQRUGHUWKHFXUUHQWOHDGWLPHRUTXDQWLW\ UHVWULFWLRQVE\WKHVXSSOLHURUYHQGRUZLOOEHFRPHSUREOHPDWLFLQDVVXUDQFHDGHTXDWHVXSSOLHVIRU DWLPHO\GHYHORSPHQWVHUYLFHGHOLYHU\ 50 KVA Transformers 2QHRIWKHPRVWLPSRUWDQWLWHPVIRU'0(DUHWUDQVIRUPHUVERWKSDGPRXQWHG XVHGLQ VXEGLYLVLRQGHYHORSPHQWV DQGSROHPRXQWHG0RVWN9$RYHUKHDGWUDQVIRUPHUVDUHXVHGE\ '0(FRQWUDFWRUVZKRDUHZRUNLQJRQSULRULW\SROHUHSODFHPHQWSURMHFWV'0(XVHVVLQJOHSKDVH WUDQVIRUPHUVLQRYHUKHDGDQGXQGHUJURXQGFRQILJXUDWLRQVWRSURYLGHHOHFWULFVHUYLFHWRFXVWRPHUV 7KHWUDQVIRUPHUVRUGHUHGDQGXVHGE\'0(DUHSXUFKDVHGZLWKYDULHGHOHFWULFDOGHPDQGVDQG VHFRQGDU\YROWDJHVDVRXWOLQHGLQ'0(¶VTariffsDQGElectric Service Standards This image is taken of the racks used by DME to store its single-phase, pad-mounted transformers. This rack is normally full but, as can be seen, the number of transformers is noticeably down. This image is taken of the area where 50 kVA, single-phase, pole-mounted transformers are stored. There are only seven (7) currently in stock. The space to the left of the transformers is normally full – now it has grass growing in it. 25 2FWREHU5HSRUW1R 9 Chart 1 - 50 KVA Pad-Mounted Transformers /HDGWLPHVEHWZHHQRUGHULQJDQGUHFHLYLQJSKDVHSDGPRXQWHGWUDQVIRUPHUVKDVLQFUHDVHG IURPDSSUR[LPDWHO\ZHHNVWRZKDWZLOOEHLQWKHQHZFRQWUDFWZHHNVIRUWKH+RZDUG WUDQVIRUPHUVZKLFKDUHQRUPDOO\SXUFKDVHGE\'0('0(KDVORRNHGDWXVLQJRWKHUYHQGRUV DQGXQGHUVWDQGWUDQVIRUPHUGHOLYHU\WLPHVIRU$%%LVZHHNVDQGIRU(DWRQ&RRSHULVDW \HDUV7KLVLVEDVHGRQLQIRUPDWLRQ'0(UHFHLYHGIURP7HFKOLQH±RXUFXUUHQWFRQWUDFWHG VXSSOLHU /HDGWLPHIRUN9$SKDVHSDGPRXQWHGWUDQVIRUPHUVLVZHHNV&XUUHQWO\'0( /RJLVWLFVKDVWKUHH  LQVWRFNFRPSDUHGWRWKHWZRKXQGUHGILIWHHQ  QHHGHGDVPLQLPXP DQGFRPPLWWHGVWRFNSURYLGLQJDWZRKXQGUHGWZHOYH  GHILFLW7KHUHDUHWKUHHKXQGUHG VL[W\ILYH  RQRUGHUZLWKDSURMHFWHGVL[W\  ZHHNOHDGWLPH &RPPHUFLDOGHYHORSPHQWVW\SLFDOO\XVHSKDVHWUDQVIRUPHUV'XHWRWKHTXDQWLW\FXUUHQWO\LQ VWRFN'0(LVQRWH[SHULHQFLQJWRRPXFKRIDQLVVXHZLWKVHUYLFHWRFRPPHUFLDOFXVWRPHUV +RZHYHUWKHOHDGWLPHVIRUSKDVHKDVLQFUHDVHGIURPZHHNVWRZHHNV7KHRQHSKDVH WUDQVIRUPHUZHDUHSUHOLPLQDU\SUHGLFWLQJPD\EHDQLVVXHLVWKHIXWXUHLVN9$ YROWV 26 2FWREHU5HSRUW1R 10 Pedestals Chart 2 - Pedestals 3HGHVWDOVSURYLGHDFRQQHFWLRQSRLQWIRU VHFRQGDU\DQGVHUYLFHFRQGXFWRUVWRGLVWULEXWH HOHFWULFLW\WRDODUJHUQXPEHURIFXVWRPHUV 7KHVHLWHPVSURYLGHIRUHIILFLHQWXWLOL]DWLRQRI SDGPRXQWHGWUDQVIRUPHUVHUYLFHFDSDFLW\ N9$ E\DOORZLQJPXOWLSOHXVHUVRQRQH WUDQVIRUPHU /HDGWLPHIRUSHGHVWDOVLVVL[  PRQWKV &XUUHQWO\WKH&LW\RI'HQWRQ:DUHKRXVHKDV RQHKXQGUHGWZHQW\RQH  SHGHVWDOVLQ VWRFNFRPSDUHGWRWKHVL[KXQGUHGILIWHHQ  QHHGHGDVPLQLPXPDQGFRPPLWWHGVWRFN SURYLGLQJDIRXUKXQGUHGQLQHW\IRXU  GHILFLW7KHUHDUHHLJKWKXQGUHGWZHQW\VL[  RQ RUGHUZLWKDSURMHFWHGVL[  PRQWKOHDGWLPH 27 2FWREHU5HSRUW1R 11 Residential Street Light Poles Chart 3 - Residential Streetlight Poles 7KHVWDQGDUGSROHLQVWDOODWLRQIRUDUHVLGHQWLDOVXEGLYLVLRQLVWKHDJJUHJDWHSRVWWRS IL[WXUH'HYHORSHUVFDQFKRRVHEHWZHHQWKLVIL[WXUHRU'0(¶VZRRGSROHVZLWK FREUDKHDG'XHWRDHVWKHWLFVWKHUHVLGHQWLDOVWUHHWOLJKWRSWLRQE\IDUIDYRUVWKHSRVW WRS /HDGWLPHVIRUDJJUHJDWHSROHVKDVLQFUHDVHGIURPZHHNVWRZHHNV &XUUHQWO\'0(KDV]HUR  IRRWDJJUHJDWHSROHVLQVWRFNFRPSDUHGWRWKHRQH KXQGUHGQLQHW\ILYH  QHHGHGDVPLQLPXPDQGFRPPLWWHGVWRFNSURYLGLQJD XQLWGHILFLW7KHUHDUHIRXUKXQGUHG  RQRUGHUZLWKWKHSURMHFWHGZHHN OHDGWLPH7KH&LW\RI'HQWRQUHTXLUHVGHYHORSHUVWRKDYHVWUHHWOLJKWVLQVWDOOHGDQG HQHUJL]HGEHIRUHSURYLGLQJDSSURYDOWREXLOGKRXVHV,IWKH&LW\LVFRQFHUQHGZLWK WKLVWKH\PD\FRQVLGHUDWHPSRUDU\OLIWLQJRIWKLVUHTXLUHPHQWIRUGHYHORSPHQWV  28 2FWREHU5HSRUW1R 12 (YHQWKRXJKWKLVGRFXPHQWKDVIRFXVHGRQIRXU  LWHPVOHDGWLPHVIRURWKHUFULWLFDOPDWHULDOV XVHGE\'0(KDYHDOVRVHHQOHDGWLPHH[SDQVLRQ7DEOHSURYLGHVOHDGWLPHVIRUVHYHUDORIWKH LWHPVXVHGLQWKLVGRFXPHQWDQGRWKHULWHPV:LWKWKHLQFUHDVHGVXSSO\FKDLQLVVXHVOHDGWLPHV EHWZHHQRUGHUDQGGHOLYHU\RIPDWHULDOVKDVFKDQJHG LQFUHDVHG VHYHUDOWLPHVIRUPDWHULDOV Table 3 – Lead Time Changes Material Original Lead Time New Lead Time 1-phase pad-mounted transformers 16 weeks 60 weeks 3-phase pad-mounted transformers 16 weeks 40 weeks 20’ residential streetlight poles 16 weeks 52 weeks Electrical components (switchgears, automated equip) 14-16 weeks 20 plus weeks Poles (wood) 4-12 weeks 26-52 weeks Pull boxes (heavy & light duty) 12 weeks 12-14 weeks  7KH8QLWHG6WDWHVLVH[SHULHQFLQJXQSUHFHGHQWHGOHYHOVRILQIODWLRQ7KLVFHUWDLQO\LQIOXHQFHVWKH FRVWVVHHQE\'0(6XSSO\FKDLQLVVXHVDUHJRLQJWRKDYHDILQDQFLDOLPSDFWRQ'0(¶VFDSLWDO EXGJHWZKLFKEOHQGVLQWRLWVFRVWRIVHUYLFH$UHFHQWSULFHUHTXHVWWKURXJKWKH/&5$ ZDUHKRXVHFRQWUDFWSURYLGHGVWDUNLQGLFDWLRQPDWHULDOFRVWVDUHULVLQJUDSLGO\7DEOHLVWKH TXRWHIRUWKH/&5$SULFLQJVKRZLQJWKHLQFUHDVHIRUPDQ\RIWKHSKDVHSDGPRXQWHG WUDQVIRUPHUVXVHGE\'0( Table 4 - Price Increase for Pad-Mounted Transformers Item Percent Increase 50 kVA, 240/120 V 251% 75 kVA, 240/120 V 278% 100 kVA, 240/120 V 267% 167 kVA, 240/120 V 272% ,WHPVLGHQWLILHGDVHOHFWULFDOFRPSRQHQWVKDVDOVRVHHQDSULFHLQFUHDVHLQWKHUDQJHRI EHWZHHQDQG-XO\RI ,QFUHDVHLQFRVWIRUPDWHULDOVZLOOFRQWLQXHWRLQFUHDVHWKHVWUHVVRQDQDOUHDG\VWUHVVHGFDSLWDO EXGJHW 29 2FWREHU5HSRUW1R INFORMAL STAFF REPORT TO MAYOR AND CITY COUNCIL SUBJECT: 9LOODVRI3LQH\&UHHN+2$,QIUDVWUXFWXUH  BACKGROUND:  7KH9LOODVRI3LQH\&UHHN+2$,QFDVXEGLYLVLRQZKLFKLQFOXGHVVLQJOHIDPLO\GZHOOLQJV RQHRSHQVSDFHORWDQGSULYDWHVWUHHWVUHFHQWO\KHOGD6SHFLDO0HHWLQJWRGLVFXVVWKHIXWXUHRI WKH+RPHRZQHU¶V$VVRFLDWLRQ +2$ $GGLWLRQDOO\DQHLJKERUKRRGUHSUHVHQWDWLYHVSRNHRQWKLV PDWWHUDWWKH2FWREHU&LW\&RXQFLOPHHWLQJ7KHVXEGLYLVLRQVKRZQRXWOLQHGLQEOXH DERYHLV]RQHG5HVLGHQWLDO 5 DQGORFDWHGQRUWKZHVWRI6DQ-DFLQWR%RXOHYDUGDWWKHWHUPLQXV RI3LQH\&UHHN%RXOHYDUG $FFRUGLQJWRQHLJKERUKRRGUHSUHVHQWDWLYHVSDUWLFLSDWLRQLQWKH+2$KDVZDQHGDQGWKHOLPLWHG QXPEHURIGZHOOLQJVSUHYHQWVWKHFROOHFWLRQRIVXIILFLHQWIXQGVWRPDLQWDLQWKHSULYDWHVWUHHWV &XUUHQWO\\HDUO\GXHV SHU\HDU SD\WKHXWLOLW\ELOOVDQGDVHUYLFHWRPRZWKHUHVLGHQWLDO IURQWODZQVDQGWKHRSHQVSDFHORWORFDWHGRQWKHZHVWVLGHRIWKHVXEGLYLVLRQ)RUWKHVHUHDVRQV WKH+2$ZRXOGOLNHWRGLVVROYHDQGKDVUHTXHVWHGWKDWWKH&LW\WDNHRYHUWKHRZQHUVKLSDQG PDLQWHQDQFHRIWKHSULYDWHVWUHHWVSULYDWHO\KHOGGUDLQDJHLPSURYHPHQWVDQGRSHQVSDFHORW,WLV LPSRUWDQWWRQRWHWKDWWKH'HQWRQ'HYHORSPHQW&RGHGRHVQRWUHTXLUHWKH&LW\WRWDNHRYHUVWUHHW RZQHUVKLS$GGLWLRQDOO\DFFRUGLQJWR$SSUDLVDO'LVWULFWUHFRUGVWKHRSHQVSDFHORWLVSULYDWHO\ RZQHG7KH&LW\ZRXOGQRWDVVXPHPDLQWHQDQFHUHVSRQVLELOLW\RIDSULYDWHO\KHOGORWRXWVLGHRI WDNLQJSURSHUW\PDLQWHQDQFHDFWLRQGXHWRQHHGLQJWRDEDWHDQXLVDQFH 30 2FWREHU5HSRUW1R 7KHIROORZLQJLVLQIRUPDWLRQUHODWHGWRWKHKLVWRU\RIWKHVXEGLYLVLRQWKHSULYDWHLQIUDVWUXFWXUH DQGWKH'HQWRQ'HYHORSPHQW&RGHSURFHVVUHODWHGWR+2$GLVVROXWLRQ,WLVEHLQJSUHVHQWHGWR IDFLOLWDWH&RXQFLO¶VXQGHUVWDQGLQJRIWKH9LOODVRI3LQH\&UHHN¶VUHTXHVWVRWKDW&RXQFLOFDQJLYH 6WDIIGLUHFWLRQRQWKLVPDWWHULQDIXWXUHPHHWLQJ Zoning and Subdivision History • 7KH9LOODVRI3LQH\&UHHN3KDVHZDVGHYHORSHGDVD3ODQQHG'HYHORSPHQW 3' DQGWKH GHWDLOHGSODQZDVDSSURYHGLQ 2UGLQDQFHDWWDFKHG 7KHRUGLQDQFHLQFOXGHVD VLWHSODQDQGDQLQGHPQLILFDWLRQIRUWKHSULYDWHLPSURYHPHQWVLQFOXGLQJWKHSULYDWHVWUHHWV • 7KH)LQDO3ODWZDVDSSURYHGE\WKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQRQ2FWREHU 9LOODVRI3LQH\&UHHN3KDVH,6WDII5HSRUW)3DQG0LQXWHVBBDWWDFKHG  H[HFXWHGE\WKHRZQHURQ6HSWHPEHUDQGILOHGRIUHFRUGRQ2FWREHU o 7KH)LQDO3ODWUHIOHFWVUHVLGHQWLDOORWVDDFUHRSHQVSDFHORWDQGDSULYDWHO\ RZQHGDQGPDLQWDLQHGVWUHHWORW /RW%ORFN' ZKLFKUDQJHVLQZLGWKIURPIHHW EDFNRIFXUEWREDFNRIFXUE ZLWKPRXQWDEOHFXUEDQGJXWWHUWRIHHW EDFNRIFXUE WREDFNRIFXUE 7KHVHGRQRWPHHWWKHPLQLPXPZLGWKVWDQGDUGV DVVKRZQLQ7DEOH EHORZ   o 1HVWHGLQVLGHWKHSULYDWHVWUHHWORWDQGH[WHQGLQJLQWRWKHIURQW\DUGRIWKHUHVLGHQWLDO ORWVLVDYDULDEOHZLGWK3XEOLF8WLOLW\3ULYDWH$FFHVVDQG3ULYDWH'UDLQDJH(DVHPHQW 7KLVHDVHPHQWFRQWDLQVDSULYDWHGUDLQDJHV\VWHPDQGSXEOLFZDWHUZDVWHZDWHU o 7KH+2$&RYHQDQWVDQG5HVWULFWLRQVZHUHDSSURYHGE\WKH3ODQQLQJDQG=RQLQJ &RPPLVVLRQFRQFXUUHQWZLWKWKH)LQDO3ODWDQGILOHGRIUHFRUGLQ DWWDFKHG  • 7KH'HQWRQ'HYHORSPHQW&RGH ''& UHPRYHG3ODQQHG'HYHORSPHQWVIURPWKH]RQLQJ ³WRROER[´VRWKHSURSHUW\ZDVUH]RQHGIURP3'WR1HLJKERUKRRG5HVLGHQWLDO 15  'LVWULFWZLWKWKH&LW\ZLGHUH]RQLQJDQGFRGHDGRSWLRQ • :LWKWKHLPSOHPHQWDWLRQRIWKH''&WKH]RQLQJWUDQVLWLRQHGWR5ZKLFKUHPDLQVLQ HIIHFWWRGD\ 31 2FWREHU5HSRUW1R DISCUSSION:  %HIRUH&LW\VWDIIFRXOGHQGRUVHDFFHSWDQFHRIH[LVWLQJSULYDWHLQIUDVWUXFWXUH VWUHHWVGUDLQDJH OLJKWLQJ DIXOO&RQGLWLRQV$VVHVVPHQWPXVWEHFRPSOHWHG Street Dedication ,I&RXQFLOLQVWUXFWV 6WDIIWRDFFHSW WKH+2$¶VSULYDWHVWUHHWV 6WDIIZLOO FRPSOHWHQHFHVVDU\UHVHDUFKWRLGHQWLI\WKHPRVWDSSURSULDWHSURFHVVIRUWKHGHGLFDWLRQRIWKH H[LVWLQJSULYDWHVWUHHWVDQGSULYDWHO\KHOGGUDLQDJHLPSURYHPHQWVWRWKHSXEOLF Dissolution of the HOA3HU''&6HFWLRQ-WKH+2$FDQQRWEHGLVVROYHGZLWKRXWWKH &LW\¶VFRQVHQW³7KH+RPHRZQHUV$VVRFLDWLRQPD\QRWEHGLVVROYHGQRUPD\GHHGUHVWULFWLRQV DQGFRYHQDQWVSURYLGLQJIRUPDLQWHQDQFHRIFRPPRQDUHDVEHGHOHWHGRUDPHQGHGZLWKRXWWKH SULRUZULWWHQFRQVHQWRIWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQE\ZD\RIDSODWDPHQGPHQW´$ SODWWRDPHQGRUGLVVROYHWKH+2$ZRXOGUHTXLUHWKHVLJQDWXUHVRIDOOSURSHUW\RZQHUVZLWKLQWKH SODWWHGVXEGLYLVLRQERXQGDULHV,WVKRXOGDOVREHQRWHGWKDWWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQ FRXOGQRWDSSURYHDSODWDPHQGPHQWWRIDFLOLWDWHWKH+2$GLVVROXWLRQZLWKRXWWKH+2$ILUVW GLVSRVLQJRIWKHSULYDWHVWUHHWVDQGGUDLQDJHLPSURYHPHQWVDVGLVFXVVHGLQWKHEXOOHWSRLQWDERYH Other Platting Information related to the Villas of Piney Creek 'XULQJ WKH 2FWREHU &LW\ &RXQFLO PHHWLQJ D PHPEHU RI WKH +2$ KLJKOLJKWHG D GLVFUHSDQF\LQWKHGDWHRQWKHUHFRUGHG)LQDO3ODW6WDIIKDVUHYLHZHGWKHGRFXPHQWDQGKDV GHWHUPLQHGWKDWWKH)LQDO3ODW¶V&HUWLILFDWHRI$SSURYDOHUURQHRXVO\VKRZHGKRZHYHULWZDV FRUUHFWHGWRDQGDOWKRXJKWKHPLVWDNHLVXQIRUWXQDWHLWLVDVFULYHQHU¶VHUURUWKDWLVQRWIDWDO WRWKHHIIHFWLYHQHVVRIWKHSODWWKHUHIRUHWKHSODWLVYDOLG Other HOA’s which Maintain Private Streets )XUWKHULQIRUPDWLRQZDVUHTXHVWHGDVWRKRZPDQ\+2$¶VLQ'HQWRQRZQDQGPDLQWDLQSULYDWH VWUHHWV6WDQGDUGVDQGSURFHVVHVUHODWHGWRJDWHGUHVLGHQWLDOFRPPXQLWLHVDQGSULYDWHVWUHHWVZHUH DGGHGWRWKH&LW\¶VVXEGLYLVLRQUHJXODWLRQVLQDQGZHUHFDUULHGIRUZDUGLQWKH''& 7KHIROORZLQJVXEGLYLVLRQVKDYH+2$¶VZKLFKPDLQWDLQSULYDWHVWUHHWVDQGZHUHHVWDEOLVKHGE\ HLWKHU3ODQQHG'HYHORSPHQWRUWKHJDWHGFRPPXQLW\VXEGLYLVLRQUHJXODWLRQV • 5REVRQ5DQFK • 7XVFDQ+LOOV • (OOLVRQ3DUN • 9LOODVRI3LQH\&UHHN • &DUPHO9LOODV XQGHUFRQVWUXFWLRQ  • 7KH2DNVRI7RZQVKLS XQGHUFRQVWUXFWLRQ  • 9LQWDJH7RZQKRPHV XQGHUFRQVWUXFWLRQ   ATTACHMENTS:  2UGLQDQFH  9LOODVRI3LQH\&UHHN3KDVH,  6WDII5HSRUW)3  0LQXWHVBB 32 2FWREHU5HSRUW1R  9LOODVRI3LQH\&UHHN+2$'HFODUDWLRQV STAFF CONTACT: -XOLH:\DWW 6HQLRU3ODQQHU MXOLHZ\DWW#FLW\RIGHQWRQFRP    REQUESTOR: &RXQFLO0HPEHU9LFNL%\UG STAFF TIME TO COMPLETE REPORT:6WDIIWLPHWRFRPSOHWHZDVDSSUR[LPDWHO\KRXUV PARTICIPATING DEPARTMENTS: 'HYHORSPHQW 6HUYLFHV (QJLQHHULQJ DQG /HJDO SDUWLFLSDWHGLQWKHSUHSDUDWLRQRIWKLVUHSRUW   33 pineycrk.ord ORDINANCE NO. ~ AN ORDINANCE OF THE CITY OF DENTON, TEXAS, APPROVING A DETAILED PLAN FOR PLAiYNED DEVELOPMENT ZONING DISTRICT SIX (PD-6), WITH RESPECT TO 15.413 ACRES OF LAND LOCATED THEREIN, NEAR THE NORTHWEST CORNER OF THE INTERSECTION OF COLORADO BOULEVARD AND SAN JACINTO BOULEVARD; AUTHORIZING THE CITY ATTORNEY AND CITY MANAGER OR THEIR DESIGNATES TO REVIEW AND APPROVE AS TO FORM AND COMPLIANCE RESTRIC- TIVE COVENANTS AND INDEMNIFICATION LA_NGUAGE CONTAINED WITHIN DEEDS AND PROPERTY ASSOCIATION BYLAWS AS PROVIDED IN EXHIBIT C; PROVIDING FOR A PENALTY IN THE MAXIMUM AMOUNT OF $2,000 FOR VIOLATIONS OF THIS ORDINANCE; AND PROVIDING FOR AN EFFECTIVE DATE. WHEREAS, Tipton Engineering has applied for approval of a detailed plan for 15.413 acres of land located within Planned Development District Six (PD-6), near the northwest corner of Colorado Boulevard and San Jacinto Boulevard; and WHEREAS, on July 12, 1995, the Planning and Zoning Commission recommended approval of the requested zoning amendment; and WHEREAS, the City Council finds that the change in zoning will be in compliance with the Denton Development Plan; NOW, THEREFORE, THE COUNCIL OF THE CITY OF DENTON HEREBY ORDAINS: SECTION I. That Ordinance No. 69-35 (PD-6), providing appro- val of a planned development zoning district classification and use designation is hereby amended with respect to 15.413 acres of land located therein, and more particularly described in Exhibit A, attached hereto and incorporated herein by reference, by adopting the detail plan, attached hereto and incorporated herein as Exhibit B for all purposes, in accordance with Division 2 of Article IV of Chapter 35 of the Code of Ordinances. SECTION II. That the City Attorney and City Manager, or their designates, are hereby authorized to review and approve as to form and compliance restrictive covenants and indemnification language contained within deeds and property association bylaws, as provided in Exhibit C. SECTION III. That the provisions of this ordinance as they apply to the 15.413 acres described by Exhibit A govern and control over any conflicting provision of Ordinance No. 69-35 or its amendments, but all the provisions of Ordinance No. 69-35 or its amendments as they apply to that remaining portion of the PD-6 zoning district classification and use designation not herein amended, shall continue in force and effect and shall apply to the remainder of said district. 34 SECTION IV. That a copy of this ordinance shall be attached to Ordinance No. 69-35, showing the amendment herein approved. SECTION V. That any person violating any provision of this ordinance shall, upon conviction, be fined a sum not exceeding 2,000.00. Each day that a provision of this ordinance is violated shall constitute a separate and distinct offense. SECTION VI. That this ordinance shall become effective four- teen (14) days from the date of its passage, and the City Secretary is hereby directed to cause the caption of this ordinance to be published twice in the Denton Record-Chronicle, the official news- paper of the City of Denton, Texas, within ten (10) days of the date of its passage. PASSED ~ND APPROVED this /~ day of ~~ , 1995. ATTEST: BOB CASTLEBERRY,~}~OR~'~.~JENNIFER WALTERS, CITY SECRETARY AP~oVE~As TO LEGAL FORM: HERBERT L. PROUTY, CITY ATTORNEY BY: ~<' .~-'~' i- .-' 35 FIELD NOTES 4141 .fid BEING Lot 56 in Block A of The Oaks of Township II, an Addition to the City of Denton, Denton County, Texas, according to the Plat thereof, recorded in Cabinet E, Page 13, Plat Records, Denton County, Texas, together with Certificate of Correction recorded in Volume 1619, Page 587, and in Volume 1652, Page 130, Real Property Records, Denton County, Texas; BEGINNING at the Northeast comer of the said Lot 56 in Block A of The Oaks of Township II, also a poim on the South ROW line of Colorado Blvd., (a 70' ROW); THENCE, S 62' 40' 39" E, along said Colorado Blvd., a distance of 111.90 feet to a 1/2" iron rod found; THENCE, along a tangent curve to the right having a central angle of 22' 28' 59", a radius of 1222.79 feet, a chord bearing of S 51' 27' 00" E, and an arc distance of 479.83 feet to a 1/2" iron rod found; THENCE, S 40' 11' 40" E, a distance of 160.00 feet to a 1/2" iron rod set; THENCE, S 28' 53' 02" E, a distance of 152.97 feet to a 1/2" iron rod set; THENCE, S 49' 48' 21" W, leaving said Colorado Blvd., a distance of 365.86 feet to a 1/2" iron rod found; THENCE, along a tangent curve to the right, having a central angle of 12' 49' 01", a radius of 660.00 feet, a chord bearing of S 56° 12' 51" W, and an arc distance of 147.64 feet to a 1/2" iron rod found; THENCE, S 62' 37' 20" W, a distance of 764.87 feet to a 1/2" iron fod found; THENCE, along a tangent curve to the right, having a central angle of 25' 48' 35", a radius of 986.95 feet, a chord bearing of S 75' 31' 38" W, and an arc distance of 444.59 feet to a 1/2" iron rod set; THENCE, N 01' 34' 05" W, a distance of 130.00 feet to a 1/2" iron rod found; THENCE, N 01° 18' 07" W, a distance of 60.00 feet to a 1/2" iron rod found; THENCE, N 02' 23' 04" W, a distance of 149.70 feet to a point for comer; THENCE, East a distance of 152.66 feet to a 1/2" iron rod found; THENCE, N 76' 02' 04" E, a distance of 152.77 feet to a 1/2" iron rod found; 36 THENCE, N 62' 37' 21" E, a distance of 764.32 feet to a point for corner; THENCE, N 27' 19' 21' E, a distance of 181.46 feet to a 1/2'~ iron rod found; THENCE, N 44' 08' 44" W, a distance of 146.11 feet to a point for corner; THENCE, N 62' 40' 39" W, a distance of 260.00 feet to a 1/2" iron rod found; THENCE, N 27' 19' 21 '~ E, a distance of 305.00 feet to the PLACE OF BEGINNING and containing 671,390 square feet or 15.413 acres of land. 37 38 ATTACHMENT 3 39 EXHIBIT C As a condition of this planned development zoning classification and subdivision acceptance, Developer shall integrate the following indemnification language into each deed agreement as a negative reciprocal restrictive covenant running with the land, binding upon all heirs and assigns, and filed in the Deed Records of Denton County, Texas, such as to give notice to all subsequent prospective purchasers. Developer shall also integrate this language into the bylaws of the property owners association. The City Attorney, or his or her designate, shall have the opportunity to review and approve all such covenants and by-laws, and no amendments to the following indemnification language shall be permitted except upon review, approval and concurrence of the City Attorney and City Manager, or their designates. INDEMNIFICATION: THE VILLAS OF PINEY CREEK HOMEOWNERS ASSOCIATION, INC., (ASSOCIA- TION) AGREES TO RELEASE, INDEMNIFY, DEFEND AND HOLD HARMLESS THE CITY OF DENTON, ITS OFFICERS, AGENTS, AND EMPLOYEES, AND ANY GOVERNMENTAL ENTITY OR PUBLIC UTILITY COMPANY THAT OWNS PUBLIC IMPROVEMENTS WITHIN THIS SUBDIVISION (INDEMNITEES) FROM ANDAGAINST ANY ANDALL CLAIMS FOR DAMAGES TO PRIVATE STREET, RESTRICTED ACCESS GATES AND ENTRANCE, LANDSCAPING AND RELATED APPURTENANCES (PRIVATE IMPROVEMENTS) OCCASIONED BY THE INDEMNITEES' USE, REPAIR OR MAINTENANCE OF ITS EASEMENTS. THE ASSOCIATION FURTHER AGREES TO RELEASE, INDEMNIFY, DEFEND AND HOLD HARMLESS THE INDEMNITEES FROM AND AGAINST ANY AND ALL CLAIMS FOR DAMAGES TO PROPERTY AND INJURY TO PERSONS (INCLUDING DEATH) THAT ARISE OUT OF THE USE OF THE PRIVATE IMPROVEMENTS BY THE INDEMNITEES. THIS INDEMNIFICATION SHALL APPLY REGARDLESS OF WHETHER A CONTRIBUTING FACTOR TO SUCH DAMAGES OR INJURIES WAS THE NEGLIGENT ACTS OR OMISSIONS OF THE INDEMNITEES OR THEIR RESPECTIVE OFFICERS, EMPLOYEES AND AGENTS. THE ASSOCIATION AND EACH LOT OWNER AGREE TO RELEASE, INDEMNIFY AND DEFEND THE INDEMNITEES FROM CLAIMS FOR DAMAGES TO PROPERTY AND INJURY TO PERSONS (INCLUDING DEATH) THAT ARISE OUT OF ANYDEFECTIVE CONDITION OF THE PRIVATE IMPROVEMENTS, OR THEIR USE BY ANY OTHER PERSON. THE PROPERTY OWNERS ASSOCIATION AND EACH LOT OWNER SHALL INDEMNIFY THE CITY OF DENTON FROM ANY CLAIMS FOR DAMAGES TO PROPERTY AND INJURY TO PERSONS (INCLUDING DEATH) THAT ARISE OUT OF A DELAY OF EMERGENCY VEHICLES CAUSED BY THE RESTRICTED ACCESS. EXHIBIT C/PAGE 140 0 R r s I GRAPHIC SCALE i" = 60' Denotes Zero side of Lot co, ONO!, O DENTON 88 J.V. Imo'/cAP Lot 57. Oaks of Township 11 COMMON GREENBELT AREA A, BLANKET 14 Ha95)• 1 15',r6 0 15 9_ 7UTILITY &DRAINAGE EASEMENT / 7a0pfeE N75'4140E 09, V n E N82'37'20'E 41 N62'37'20'E N82'37'2,"E 66.00' 8300' 2 $ A as ' OPEN SPACE 1 l7 N82 E N82'6.00 The following minimum setbacks apply from the Bock of Curb Adjacent to cul-de-sacs/Streets 20 feet to garage door 15 feet to remainder of structure Setback Detail 32 Exreun9E t. prn9• ESmt. I) g• 09mm. 1 y' _BO ota pot. Exbtin9 27 -' - Y- IR CP-F IRf/CAP ^-- -' - -• N550,63 4 z I z ioo' Ex;at. ptcar aw K e7i.=1 u 23,. ig,1 t4 ny` to 211$ 22 ' % fry 0 il4 m 1 12 Y A•> N82'37'20'E 22-37-20'wr'''9x'Oz'3. 2$ 0 24a 8 N., 7'20'E ' HI ' -1 N12• 81.90' 81.98• a ' 2D ' % h $ ay^0N62'3]'20.E t P Y' g ' dfa. C( ` g247 fn r l AOh $ S62.3 ' 2. ^ 25 g. PP i"1 b o 62.41• ro m w 2.3721"E $p 9 $ A 9 //1N62' 37'20'E gg.00' S6277'20'W `b U o N se g5.00' G g2s2' - a 14 8 $ $ 4sg2.3Tzo^w . a. 1,,,- 1 3 $ m a1 s600' $ m & 26 818 y, 6 1- ly N6$5120'E Y'nG-"'"' n.l 1 '& Ng2'3]'21'E $ iM 5'00' z. 16 I$ I N61'SY20E DENTON 68 J. V. 1 0. 0 ;, •N .t 85.00' $62-3]'20'W , 1 / 8 8 WI ' 80.00' g m g LOT 1 BLOCK D W 7 m 1 y $ g5,00' 1 a V X,982"1 z $ GREENBELT AREA 2 1 3 ® I$ i 8 ' a 81 Ym 1. 173 AC 1 EolaG Ut6ilY Eaa t. N NI 4 I 7'x0'E 6 65.00 w A $ I h 27 $ TOWNSHIP 11 PHASE 2 IRS ' ` ' 1 .7 t De Abandon d N89'26'OI E 1 - I g t'n7 g SA1 N82 q/ 5, VOL11PG14P.R. /CAP '-- _$ _ tD mI by$56 . 4y.60' l0! -J l7S 1 N62'3721E S]20•w 1 Ik O /1 17 Q y.-'•BS.00r- a a6.00' s6x aQI o a 1, o . E, Page 1J) -, /1lL[l LU LLia+ 1 lyu. ' gl 85 00 1$ 16 $11 (j \O $• "65.00T -J 4 ry 97.00' - - 0.0'S A 1/• \ Y/.t A_'-- m e m ;8 Tay 6 o g `s. ' '&'' yy $ 'd 6 1 s].so• 37. 4 > n R S 1 41 n o. A1.24• Ba.00 4i°--, .' • xe J3.OB' - 97. 00'--562-3Y20"5' a ye 126.Jo' xsso'o-ro_°'ems nyont n 550.76' u ` U 30 y 1 5&80 .W NB 2536' C3 - a - CSe=. IRP AP S39g• c"1I 1 Sg2'JT2o - 03f- `$ " 562"37'20W ate THE OAKS OF TOWNSHIP If CAB. E PAGE 13 26 1 EyteUn9emt . utal Exi. lol ilea etin916 16 -\ UUEE6' elerer sid s' 162' 37'21 - -' 60. 00' J 122. Y d 11 IQR a $ A0. 0' roI 1l ao II ! 1-,b 4 R5/ CAP IRS/ CM _ • _ o c` e - C- 4 C•Y'156t96` 16' VE tcoE. E. Pa9° 1 "' _ L- 52' PUb11t iPflVatsf ry GOLDEN TRIANGLE JOINT VENTURE o`' s - Access a Epgement mg.) VOL 986 PAGE 937 1/ 2. IRr 1' 1ace Z TRAMMEL CROW CO. #91 Of Be rnnlh TOWNSHIP 1 E ND. INSTALLMENT 220 A - 25.47lLEGEND p t- R = 986. 95< 1 I l N• lC T = 225.93' 1` IRF =IRON ROD FOUND L ® 4442o. 1, C1 C7 1RS/CAP - IRON ROD SET W/CAP 47'I // 1 1 Ij 1 U.E. =UTILITY EASEMENT F. D. !. C. CD BRG4= 575'45'23"W I'l 7 `w" ` x++ ( I/ D.E. = DRAINAGE EASEEMENT Lot 6A, Block A Q d 5`V A't Y" R.L. = BUILDING LINE C U R V E D A T A TOWNSHIP Block 301 1 PHASE r! GUR1F RADIUS DELTA 7ANr. I WN 9 ARINO C-1 11&50' 240Y0a' 21.67' 4&6Y 4&26' S85.4Y20'W C-2 C-J100.00' IMM 1e5Yyy9' 185T4Y 1&70' 1&]0' J&09' J&08' 3294' J294' SSJroB'JS'W N71ro6'11E C-4 C-588&45' I1&50- OJ24'JB' 189Y43• 1&78' 19.29' S7.55' JA1Y 57.34• J&05' 589R9'f9'W SMro641'WC-6 MOO e1R5j4' J&i2' 1Ze 4&e6' 00421 W C-7 C-e2.5 2aoo' 71roW1' 71 it14.28' 1L28'' 2A80' 2480' 2&24' 23.14' SOBroB'35'W N62,83'49•W 0- fr10 f00.00' 64Ag5 f8E7'4Y OJ24'S8' 1&70• 2&32' 33.08' S8.63' 3284' S&6YS72ro8'II•W 58828'f8]V 0-11 C-1210.00' 2Q00' 90YJ0'00 90V0;00' Z0.00' 20.00' Jf.41' 31.a2' 2a26' Zan' N72R'40 W S1737P0'W 0-3 C-1420.00' Moo' 90ro000' 90ro0'oo' 20.00' 2aW J1.4Y 3I.422&2e' 2a29' N]2224; S17'3C-13 20.00' 89Z8'3IY 20.07 J1.42' 1d2e' f0•W S727239'EC-15 117 T0.00' 20a0' 90ro0'01' B374'3!' 20.00' 17.T/' 31.42' Z9.08', 2&18' 2&57' NiT37'2ft SB5713a 180-19 40.00' 20.00' 2592¢IQ S3ro748 4&15' 10.00' f81.fP i&55 11.14: 17.e9 N2134157Ng0'1e'46' W 0-20 20. 00' SJVY48"1&35' 17.89'• 55336;J4'6 0-21 C- 12 20.00' Z0.00' SSro7'48' S3roY48' f0.So1000' 1&55' f&55' 17.B9 17.0 N001846'W SSJ76'34'E C-23 C- 24 f00.04' 50.60 24ro]'00' 81R5;7}' 2f.J8' 43.46• 4209' 1.7Y 41."1 65.89' S55'43 0'W mew2YW C-2580. 00' 81ro948' 3/.J8' Ha.99' 7&OB' S87'gYJ3'E V- R to G5(a- pare- uu. L-Jl/'I 5 5 1 C 5 FINAL PLAT OF VILLAS OF PINEY CREEK PHASE I Being A Replat of A Pert of Lot 56, The Oaks of Township A Cab. E, Pg. 13 Plat Records R.H. Hopkins Survey, Abstract No. 1694 CITY OF DENTON, DENTON COUNTY, TEXAS OWNER - VILLAS OF PINEY CREEK / SOINT VENTURE 1517 Bayberry Court - Denton, Texas 76205 ins On Oct el 1996 At 3:00pe Doc/Nue : 96- ROO69295 Doc/ RecoTrding: yppe 46.00 PLRDoc/11ge4 6, Recei t N: 3077008 s\; epui;y - CABBY I Mike -KERN SURVEYING INC. O X 507 c'`•"''»":.; e'i KRUM, TEXAS 76249 817) 482-6723 a6vls6o axase PAGE I of 2 41 DEDICATION STATE OF TEXAS COUNTY OF DENTON ttA'?5 sts WHEREAS, Villas of Piney Cmek/Joint Venture is the owner of all that certain trap of land situated in the R.H, Hopkins Survey, Abstract Number 1694 in the City of Denton, Denton County, Texas and being a part of Lot 56, The Oaks of Township 11, an addition to the City of Denton, according to the plat thereof recorded in Cabinet E Page 13 of the Plat Records of Denton County, Texas, together with the Certificate of Correction recorded in Volume 1652 Page 130 of the Real Property Records of Denton County, Texas as recognized and occupied on the ground the subject trap being more particularly described as follows; BEGINNING for the Southwest Comer of the trap being described herein at a capped iron rod set for the Southwest Comer of saitl Lot 56: THENCE North 01 Degrees 37 Minutes 18 Seconds West with the Westerly line of said Lot a distance of 130.04 feet to a capped Iron rod set for an angle point in said West line; THENCE North 01 Degrees 12 Minutes 54 Seconds West continuing with said West line a distance of 60.04 feet to a capped iron rod set for the Southeast Comer of Lot 57 said Oaks of Township 11; THENCE North 02 Degrees 49 Minutes 1t3 Seconds West continuing with said West line and the East line of said Lot 57 a distance of 447.71 feet to a capped Iron rod found for the Northwest Comer of said Lot 56 and the Southwest Comer of Lot 14 said Oaks of Township II; THENCE in a general Easterly direction with the North line of saitl Lot 66 and the South line of Lots 14,15,16,26,27 and 32 of said Oaks of Township II, the following 3 courses and distances 1.) South 89 Degrees $7 Minutes 12 Seconds East a distance of 152.76 feet to a 1/2" iron rod found for the Southeast Comer of Bald Lot 14 and the Southwest Comer of said Lot 15; THENCE North 75 Degrees 41 Minutes 40 Seconds East a distance of 153.09 feet to a 112" Iron rod found; THENCE North 62 Degrees 37 Minutes 21 Seconds East a distance of 550.63 feet to a capped iron rod set for the Northeast Comer of the herein described trap in the South line of said Lot 32; THENCE South 27 Degrees 22 Minutes 40 Seconds East severing said Lot 56 a tlistance of 300.46 feet to a capped Iron rod set for the Southeast Comer of the herein described trap in the South line of mid Lot 56: THENCE South 62 Degrees 37 Minutes 20 Seconds West with the South line of saitl Lot 66 a distance of 650,78 feet to a 1/T iron rod found on the West line of Piney Creek Boulevard in a curve to the right, having a radius of 988.95 feet; THENCE along the are of said curve and the South line of said Lot 56 an are distance of 444.21 feet (chord bearing of South 75 Degrees 45 Minutes 23 Seconds West a distance of 440.47 feet) to the PLACE OF BEGINNING and enclosing 6.545 acres of land. NOW THEREFORE, KNOW ALL MEN BY THESE PRESENTS: That Villas of Piney Creek/Joint Venture, does hereby adopt this plat designating the herein described properly as Villas of Piney Creek Phase I, in the City and County of Denton, Texas and do hereby dedicate to the public use forever, the public easements shown hereon. Villas Ofplagy Creek/Joint Venture By: STATE OF TEXAS BEFORE ME, the undersigned Notary Public in and for the State of Texas, on this daypersonallyappearedrr ,known to me to be the person, whose name is subscribed to the foregoing instrument and acknowledge to me that he/she executed the same for the purpose and consideration therein expressed, and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF THE OFFICE THIS.?-J—OAY OF;1996. WPublic in the State of TezaS' My Commission expires 98 LOIN* MELISSA A. ORTIZ NOTARY PUBLICTexas av'. L!H SURVEYOR'S CERTIFICATE KNOW ALL ME BY THESE PRESENTS THAT I MICHAEL J: KERN, Registered Professional Land Surveyor, do hereby certify that this plat was prepared from an actual and accurate survey made on the ground of the land and that the monuments shown hereon were found or placed under my direction and supervision in accordance with the Ordinances of the City of Denton, Texas. Michael J. Kem R.P.L.S. No. 414158 ate CERTIFICATE OF APPROVAL Approved this__/40 day of ( bWthePlanningandZoningCommission for the City of Denton em.L1paDP Chairman C j Secrete FINAL PLAT OF VILLAS OF PINEY CREEK PHASE I Being A Replat of A Part of Lot 56, The Oaks of Township 11, Cab. 6, Pg. 13 Plat Records R. H. Hopkins Survey, Abstract No. 1694 CITY OF DENTON, DENTON COUNTY, TEXAS OWNER — VILLAS OF PINEY CREEK / JOINT VENTURE 1517 Boyberry Court - Denton, Texos 76205 On Oct 01 1996 At 3:00pm Doc/ Nu. 96-R0069295 Record nge 46P00 Doc/ Ngmt : 6.00 Receipt g: 30778 Deputy - CASSY OF filf i01 F°•JrY Y • EMI ••AEE 1. KERN 41580A• KERN SURVEYING INC. 9 yO.'tss N.• ya MaP.O. BOX 507 5UP` 1C KRUM, TEXAS 76249 817) 482-6723 PACE 2 of 2 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 P&Z Minutes October 11, 1995 Page 14 Mr. Cochran: I move approval of the preliminary plat of the Cundall Addition. Ms. Schertz: I'll second. Ms. Russell: Any discussion? All in favor please raise your right hand. Opposed same sign. Approved. (6-0) VI. Villas of Piney Creek. a. Consider the final plat of the Villas of Piney Creek, Phase I. The subject property is located northwest of San Jacinto Boulevard and southwest of Colorado Boulevard in PD-6. Mr. Reeves: This is the final plat. The Commission has previously approved the detail plan. The final plat does not correspond with the detail plan. The applicant will be submitting a revised detail plan that will correspond to this final plat. This will be a minor amendment that Mr. Robbins can approve and then bring to you. DRC recommends Iapproval. Ms. Russell: Are there any questions? Ms. Schertz: I move that we approve the final plat for the Villas of Piney Creek, Phase I. Ms. Flemming: I'll second. Ms. Russell: Any discussion? All in favor of the motion please raise your right hand. Opposed same sign. Approved. (6-0) b. Consider the Homeowners Association Agreement and Restrictive Covenants for the Villas of Piney Creek. Mr. Reeves: You have a copy of the Homeowners Association Agreement and Restrictive Covenants. They wrote everything that Jerry told them to write. DRC recommends approval. Mr. Drake: Whenever we have private streets we look at them to make sure that the city does not have any liability. Mr. Reeves: We also want to make sure that there is some sort of ineans to maintain the 78 P&Z Minutes- October 11, 1995 Page 15 streets and that the city won't be asked to do repairs on them at a later date. Mr. Ed Bright: My name is Fd Bright. This is my first tune to do a development with private streets. The concept is to build these streets to city standards. Mr. Powell: Will these streets be the same width as if they were public streets? Mr. Reeves: There is a difference in width. Mr. Salmon: They are proposing to build their private streets twenty-four feet wide and city streets are thirty-one feet wide. Their streets will be the same thickness as what the city requires. Mr. Powell: I move that we approve the homeowners association agreement and restrictive covenants for the fmal plat of the Villas of Piney Creek, Phase I. Ms. Schertz: I'll second. Russell: Any discussion? All in favor please raise your right hand. Opposed same sign. Approved. (6-0) VII. Batey Addition. 6.003 acres located immediately north of Blagg Road and east of Mayhill. a. Consider the General Development Plan of about 68 acres owned by G. Wilborn adjacent to the proposed Batey plat. b. Consider a variance to Section 34-114(5) concerning perimeter paving standards. c. Consider a variance to Section 34-114(17) concerning sidewalk standards. d. Consider the preliminary and final plats of Lots 1 and 2, Block A. Mr. Yost: A large part of the Batey addition was purchased from Gene Wilborn. I talked to the applicant late this afternoon and the applicant has requested that we postpone this item until October 25th. Ms. Russell: Do we need to have a motion to postpone this? Mr. Yost: The Batey's are involved in all four items so we would like to postpone all of 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 FY 22/23 Council Requests Number of Pending Requests by Council Member Council Requests 13 Number of Requests Per Quarter Total Requests Made by Council Person Please note the number of requests per council member may add up to a greater total than the total number of council requests as several council members may be associated with a single request 111 ))ULGD\ 5HSRUW  &RXQFLO 5HTXHVWV6XPPDU\\RII5HTXHVW&RXQFLO0HPEHU5HTXHVWRU'DWH5HFHLYHG 6WDII$VVLJQHG 'HSDUWPHQW &RPPHQWV $FWLRQ 6WDWXV,QTXLU\RQXSGDWHUHJDUGLQJ1RUWK7H[DV%OYG6RXWKRI,&RXQFLO0HPEHU'DYLV  %HFN\'LYLQH\ &DSLWDO3URMHFWV(QJLQHHULQJ ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV,QTXLU\RQQH[WVWHSVUHJDUGLQJ%HOO$YHQXHLQFOXGLQJ&RXQFLODSSURYDODQGIXQGLQJ&RXQFLO0HPEHU'DYLV  %HFN\'LYLQH\ &DSLWDO3URMHFWV(QJLQHHULQJ ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV,QTXLU\RQFDQRS\UHWHQWLRQPHWULFVLQ&RPSUHKHQVLYH3ODQ0D\RU3UR7HP%HFN  0LFKDHO*DQJH (QYLURQPHQWDO6HUYLFHV ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV,QTXLU\RQSHUPLWVRUUHTXHVWVUHJDUGLQJGULYHZD\FRQVWUXFWLRQDW5D\]RU5DQFK7RZQ&HQWHU0D\RU+XGVSHWK  6FRWW0F'RQDOG 'HYHORSPHQW6HUYLFHV ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV,QTXLU\RQWKHXVHIXOQHVVDQGRUYDOLGLW\RIWKH7H[DV+RPHRZQHUV$VVLVWDQFH3URJUDPWRWKH&LW\0D\RU3UR7HP%HFN  &DVVH\2JGHQ'DQLHOOH6KDZ/DXUD%HKUHQV&RPPXQLW\6HUYLFHV)LQDQFH ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV5HTXHVWIRUDQXSGDWHRQWKHFOHDQXSRISRZHUFDEOHOLQHVLQ6('HQWRQ&RXQFLO0HPEHU0F*HH  $QWRQLR3XHQWH '0( ,QIRUPDWLRQZLOOEHLQFOXGHGLQDIXWXUH)ULGD\5HSRUW,Q3URJUHVV,QTXLU\RQLQGLYLGXDOVFDPSLQJDW6RXWK/DNHV3DUN &RXQFLO0HPEHU'DYLV PHJDQEDOO#FLW\RIGHQWRQFRP &RPPXQLW\6HUYLFHV5HIHUUHGWR&RPPXQLW\6HUYLFHV+RPHOHVV2XWUHDFK7HDP&RPSOHWH,QTXLU\RQWUDIILFVROXWLRQVGXHWRFRQVWUXFWLRQDW/RQGRQGHUU\DQG6DP%DVV%OYG0D\RU3UR7HP%HFN&RXQFLO0HPEHU'DYLV %HFN\'LYLQH\ &DSLWDO3URMHFWV(QJLQHHULQJ ,QIRUPDWLRQLQFOXGHGLQWKH2FW)ULGD\5HSRUW&RPSOHWH5HTXHVWIRUVWDIIWRFRQWDFWDGHYHORSHUUHJDUGLQJ]RQLQJFKDQJHV&RXQFLO0HPEHU%\UG  6FRWW0F'RQDOG7LQD)LUJHQV 'HYHORSPHQW6HUYLFHV 6WDIIZLOOUHDFKRXWWRGHYHORSHUWRIDFLOLWDWHDGLVFXVVLRQ&RPSOHWH5HTXHVWIRUFODULILFDWLRQRQWHUPLQRORJ\LQFOXGHGLQWKHSDLGSDUHQWDOOHDYHUHVROXWLRQ&RXQFLO0HPEHU0F*HH  6DUDK.XHFKOHU +XPDQ5HVRXUFHV ,QIRUPDWLRQSURYLGHGGLUHFWO\WR&RXQFLO0HPEHU0F*HH&RPSOHWH,QTXLU\RQHQIRUFHPHQWRIVPRNLQJUHVWULFWLRQVZLWKLQIHHWRIUHVWDXUDQWEDUHQWUDQFHV0D\RU3UR7HP%HFN  )UDQN'L[RQ6FRWW0F'RQDOG 'HYHORSPHQW6HUYLFHV3ROLFH ,QIRUPDWLRQLQFOXGHGLQWKH2FW)ULGD\5HSRUW&RPSOHWH,QTXLU\RQWKH9LOODVRI3LQH\&UHHN+2$ &RXQFLO0HPEHU%\UG %HFN\'LYLQH\6FRWW0F'RQDOG7LQD)LUJHQV&DSLWDO3URMHFWV(QJLQHHULQJ'HYHORSPHQW6HUYLFHV,QIRUPDWLRQLQFOXGHGLQWKH2FW)ULGD\5HSRUW&RPSOHWH7ZRPLQXWHSLWFKIRUVWDIIWRFRQVWUXFWDQRUGLQDQFHIRUDFKDUWHUDPHQGPHQWPRYLQJHOHFWLRQVWR1RYHPEHU0D\RU3UR7HP%HFN  -HQQLIHU5DLQH\ &LW\0DQDJHU V2IILFH 7REHVFKHGXOHG7REH6FKHGXOHGPage 1 of 1Exported on October 21, 2022 3:52:25 PM CDT112 Meeting Calendar City of Denton City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com Criteria : Begin Date: 10/1/2022, End Date: 12/31/2022 Date Time Meeting LocationMeeting Body October 2022 10/3/2022 6:00 PM Board of Ethics Council Work Session Room 10/3/2022 6:00 PM Parks, Recreation and Beautification Board Civic Center Community Room 10/5/2022 1:00 PM Civil Service Commission City Hall East Human Resources Training Room 10/6/2022 Community Services Advisory Committee Development Service Center (401 N. Elm Street, Denton, Texas) 10/6/2022 8:00 AM Agenda Committee Council Work Session Room 10/6/2022 8:30 AM Economic Development Partnership Board Development Service Center Training Rooms 10/6/2022 4:00 PM Public Art Committee Civic Center Community Room 10/10/2022 9:00 AM Public Utilities Board Council Work Session Room 10/10/2022 10:00 AM Development Code Review Committee Development Service Center 10/10/2022 5:30 PM Historic Landmark Commission Development Service Center 10/10/2022 5:30 PM Library Board Meeting Room at the South Branch Library, 3228 Teasley Lane, Denton, Texas 10/11/2022 11:30 AM City Council Council Work Session Room 10/12/2022 11:00 AM Economic Development Partnership Board Development Service Center Training Rooms 10/12/2022 1:00 PM Community Partnership Committee City Hall Conference Room 10/12/2022 3:30 PM Airport Advisory Board Airport Terminal Meeting Room 10/12/2022 5:00 PM Planning and Zoning Commission Council Work Session Room & Council Chambers 10/13/2022 3:00 PM Health & Building Standards Commission Development Service Center 10/14/2022 12:00 PM Community Services Advisory Committee Development Service Center (401 N. Elm Street, Denton, Texas) 10/14/2022 1:00 PM Committee on the Environment Sustainability Office 10/17/2022 5:30 PM Traffic Safety Commission Development Service Center Page 1City of Denton Printed on 10/21/2022 113 Date Time Meeting LocationMeeting Body Meeting Calendar continued... 10/18/2022 12:00 PM City Council Development Service Center 10/18/2022 12:00 PM Planning and Zoning Commission Development Service Center 10/18/2022 2:00 PM City Council Council Work Session Room & Council Chambers 10/18/2022 2:00 PM City Council Council Work Session Room & Council Chambers 10/19/2022 3:00 PM Animal Shelter Advisory Committee Council Work Session Room 10/24/2022 9:00 AM Public Utilities Board Council Work Session Room 10/24/2022 10:00 AM Development Code Review Committee Development Service Center 10/24/2022 5:30 PM Internal Audit Advisory Committee City Hall Conference Room 10/25/2022 2:00 PM City Council Council Work Session Room 10/26/2022 10:00 AM Mobility Committee Council Work Session Room 10/26/2022 4:00 PM Planning and Zoning Commission Council Work Session Room 10/26/2022 5:00 PM Planning and Zoning Commission Council Work Session Room & Council Chambers 10/28/2022 12:00 PM Bond Oversight Committee Development Service Center 10/28/2022 1:00 PM Sustainability Framework Advisory Committee Council Work Session Room 10/31/2022 5:30 PM Zoning Board of Adjustment Council Work Session Room November 2022 11/1/2022 2:00 PM City Council Council Work Session Room & Council Chambers 11/2/2022 1:00 PM Civil Service Commission City Hall East Human Resources Training Room 11/2/2022 5:30 PM Historic Landmark Commission Development Service Center 11/3/2022 8:00 AM Agenda Committee City Hall Conference Room 11/3/2022 8:30 AM Economic Development Partnership Board Development Service Center Training Rooms 11/7/2022 6:00 PM Board of Ethics Council Work Session Room 11/7/2022 6:00 PM Parks, Recreation and Beautification Board Civic Center Community Room 11/9/2022 11:00 AM Economic Development Partnership Board Development Service Center Training Rooms 11/9/2022 3:00 PM Airport Advisory Board Airport Terminal Meeting Room Page 2City of Denton Printed on 10/21/2022 114 Date Time Meeting LocationMeeting Body Meeting Calendar continued... 11/11/2022 12:00 PM Community Services Advisory Committee Development Service Center (401 N. Elm Street, Denton, Texas) 11/14/2022 9:00 AM Public Utilities Board Council Work Session Room 11/14/2022 10:00 AM Development Code Review Committee Development Service Center 11/14/2022 5:30 PM Historic Landmark Commission Development Service Center 11/14/2022 5:30 PM Library Board Meeting Room at the South Branch Library, 3228 Teasley Lane, Denton, Texas 11/15/2022 11:30 AM City Council Development Service Center & Council Chambers 11/15/2022 2:00 PM City Council Council Work Session Room & Council Chambers 11/16/2022 12:00 PM Downtown Denton Tax Increment Financing Zone No. 1 Board Development Service Center Training Rooms 11/16/2022 3:00 PM Animal Shelter Advisory Committee Council Work Session Room 11/16/2022 5:00 PM Planning and Zoning Commission Council Work Session Room & Council Chambers 11/16/2022 6:00 PM Denton Police Department Chief of Police Advisory Board Public Safety Training Center 719 E. Hickory Street Denton, Texas 76205 11/17/2022 12:00 PM Community Services Advisory Committee Development Service Center (401 N. Elm Street, Denton, Texas) 11/17/2022 3:00 PM Committee on Persons with Disabilities Development Service Center 11/17/2022 6:00 PM City Council Embassy Suites Denton Convention Center & Council Chambers 11/18/2022 9:00 AM City Council Council Chambers 11/18/2022 1:00 PM Sustainability Framework Advisory Committee Council Work Session Room 11/23/2022 12:00 PM Downtown Denton Tax Increment Financing Zone No. 1 Board Development Service Center Training Rooms 11/28/2022 10:00 AM Development Code Review Committee Development Service Center 11/29/2022 11:30 AM City Council Denton ISD Central Services Building & Council Chambers 11/30/2022 9:00 AM Mobility Committee Council Work Session Room December 2022 Page 3City of Denton Printed on 10/21/2022 115 Date Time Meeting LocationMeeting Body Meeting Calendar continued... 12/1/2022 8:00 AM Agenda Committee City Hall Conference Room 12/1/2022 8:30 AM Economic Development Partnership Board Development Service Center Training Rooms 12/1/2022 4:00 PM Public Art Committee Civic Center Community Room 12/5/2022 6:00 PM Parks, Recreation and Beautification Board Civic Center Community Room 12/6/2022 2:00 PM City Council Council Work Session Room & Council Chambers 12/12/2022 9:00 AM Public Utilities Board Council Work Session Room 12/12/2022 10:00 AM Development Code Review Committee Development Service Center 12/12/2022 5:30 PM Historic Landmark Commission Development Service Center 12/12/2022 5:30 PM Library Board Meeting Room at the Emily Fowler Central Library, 502 Oakland St., Denton, Texas 12/13/2022 2:00 PM City Council Council Work Session Room & Council Chambers 12/14/2022 11:00 AM Economic Development Partnership Board Development Service Center Training Rooms 12/14/2022 1:00 PM Community Partnership Committee City Hall Conference Room 12/14/2022 3:00 PM Airport Advisory Board Airport Terminal Meeting Room 12/14/2022 5:00 PM Planning and Zoning Commission Council Work Session Room & Council Chambers 12/16/2022 1:00 PM Sustainability Framework Advisory Committee Council Work Session Room 12/31/2022 2:00 PM City Council Council Work Session Room & Council Chambers Page 4City of Denton Printed on 10/21/2022 116 City of Denton Meeting Agenda City Hall 215 E. McKinney St. Denton, Texas 76201 www.cityofdenton.com City Council Council Work Session Room & Council Chambers 2:00 PMTuesday, November 1, 2022 WORK SESSION BEGINS AT 2:00 P.M. IN THE COUNCIL WORK SESSION ROOM CLOSED MEETING BEGINS IMMEDIATELY FOLLOWING THE WORK SESSION IN THE COUNCIL WORK SESSION ROOM REGULAR MEETING BEGINS AT 6:30 P.M. IN THE COUNCIL CHAMBERS REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL Individuals may speak during a Council meeting under one of the following categories: Open Microphone: At regular meetings only, individuals can speak on any topic that is not on the agenda for no longer than four (4) minutes per individual. This portion of the meeting occurs immediately after the start of the regular meeting session. Please note, Council members cannot engage in a discussion on topics presented during this portion and there are limited slots available for this portion of the meeting. Comments on Agenda Items: Public comments can be given for any item considered by the Council, EXCEPT work session reports or closed meetings. Individuals are only able to comment one time per agenda item and cannot use more than one method to comment on a single agenda item. Public comments are limited to three (3) minutes per citizen. Public Hearing Items: Individuals are limited to four (4) minutes per public hearing item. _________________________________________________________________________________ Individuals may participate by using one of the following methods: 1. In Person for Regular or Consent Agenda Items: To provide in-person comments regular or consent agenda items (excluding public hearing items), Individuals must be present at the meeting and submit a speaker card (available at the meeting location) to the City Secretary prior to the item being called. 2. In Person for Public Hearing Items: For public hearing items, speaker cards are encouraged but not required. Page 1 Printed on 10/21/2022 117 November 1, 2022City Council Meeting Agenda 3. eComment: The agenda is posted online at https://tx-denton.civicplus.com/242/Public-Meetings-Agendas. Once the agenda is posted, a link to make virtual comments using the eComment module will be made available next to the meeting listing on the Upcoming Events Calendar. Using eComment, Individuals may indicate support or opposition and submit a brief comment about a specific agenda item. eComments may be submitted up until the start of the meeting at which time the ability to make an eComment will be closed. eComments will be sent directly to members of the City Council immediately upon submission and recorded by the City Secretary into the Minutes of the Meeting. 4. By Phone: Individuals may register to provide comments by phone. Instructions and a link to register to comment by phone will be available at www.cityofdenton.com/publicmeetings until noon of the meeting date. Residents will submit contact information using the link provided and receive further instructions via email on how to join the meeting by phone and provide comments. _________________________________________________________________________________ After determining that a quorum is present, the City Council of the City of Denton, Texas will convene in a Work Session on Tuesday, November 1, 2022, at 2:00 p.m. in the Council Work Session Room at City Hall, 215 E. McKinney Street, Denton, Texas at which the following items will be considered: WORK SESSION 1. Citizen Comments on Consent Agenda Items This section of the agenda allows citizens to speak on any item listed on the Consent Agenda prior to its consideration. Each speaker will be given a total of three (3) minutes to address any item(s). Any person who wishes to address the City Council regarding these items may do so by utilizing the "By Phone" registration process as referenced under the REGISTRATION GUIDELINES FOR ADDRESSING THE CITY COUNCIL detailed at the beginning of this agenda. Registration is required prior to the time the City Council considers this item. Registrants may call in and remain on hold or receive a call back at the time the Work Session is called to Order and are encouraged to ensure they remain accessible to accept the call. 2. Requests for clarification of agenda items listed on this agenda. 3. Work Session Reports Receive a report, hold a discussion, and give staff direction regarding the rehabilitation and future use of City Hall West. *[Council Priority; Presentation/Discussion Time: 45 minutes] ID 22-1552A. Receive a report, hold a discussion, and give staff direction regarding citywide regulation of criminal history information on job applications. [Estimated Presentation/Discussion Time: 45 minutes] ID 22-1761B. Receive a report, hold a discussion, and give staff direction regarding the updates to the Roadway Impact Fees. [Estimated Presentation/Discussion Time: 45 minutes] ID 22-1719C. Page 2 Printed on 10/21/2022 118 November 1, 2022City Council Meeting Agenda Receive a report and hold a discussion regarding an update on Bonnie Brae Street. [Estimated Presentation/Discussion Time: 30 minutes] ID 22-1999D. Receive a report, hold a discussion, and give direction regarding the Water, Wastewater Impact Fee Study. [Estimated Presentation/Discussion Time: 1 hour] ID 22-1930E. Receive a report, hold a discussion, and give staff direction on pending City Council requests for: [Estimated Presentation/Discussion Time: 30 minutes] ID 22-1676F. Following the completion of the Work Session, the City Council will convene in a Closed Meeting in the Council Work Session Room to consider specific item(s) when these items are listed below under the Closed Meeting section of this agenda. The City Council reserves the right to adjourn into a Closed Meeting on any item on its Open Meeting agenda consistent with Chapter 551 of the Texas Government Code, as amended, or as otherwise allowed by law. 1. Closed Meeting: -- PLACEHOLDER IN THE EVENT A CLOSED MEETING IS NEEDED; OTHERWISE, WILL BE DELETED. -- Any final action, decision, or vote on a matter deliberated in a Closed Meeting will only be taken in an Open Meeting that is held in compliance with Texas Government Code, Chapter 551, except to the extent such final decision, or vote is taken in the Closed Meeting in accordance with the provisions of Section 551.086 of the Texas Government Code (the ‘Public Power Exception’). The City Council reserves the right to adjourn into a Closed Meeting or Executive Session as authorized by Texas Government Code, Section 551.001, et seq. (The Texas Open Meetings Act) on any item on its open meeting agenda or to reconvene in a continuation of the Closed Meeting on the Closed Meeting items noted above, in accordance with the Texas Open Meetings Act, including, without limitation Sections 551.071-551.086 of the Texas Open Meetings Act. NOTE: Any item for which a formal action at the Regular Meeting has been taken by Council may be subject to a request for a motion for reconsideration at any time during the meeting, at the Concluding Items Section, or after the meeting. In order to comply with the Texas Open Meetings Act, a request for a motion for reconsideration made during, at the end of, or after a Council meeting will be placed on the agenda and considered at the next official meeting of the City Council. Following the Closed Meeting, the City Council will reconvene in Open Meeting to take action, if any, on matters discussed in closed session. _________________________________________________________________________________ AFTER DETERMINING THAT A QUORUM IS PRESENT, THE REGULAR MEETING OF THE CITY OF DENTON CITY COUNCIL WILL CONVENE AT 6:30 P.M. IN THE COUNCIL CHAMBERS AT CITY HALL, 215 E. MCKINNEY STREET, DENTON, TEXAS AT WHICH THE FOLLOWING ITEMS WILL BE CONSIDERED: 1. PLEDGE OF ALLEGIANCE A. U.S. Flag B. Texas Flag “Honor the Texas Flag – I pledge allegiance to thee, Texas, one state under God, one and indivisible.” Page 3 Printed on 10/21/2022 119 November 1, 2022City Council Meeting Agenda 2. PROCLAMATIONS/PRESENTATIONS Proclamation: The Salvation Army’s Red Kettle Love Beyond CampaignID 22-2144A. 3. PRESENTATIONS FROM MEMBERS OF THE PUBLIC A. Review of procedures for addressing the City Council. B. Reports from members of the public shall be received through the following two (2) methods. A total of up to seven (7) speakers are permitted to provide public comment and may include any combination of prior registration and open microphone speakers. 1) Pre-registration. This section of the agenda permits any person who has registered in advance to make a citizen report regarding a public business item he or she wishes to be considered by the City Council. Each speaker is allowed a maximum of four (4) minutes to present their report. At the conclusion of each report, the City Council may pose questions to the speaker or may engage in discussion. If the City Council believes that a speaker's report requires a more detailed review, the City Council will give the City Manager or City Staff direction to place the item on a future work session or regular meeting agenda and advise staff as to the background materials to be desired at such meeting. 2) Open Microphone. This section of the agenda permits any person who has not registered in advance for a citizen report to make comments about public business items not listed on the agenda. Such person(s) shall have registered using the “Virtual White Card” or “By Phone” process outlined by the City on its website or meeting notice. During open microphone reports under this section of the agenda, the Council may listen to citizens speak. However, because notice of the subject of the open microphone report has not been provided to the public in advance, the Texas Open Meetings Act limits any deliberation or decision by the Council to: a proposal to place the item on a future agenda; a statement of factual information; or a recitation of existing policy. Council Members may not ask the open microphone speakers questions or discuss the items presented during open microphone reports. NOTE: If audio/visual aids during presentations to Council are needed, they must be submitted to the City Secretary 24 hours prior to the meeting. 4. CONSENT AGENDA Each of these items is recommended by Staff or a board, commission, and committee. Approval thereof will be strictly on the basis of the those recommendations. Approval of the Consent Agenda authorizes the City Manager or his designee to implement each item in accordance with the Staff recommendations. The City Council has received background information and has had an opportunity to raise questions regarding these items prior to consideration. For those items recommended by a specific board, commission, or committee, the agenda item will reference that recommendation. To view the video of the related board, commission, or committee meeting, as applicable, a link can be found within the applicable supporting documentation (Exhibit 1). Listed below are bids, purchase orders, contracts, and other items to be approved under the Consent Agenda (Agenda Items A – AH). This listing is provided on the Consent Agenda to allow Council Members to discuss or withdraw an item prior to approval of the Consent Agenda. If no items are pulled, the Consent Agenda Items will be approved with one motion. If items are pulled for separate discussion, Page 4 Printed on 10/21/2022 120 November 1, 2022City Council Meeting Agenda they may be considered as the first items following approval of the Consent Agenda. Consider approval of the minutes of October 18, 2022 (Joint Council/Planning & Zoning Special Called), and October 18, 2022 (Regular), Meetings. ID 22-825A. Consider nominations/appointments to the City’s Boards, Commissions, and Committees: Airport Advisory Board, Animal Shelter Advisory Committee, Board of Ethics, Committee on Persons with Disabilities, Community Services Advisory Committee, Denton Police Department Chief of Police Advisory Board, Health & Building Standards Commission, Historic Landmark Commission, Internal Audit Advisory Committee, Library Board, Parks, Recreation & Beautification Board, Planning & Zoning Commission, Public Art Committee, Public Utilities Board, Sustainability Framework Advisory Committee, Traffic Safety Commission, and Zoning Board of Adjustment. ID 22-1393B. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the city manager or designee to execute contracts regarding recurring programs and services in Denton Public Library facilities offered by local non-profit agencies, organizations, or businesses in coordination with Denton Public Library to clarify roles and responsibilities for each party; and providing an effective date. ID 22-1760C. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a funding agreement between the City of Denton and the Habitat for Humanity of Denton County to provide HOME Investment Partnership Program funds for the new construction of four (4) homebuyer units located at Habitat Village (located in Southeast Denton between Duncan St. and Hill St. and along Smith St.), Denton, Texas; authorizing the expenditure of funds in an amount not to exceed $253,527; and providing an effective date. ID 22-1932D. Consider adoption of an ordinance of the City of Denton, Texas, approving a Third Amended Employment Agreement for Municipal Court Presiding Judge Tyler Atkinson under the performance review provision of his employment agreement with the City to amend the employment agreement to authorize the Presiding Judge to perform magistrate duties for Denton County and to provide for an increase in severance pay, salary, and car allowance; authorizing the expenditure of funds; and providing an effective date. ID 22-2008E. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a funding agreement between the City of Denton and the Denton Affordable Housing Corporation to provide HOME Investment Partnership Program funds for the rehabilitation of six (6) rental units located at 710, 712, 714, 716, 718 and 720 Roberts Street, Denton, Texas; authorizing the expenditure of funds in an amount not to exceed $200,000.00; and providing an effective date. ID 22-1776F. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Main Street Association for the purpose of the 2023 Arts & Autos Extravaganza sponsorship; providing for the expenditure of funds; and providing for an effective date. ($2,500 - Community Partnership Committee recommends approval 3-0) ID 22-2028G. Consider adoption of an ordinance of the City of Denton authorizing an agreement ID 22-2033H. Page 5 Printed on 10/21/2022 121 November 1, 2022City Council Meeting Agenda between the City of Denton and Denton Black Chamber of Commerce, Inc. for the purpose of the 2023 Denton Blues Festival and Young Minority Entrepreneurs Institute Program sponsorship; providing for the expenditure of funds; and providing for an effective date. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Black Film Festival Institute for the purpose of the 2023 Denton Black Film Festival sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2034I. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Festival Foundation Inc., for the purpose of the 2022 Denton Arts and Jazz Festival sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2035J. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Greater Denton Arts Council, Inc., for the purpose of the Community Art Grants Program sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2036K. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Juneteenth Celebration Committee for the purpose of the 2023 Juneteenth Celebration sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2037L. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton, Texas, and Kiwanis Youth Services, Inc., for the purpose of 4th of July fireworks show sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2038M. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and North Texas State Fair Association, Inc., for the purpose of the 2023 North Texas Fair and Rodeo Kids Zone sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2039N. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Texas Filmmakers Corporation for the purpose of the Thin Line Fest 2023 sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2040O. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and the Texas Veterans Hall of Fame for the purpose of the 2022 Honor Veterans Day sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2041P. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Parks Foundation for the purpose of the 2023 Cinco de Mayo Festival sponsorship; providing for the expenditure of funds; and providing an effective date. ID 22-2133Q. Page 6 Printed on 10/21/2022 122 November 1, 2022City Council Meeting Agenda Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton’s Day of the Dead Festival for the purpose of the 2022 Day of the Dead Festival sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2137R. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Holiday Festival Association, Inc. for the purpose of the 2022 Denton Holiday Lighting Festival sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2138S. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Parks Foundation for the purpose of the 2023 Dog Days of Denton sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2140T. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and the Denton Area Running Club for the purpose of the 2022 Downtown Denton Turkey Trot and Kids’ Gobble Wobble sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2141U. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Tejas Storytelling Association for the purpose of the 2023 Tejas Storytelling Festival sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2142V. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and United Way of Denton County for the purpose of the 2022 Pride and Class Truck Parade sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2143W. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Explorium Denton, Inc., for the purpose of the 2023 Touch a Truck sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2171X. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Juneteenth University for the purpose of the 2023 Denton Juneteenth Parade sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2172Y. Consider adoption of an ordinance of the City of Denton authorizing an agreement between the City of Denton and Denton Main Street Association for the purpose of the 2022 Fall Twilight Tunes sponsorship; providing for the expenditure of funds; and providing for an effective date. ID 22-2173Z. Consider adoption of an ordinance of the City of Denton authorizing the City Manager to execute a contingency fund agreement between the City of Denton and American Legion Post 71 in an amount not to exceed three hundred seventy dollars ($370); and providing for an effective date. ID 22-2191AA. Page 7 Printed on 10/21/2022 123 November 1, 2022City Council Meeting Agenda Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a Professional Services Agreement with HDR Engineering, Inc., for professional engineering services on the Lead and Copper Public Outreach and Crisis Communication Plan for the Water Utilities Department as set forth in the contract; providing for the expenditure of funds therefor; and providing an effective date (RFQ 7574-019 - Professional Services Agreement for engineering services awarded to HDR Engineering, Inc., in the not-to-exceed amount of $217,106.50). The Public Utilities Board recommends approval ( - ). ID 22-2193AB. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with Altec Industries, Inc., through the Sourcewell Cooperative Purchasing Network Contract Number 110421-ALT, for the acquisition of Altec model Digger Derricks, Bucket Trucks, & Utility Equipment for the Electric Distribution, Electric Operations, Traffic, and Parks Departments; authorizing the expenditure of funds therefor; and providing an effective date (File 8130 - awarded to Altec Industries, Inc., in the five (5) year not-to-exceed amount of $3,000,000.00). The Public Utilities Board recommends approval ( - ). ID 22-2196AC. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with KS2 Technologies, Inc., for the renewal of maintenance and vendor support services for the KS2 Reporting Tool and associated software modules for the Technology Services Department, which is the sole provider of this software, in accordance with Texas Local Government Code Chapter 252.022, which provides that procurement of commodities and services that are available from one source are exempt from competitive bidding, and if over $50,000, shall be awarded by the governing body; providing for the expenditure of funds therefor; and providing an effective date (File 8073-awarded to KS2 Technologies, Inc., for one (1) year, with the option for four (4) additional one (1) year extensions, in the total five (5) year not-to-exceed amount of $150,000.00). ID 22-2197AD. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the approval of Change Order No. 4 to the contract between the City of Denton and 2L Construction, LLC., for the construction of the West Hickory Street Paving, Lighting & Drainage Improvements Project for the City of Denton; providing for the expenditure of funds therefor; and providing an effective date (IFB 7163 - Change Order No. 4 in the not-to-exceed amount of $219,543.05 for a total contract award aggregated to $2,139,047.00). ID 22-2198AE. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with Amperon Holdings, Inc., for load forecasting services for Denton Municipal Electric; providing for the expenditure of funds therefor; and providing an effective date (RFP 8024 - awarded to Amperon Holdings, Inc., in the three (3) year not-to-exceed amount of $252,000.00). The Public Utilities Board recommends approval ( - ). ID 22-2199AF. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with Maxar Intelligence, ID 22-2200AG. Page 8 Printed on 10/21/2022 124 November 1, 2022City Council Meeting Agenda Inc., for weather forecasting services and renewables forecasting services for Denton Municipal Electric; providing for the expenditure of funds therefor; and providing an effective date (RFP 8024 - awarded to Maxar Intelligence, Inc., in the three (3) year not-to-exceed amount of $200,000.00). The Public Utilities Board recommends approval ( - ). Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with Red Wing Brands of America, Inc., through the U.S. General Services Administration's (GSA) MAS schedule 47QSWA22D00AB, for Safety Foot Wear for the City of Denton; providing for the expenditure of funds therefor; and providing an effective date (File 8144 - awarded to Red Wing Brands of America, Inc., in a not-to-exceed amount of $750,000.00). ID 22-2250AH. 5. PUBLIC HEARINGS -- PLACEHOLDER IN THE EVENT PUBLIC HEARING ITEMS ARE SCHEDULED; OTHERWISE, WILL BE DELETED. -- 6. ITEMS FOR INDIVIDUAL CONSIDERATION – CONSIDERATION OF THE USE OF EMINENT DOMAIN TO CONDEMN REAL PROPERTY INTERESTS -- PLACEHOLDER IN THE EVENT EMINENT DOMAIN ITEMS ARE SCHEDULED; OTHERWISE, WILL BE DELETED. -- 7. ITEMS FOR INDIVIDUAL CONSIDERATION Consider approval of a resolution of the City of Denton adopting the City of Denton’s 2023-2024 Legislative Program; and providing an effective date. ID 22-1697A. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a Professional Services Agreement with Kimley-Horn and Associates, Inc., for the design services of Neighborhoods 2 and 6 for the Capital Projects/Engineering Department as set forth in the contract; providing for the expenditure of funds therefor; and providing an effective date (RFQ 7599-010 - Professional Services Agreement for design services awarded to Kimley-Horn and Associates, Inc., in the not-to-exceed amount of $5,726,000.00). The Public Utilities Board recommends approval ( - ). ID 22-2192B. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a Construction Manager at Risk contract with Sundt Construction, Inc., for pre-construction services of Neighborhood 2 & 6 Improvements for the Capital Projects Department; providing for the expenditure of funds therefor; and providing an effective date (RFP 8055 - awarded to Sundt Construction, Inc., in the not-to-exceed amount of $452,147.00). The Public Utilities Board recommends approval ( - ). ID 22-2195C. Consider adoption of an ordinance of the City of Denton, a Texas home-rule municipal corporation, authorizing the City Manager to execute a contract with Mountain Cascade of Texas, LLC, for the construction of the I-35E-Mayhill Utility Relocations Project for the Water/Wastewater Utilities and Capital Projects/Engineering Department; providing ID 22-2194D. Page 9 Printed on 10/21/2022 125 November 1, 2022City Council Meeting Agenda for the expenditure of funds therefor; and providing an effective date (IFB 7968-001 - awarded to Mountain Cascade of Texas, LLC, in the not-to-exceed amount of $15,008,997.15). The Public Utilities Board recommends approval ( - ). 8. CONCLUDING ITEMS A. Under Section 551.042 of the Texas Open Meetings Act, respond to inquiries from the City Council or the public with specific factual information or recitation of policy, or accept a proposal to place the matter on the agenda for an upcoming meeting AND Under Section 551.0415 of the Texas Open Meetings Act, provide reports about items of community interest regarding which no action will be taken, to include: expressions of thanks, congratulations, or condolence; information regarding holiday schedules; an honorary or salutary recognition of a public official, public employee, or other citizen; a reminder about an upcoming event organized or sponsored by the governing body; information regarding a social, ceremonial, or community event organized or sponsored by an entity other than the governing body that was attended or is scheduled to be attended by a member of the governing body or an official or employee of the municipality; or an announcement involving an imminent threat to the public health and safety of people in the municipality that has arisen after the posting of the agenda. B. Possible Continuation of Closed Meeting topics, above posted. C E R T I F I C A T E I certify that the above notice of meeting was posted on the official website (https://tx-denton.civicplus.com/242/Public-Meetings-Agendas) and bulletin board at City Hall, 215 E. McKinney Street, Denton, Texas, on October 28, 2022, in advance of the 72-hour posting deadline, as applicable, and in accordance with Chapter 551 of the Texas Government Code. __________________________________________ CITY SECRETARY NOTE: THE CITY OF DENTON'S DESIGNATED PUBLIC MEETING FACILITIES ARE ACCESSIBLE IN ACCORDANCE WITH THE AMERICANS WITH DISABILITIES ACT. THE CITY WILL PROVIDE ACCOMMODATION, SUCH AS SIGN LANGUAGE INTERPRETERS FOR THE HEARING IMPAIRED, IF REQUESTED AT LEAST 48 HOURS IN ADVANCE OF THE SCHEDULED MEETING. PLEASE CALL THE CITY SECRETARY'S OFFICE AT 940-349-8309 OR USE TELECOMMUNICATIONS DEVICES FOR THE DEAF (TDD) BY CALLING 1-800-RELAY-TX SO THAT REASONABLE ACCOMMODATION CAN BE ARRANGED. Page 10 Printed on 10/21/2022 126 Meeting Date Item Legistar ID Departments Involved Type Estimated Time A. Legislative Program 22-1830 City Manager's Office City Business 1:00 B. Responsive Speed Limit Sign Program 22-1721 Capital Projects/Engineering Council Request: Davis 0:45 C. Public Facility Corporations 22-1453 City Manager's Office Council Request: Watts (6/28/2022)0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 2:15 A. City Hall West Plan 22-1552 Facilities Council Priority 0:45 B. Prevention of Criminal History Information on Job Application 22-1761 City Manager's Office Council Request: McGee (8/02/2022)0:45 C. Roadway Impact Fees 22-1719 Capital Projects/Engineering City Business 0:45 D. Bonnie Brae Street Update 22-1999 Capital Projects/Engineering City Business 0:30 E. Water, Wastewater Impact Fee Study 22-1930 Finance City Business 1:00 F. Two-Minute Pitch: 22-1676 City Manager's Office Council Request 0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 4:15 A. Denton Housing Strategy 22-1823 City Manager's Office City Business 0:45 B. City of Denton and Denton Housing Authority Housing Priorities 22-1824 City Manager's Office City Business 0:45 C. Topics for Future Areas of Collaboration or Partnership 22-1825 City Manager's Office City Business 0:30 Total Est. Time: 2:00 A. Audit Follow-Up Reviews – CIP: Planning & Design, and CIP: Construction 22-1166 Internal Audit City Business 0:30 B. FY 22-23 Sustainability Fund Work Plan 22-2185 Environmental & Sustainability City Business 0:30 C. Water/Wastewater Impact Fees Follow-up TBD Finance City Business TBD C. Two-Minute Pitch: 22-1677 City Manager's Office Council Request 0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 1:30 Total Est. Time: 2:30 CANVASSING MEETING ONLY N/A City Manager's Office City Business 0:45 Total Est. Time: 0:45 City Manager's Office City Business City Manager's Office City Business City Manager's Office City Business Closed Meeting Item(s): Legal (if any)City Business Total Est. Time: 0:00 A. Denton County Transit Authority Update 21-2807 City Manager's Office City Business 0:30 B. Solicitation/Panhandling Policy 22-1281 Police; Community Services Council Request: Hudspeth 0:45 C. Bond Election in 2023 TBD Finance City Business 0:30 D. Roadway Impact Fees Follow Up 22-1900 Capital Projects/Engineering City Business 0:30 E. Ethics Ordinance Section 2-272C (Add Financial Payment for Financial Engagement)22-2209 City Auditor City Manager's Office Council Request Hudspeth (09/27/2022)0:45 F. Two-Minute Pitch: 22-1678 City Manager's Office Council Request 0:30 Closed Meeting Item(s)TBD Legal (if any)City Business Total Est. Time: 3:30 A. Audit Project 030 – Solid Waste Operations: Phase 1 22-1167 Internal Audit City Business 0:30 B. Criteria Manuals Discussion (Water, Wastewater, Transportation, et al)22-1714 Capital Projects/Engineering City Business 0:45 C. Denco 911 Update TBD Police City Business 1:00 D. TxDOT Roads & Amendment to Mobility Plan (Roundabout @ Eagle, Bell, Dallas, & Locust)TBD Engineering Council Request Davis (09/27/2022)TBD E. Two-Minute Pitch: 22-1679 City Manager's Office Council Request 0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 2:45 A. Two-Minute Pitch: TBD City Manager's Office Council Request 0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 0:30 A. Two-Minute Pitch: TBD City Manager's Office Council Request 0:30 Closed Meeting Item(s): TBD Legal (if any)City Business Total Est. Time: 0:30 Item Legistar ID Departments Type Estimated Work Session Date Sanger ETJ Boundary Adjustment 21-2653 Development Services City Business :45 Denton Energy Center Alternate Fuel Study TBD DME City Business TBD GreenSense Update [Scheduling for February 7, 2023]22-1847 DME City Business 0:45 City Council Communication and Group Effectiveness 22-2182 City Manager's Office Council Priority 0:30 Audit Project 029 - Police Body-Worn Camera Usage [Scheduling for either December 2022 or January 2023]21-2813 Internal Audit City Business 0:30 Roadway Funding Strategies [Scheduling for January 2023)22-741 Finance City Business 1:00 Item Dates Departments Type Estimated Work Session Date Item Date Approved Department Estimated Hours to Complete Requestor RFP for a Downton Parking Survey 10-18-2022 City Manager's Office Development Services CM Davis November 17, 2022 Mayor's State of the City Embassy Suites Denton Convention Center (6:00 p.m. - 8:30 p.m.) State of the City N/A City Manager's Office City Business 2:30 November 29, 2022 Special Called Joint Meeting with Denton ISD (@ 11:30 a.m.) Denton ISD Central Services Building TBD TBD TBD December 13, 2022 Work Session (@2:00 p.m.) Special Called Meeting (@6:30 p.m.) Other Major Items for Meeting: Public Hearing for Criteria Manuals November 15, 2022 Work Session (@2:00 p.m.) Regular Meeting (@6:30 p.m.) Other Major Items for Meeting: Public Hearing for Roadway Impact Fees December 6, 2022 Work Session (@2:00 p.m.) Regular Meeting (@6:30 p.m.) Other Major Items for Meeting: Citywide Speed Study Public Hearing Other Major Items for Meeting: Approved Council Pitches to be Scheduled Work Session Dates to be Determined Council Priorities and Significant Work Plan Items to be Scheduled November 18, 2022 (Friday) Special Called Meeting - Canvassing Only (@ 9:00 a.m.) Council Chambers Tentative Work Session Topics and Meeting Information Updated: October 21, 2022 November 15, 2022 Special Called Joint Meeting with DHA (@ 11:30 a.m.) At the Development Service Center November 1, 2022 Work Session (@2:00 p.m.) Regular Meeting (@6:30 p.m.) October 25, 2022 Work Session (@2:00 p.m.) Special Called Meeting (@6:30 p.m.) Other Major Items for Meeting: January 24, 2023 Work Session (@2:00 p.m.) Regular Meeting (@6:30 p.m.) Other Major Items for Meeting: January 10, 2023 Work Session (@2:00 p.m.) Regular Meeting (@6:30 p.m.) Other Major Items for Meeting: *This is for planning purposes only. Dates are subject to change.127 1 Street Closure Report: Upcoming ClosuresSCR Oct 24th - 30thStreet/ IntersectionFromToClosure StartDateClosure EndDateDescriptionDepartmentDepartment Contact1Camino RealEdwardsPockus Page10/31/22 12/09/22 Street Panel RepairStreetsRoy San Miguel2Gardenview StEvers PkwyBrooke St11/07/22 11/18/22 Mill & OverlayStreetsJeremy Wilks Exported on October 21, 2022 11:29:46 AM CDT128 2 Street Closure Report: Current ClosuresStreet/ IntersectionFromToClosure StartDateClosure EndDateDescriptionDepartmentDepartment Contact1Atlas DrHercules LnRedstone Rd10/17/22 02/10/23 ReconstructStreetsJeremy Wilks2Augusta DrColonial DrAugusta Dr (2900)07/11/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig3Ave AGreenleeAve A10/25/22 12/16/22 Street ReconstructionEngineeringDustin Draper4Ave BUnderwoodMargie St10/05/22 11/25/22 Street ReconstructionEngineeringDustin Draper5Ave HPrairie StLouise St09/05/22 11/11/22 Street ReconstructionEngineeringDustin Draper6Blackberry WayThistle HLThistle Way10/10/22 11/11/22 French Drain system project DrainageGabriel Rodriguez7Bonnie Brae StWindsor DrCarril Al Lago Dr08/15/22 10/26/22 open cut for infrastructureinstallation from westsidebonnie brae to east side ofbonnie brae including utility tapsin 2 phasesPrivate DevelopmentLee Thurmond8Bradshaw StHickory StMcKinney St03/21/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig9Brook Hollow DrGreenway DrCarriage Hill10/07/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig10Clear River LnMontecito DrRambling Brook Trl10/24/22 11/23/22 Sidewalk RepairStreetsRoy San Miguel11Clover LnRobinwood LnGlenwood Ln05/23/22 10/28/22 Wastewater Collections will beinstalling a new sewer main lineand services.WastewaterTiffany Sherrane12College Park DrPeach StFowler Dr04/18/22 10/28/22 Water Distribution will beinstalling a new water naim lineand services.WaterTiffany Sherrane13Colonial DrThunderbird DrSouth Dead End07/11/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig14Cook StRobertson StWye St10/24/22 02/03/23 Utility installation and roadwayreconstructionEngineeringSeth Garcia15Crawford StHickory StMcKinney St03/21/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig16Crescent StFulton StAlice St09/27/22 11/18/22 Street ReconstructionEngineeringDustin Draper17Crisoforo DrSantos DrMorin Dr09/26/22 10/28/22 Sidewalk RepairStreetsRoy San Miguel18Fairway DrClubview DrLinks Dr10/17/22 11/04/22 Sidewalk RepairStreetsRoy San Miguel19Fowler DrCollege Park DrPeach St04/18/22 10/28/22 Water Distribution will beinstalling a new water main lineand servicesWaterTiffany Sherrane20Fulton StGrace Temple AveCongress St10/04/22 11/18/22 Street ReconstructionEngineeringDustin Draper21Fulton StOak StGrace Temple Ave09/07/22 11/18/22 Street ReconstructionEngineeringDustin Draper22Greenway DrThunderbird DrSouth Dead End07/11/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig23Greenway DrThunderbird Dr.Windsor Farms Dr10/07/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig24Hettie StPaisley StMcKinney St03/21/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig25Hickory StExposition StRuddell St05/02/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig26Hill Alley StJackson StMartin St06/06/22 10/28/22 Utility replacement and roadwayreconstructionEngineeringSeth Garcia27Hinkley Oaks DrBarrydale DrHinkley Oaks (7612)10/10/22 11/18/22 Concrete Panel and sidewalkrepairStreetsRoy San Miguel28Jackson StMorse StHill Alley St06/06/22 10/28/22 Utility replacement and roadwayreconstructionEngineeringSeth Garcia Exported on October 21, 2022 11:29:56 AM CDT129 Street/ IntersectionFromToClosure StartDateClosure EndDateDescriptionDepartmentDepartment Contact29Jim Christal RdWestern BlvdMasch Branch Rd04/18/22 10/31/22 Exeter PH2. Installing PublicWater, Sewer, and StormUtilitiesPrivate Development PublicWorks InspectionsJeremiah Tillman-David30Johnson RdJohn Paine RdLavon Ln09/02/22 11/25/22 Chris Harp performing LimeStabilization for Johnson RdPrivate Development PublicWorks InspectionsJeremiah Tillman-David31Lakewood DrGreenway DrCarriage Hill10/07/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig32Live Oak StRobinwood LnCrestwood Pl05/23/22 10/28/22 Wastewater collections will beinstalling a new sewer main lineand services.WastewaterTiffany Sherrane33Lonesome TrailBareback LnEnglish Saddle Ln10/24/22 11/18/22 Sidewalk RepairStreetsRoy San Miguel34Masch Branch RdLovers LnHampton Rd06/24/22 12/31/22 Bridge collapse at 3288 N.Masch Branch RdDrainageGabriel Rodriguez35McKinney StBell AveFrame St10/10/22 10/31/22 Inlets and approachesPublic Works Inspections Armando Beltran36McKinney StBell AveFrame St10/10/22 11/25/22 Restructuring the entrance toFrame St.Public Works Inspections Armando Beltran37McKinney StCrawford RdAudra Ln05/19/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig38Mistywood LnSherwood StRobinwood Ln05/23/22 10/28/22 Wastewater Collections will beinstalling a new sewer main lineand services.WastewaterTiffany Sherrane39Montecito DrRyan RdDead end10/10/22 10/28/22 Mill OverlayEngineeringSeth Garcia40Morse StLakey StJackson St06/06/22 10/28/22 Utility replacement and roadwayreconstructionEngineeringSeth Garcia41North Texas BlvdI-35WOak St12/13/21 10/31/22 Utility installations andpavement replacement. Therewill be multiple phases ofclosures. Will not be all at onetime.EngineeringScott Fettig42North Texas BlvdOak StHickory St06/10/22 10/31/22 Utility installations andpavement replacement.EngineeringScott Fettig43Nottingham DrChurchill DrDevonshire Ct10/17/22 11/04/22 Valley Gutter and Curb Repair StreetsRoy San Miguel44Oak StMiller StNorth Texas Blvd09/30/22 11/04/22 Utility installations andpavement replacement.EngineeringScott Fettig45Oak StCrawford StWood St04/04/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig46Oceanview DrMarina DrIntersection10/24/22 11/11/22 Concrete Panel repairStreetsRoy San Miguel47Panhandle StAileen StMalone St08/24/22 11/11/22 Street ReconstructionEngineeringDustin Draper48Parkside DrWindsor DrBowling Green St05/31/22 11/18/22 Utility installations andpavement replacement.EngineeringScott Fettig49Peach StLocust StFowler Dr07/18/22 10/28/22 Upgrading 15'' Storm pipe to18''DrainageGabriel Rodriguez50Peach StLocust StPalmer Dr04/18/22 10/28/22 Water Distribution will beinstalling a new water main lineand services.WaterTiffany Sherrane51Robertson StBell AveMorse St08/15/22 10/31/22 Utility installations andpavement replacement.EngineeringSeth Garcia52Robinwood LnKayewwod DrEmerson Ln05/23/22 10/28/22 Wastewater Collections will beinstalling a new sewer main lineand services.WastewaterTiffany Sherrane53Rose StPaisley StUland St04/25/22 11/30/22 Pavement Replacement EngineeringScott Fettig54Ruddell StRuddell St N (1526)Ruddell St N (1528)10/26/22 10/28/22 Wastewater Collections will bereplacing two wastewaterservice lines.WastewaterTiffany Sherrane55Seven Oaks LnRambling Brook TrlSerenity Way10/17/22 11/04/22 Street panels and SidewalkrepairStreetsRoy San Miguel Exported on October 21, 2022 11:29:56 AM CDT130 Street/ IntersectionFromToClosure StartDateClosure EndDateDescriptionDepartmentDepartment Contact56Stella StNorth Texas BlvdBonnie Brae St10/29/21 10/31/22 Utility installations andpavement replacement.EngineeringScott Fettig57Uland StRose StRailroad Ave04/25/22 11/01/22 Utility installations andpavement replacement.EngineeringScott Fettig58Western BlvdJim Christal RdAirport Rd08/01/22 10/31/22 Paving (2) drive approaches Public Works Inspections Jeremiah Tillman-David59Western BlvdJim Christal RdAirport Rd09/06/22 10/31/22 Connecting to existing 8" SSstub and running SS lateral toproperty.Private Development PublicWorks InspectionsJeremiah Tillman-David60Western BlvdUniversity (380)Airport Rd09/19/22 11/30/22 Western Blvd PavingPrivate Development PublicWorks InspectionsJeremiah Tillman-David61Windsor DrFireside LnBonnie Brae St06/06/22 11/30/22 Utility installations andpavement replacement.EngineeringScott Fettig62Wood StMcKinney StHickory St04/11/22 12/31/22 Utility installations andpavement replacement.EngineeringScott Fettig Exported on October 21, 2022 11:29:56 AM CDT131 3 Street Closure Report: Completed ClosuresStreet/ IntersectionFromToClosure StartDateClosure EndDateDescriptionDepartmentDepartment Contact1Barberry AveBaytree AveTrumpet Vine08/22/22 09/30/22 Sidewalk RepairStreetsRoy San Miguel2Baytree AveHawthorn DrBarberry Ave08/22/22 09/30/22 Sidewalk RepairStreetsRoy San Miguel3Bonnie Brae St@ Ft Worth DrRxR Crossing10/06/22 10/08/22 Railroad Crossing4Clubhouse Dr (2600 - 2412) Mustang DrSombrero Dr10/03/22 10/18/22 Panel RepairStreetsRoy San Miguel5Daughtry St@ Meadow StRxR Crossing10/07/22 10/09/22 Railroad Crossing6Forrestridge DrEl Paseo StWellington Oaks Cir07/19/22 10/06/22 Street Panels RepairStreetsRoy San Miguel7Hickory StBell AveRailroad Ave10/03/22 10/07/22 Concrete street panelrepair/replacement for eastbound lanes.AtmosZabdiel Mota8Hickory StRailroad AveExposition St09/06/22 10/14/22 Demo on floor plan (privatework)Public Works Inspections Armando Beltran9Hickory StBell AveRailroad Ave10/10/22 10/14/22 Concrete street panelrepair/replacement for eastbound lanes.Zabdiel Mota10Indian Paint WayLakeview BlvdHawthorn Dr08/29/22 09/22/22 Concrete Panel Repair StreetsRoy San Miguel11Juno LnStuart RdSheraton Rd08/29/22 09/30/22 Curb & Gutter RepairStreetsRoy San Miguel12Juno LnStuart RdYellowstone Pl10/03/22 10/07/22 Mill & OverlayStreetsJeremy Wilks13Livingston DrHickory Creek RdHemingway Dr08/17/22 09/30/22 Pavement, sidewalk, valleygutter, and subgradestabilization on Livingstonwhere it ties into Hickory CreekRd.EngineeringDustin Draper14Mack PlPaisley StLee Dr08/22/22 10/14/22 Street ReconstructionEngineeringDustin Draper15Mayhill RdSpencer RdMorse St09/23/22 09/30/22 Emergency closure for gas linerepairs16Mayhill RdUS 380/University RdQuail Creek Rd09/27/22 10/03/22 Sanitary Sewer Inspections willbe performed requiring variouslanes to be closed. The roadwill remain open.Engineering Wastewater Tracy L. Beck, PE, PMP17McKinney StElm StLocust St10/17/22 10/21/22 Wastewater Collections will bereplacing a sanitary sewermanhole and wastewater mainline.WastewaterTiffany Sherrane18Mingo Rd@ Fishtrap RdRxR Crossing10/04/22 10/07/22 Railroad Crossing19Mockingbird LnStockton StMingo Rd09/19/22 10/14/22 Restore the paving leavouts Public Works Inspections Armano Beltran20Pertain St@ Mingo RdRxR Crossing10/08/22 10/09/22 Railroad Crossing21Prairie St@ Bell AveRxR Crossing10/08/22 10/09/22 Railroad Crossing22Rockhill Rd@ Rhoades RdRxR Crossing10/04/22 10/07/22 Railroad Crossing23Savage DrHayes StComer St09/29/22 09/30/22 Mill & OverlayStreetsJeremy Wilks24Union Lake RdWind River LnValencia Ln09/26/22 10/06/22 Sidewalk repairStreetsRoy San Miguel25Vintage Blvd@ Ft Worth DrRxR Crossing10/08/22 10/09/22 Railroad Crossing26Windsor DrLongfellow LnWilsonwood Dr10/04/22 10/14/22 Sidewalk repairEngineeringDustin Draper27Wintercreek Dr (1212) Green Bend DrBeechwood Dr10/03/22 10/18/22 Concrete Panel Repair StreetsRoy San Miguel Exported on October 21, 2022 11:30:03 AM CDT132